KEGG   Plasmodium falciparum 3D7: PF3D7_1105000Help
Entry
PF3D7_1105000     CDS       T00095                                 

Definition
(RefSeq) histone H4
  KO
K11254  histone H4
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_1105000
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    PF3D7_1105000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CENP-T_C CENP-S TAF Histone CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 810613
NCBI-ProteinID: XP_001347737
PlasmoDB: PF11_0061
GeneDB: PF11_0061
UniProt: Q8IIV2 Q7JSX6
Position
11:complement(221818..222129)
Genome map
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEIRGVLK
VFLENVIKDSIMYTEHAKRKTVTAMDIVYSLKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaagaggtaagggaggtaaaggtttgggaaaaggaggagctaagagacacaga
aaaattttaagagataacattcaaggtattacaaaaccagccatcagacgtttagcaaga
agaggtggtgttaaacgtatttctggtttaatatatgaagaaatcagaggagttttaaaa
gttttcttagaaaacgtaattaaagattccatcatgtatactgaacacgctaaaagaaaa
accgtcactgctatggatattgtatactccttaaaaagacaaggaagaactttatatggt
tttggaggttaa

DBGET integrated database retrieval system