KEGG   Plasmodium falciparum 3D7: PF3D7_1101700
Entry
PF3D7_1101700     CDS       T00095                                 

Definition
(RefSeq) Pfmc-2TM Maurer's cleft two transmembrane protein
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: DUF2207 Ureide_permease RFC1
Other DBs
NCBI-GeneID: 810569
NCBI-ProteinID: XP_001347706
PlasmoDB: PF11_0025
GeneDB: PF11_0025
UniProt: Q8IIY1
Position
11:join(85629..85697,85792..86418)
AA seq 231 aa
MFHYIYKIYIFTIILCASNLFNNNVVEIGTYKLSYHNGGIQFRMLAQKNDNKKSFGNTLT
NILFKDKKKKNLDPQISSLVSLVDNMDITQEKKDKIKNLSLKYINSRDVKEKNESINELQ
KYSNNEECKEQMDSYLMHLRMQNDIKCLKRKNLWNNIGINSITLSLIIIMIMIACMFAIC
NAPQYIYVPASFLLIFIIYIVARYFPDMKIGFKKLKTKLNTFFQNKKQITK
NT seq 696 nt   +upstreamnt  +downstreamnt
atgtttcattatatttataaaatatatatttttaccataatactatgtgcatctaatcta
tttaataacaatgtagtagaaattggaacatacaaattatcataccataatggagggata
caattcagaatgttagcacaaaaaaatgataataaaaaatcattcggaaataccttaacg
aatatattgtttaaggacaaaaaaaaaaaaaatcttgatcctcaaatttcatctctagtc
agtttagtagataatatggatataactcaagaaaaaaaagataaaatcaaaaatctctca
ttaaaatatataaatagtagagatgtaaaagaaaaaaatgaatcaattaatgaacttcaa
aaatatagtaataacgaagaatgtaaagaacaaatggatagttatttaatgcatcttcgt
atgcaaaatgatataaaatgtttaaaaagaaaaaatttgtggaataatattgggattaat
tctattaccttatccttaatcattataatgataatgatagcatgtatgtttgctatttgt
aatgctcctcaatatatatatgttcctgcatcttttcttttaatttttattatctatata
gttgctcgttattttcctgacatgaaaataggttttaaaaaattaaaaacaaaattgaac
acattttttcaaaacaaaaagcaaataacaaaataa

DBGET integrated database retrieval system