KEGG   Plasmodium falciparum 3D7: PF3D7_1108700Help
Entry
PF3D7_1108700     CDS       T00095                                 

Definition
(RefSeq) heat shock protein DnaJ homologue Pfj2
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ Thioredoxin Thioredoxin_6 HyaE Thioredoxin_2 OST3_OST6 Thioredoxin_4 TAF1_subA
Motif
Other DBs
NCBI-GeneID: 810650
NCBI-ProteinID: XP_001347774
PlasmoDB: PF11_0099
GeneDB: PF11_0099
UniProt: Q8IIR6
Position
11:complement(373238..374860)
Genome map
AA seq 540 aa AA seqDB search
MNVTNVVKRRKKLSYFHSLLLIIFSFFLSCARGMDYYKRLGVKRNATKEDISKAYRQLAK
EYHPDIAPDKEKDFIEIANAYETLSDPEKRKMYDMYGEDYAQGGMGGGSPGRGEHAHGFH
FDQDVVNEIFKQFAGGGGAGASGGRAGNFHFKFTSGGPSFNHFEDEYEDIYKNEVLKINS
KNIESVLNDISFSLIINFYSPTCSHCISFKKKYLKLRKKFDGYITFAVVNCQEENMLCRK
YNVKSLPQLILMRSDKTYETFYGNRTDENLTYFIKNNIPSAIIECNNQKKLDNFLTQNIE
IPKVLFFISHNDNIVMLKALSLEFKKRINIGIIYNTNYSVMKLFKKKNIKTPSLLLVDDI
DSLSGDLTQLKNFDFNILSLKLSHIVAQNRLKNNLYGHVTSYQELTKKKYESGQCHEKDS
QICFFILKLLKKNYKSFDEDIKKVANKFSSDPLKILYINIYQQPYILDSFGLSNNIQYSN
GLILVAFRPKRQKFKVYDGDVNVENVHKFVDNVVSGGIPINQNIKRSLKFVHVEQYDDEL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttacaaatgtagtaaaaagacgaaagaagttatcttattttcattcacttctt
ctgataatattttctttttttctatcatgtgctagaggcatggattattacaaaagactg
ggcgttaaacggaacgccacaaaagaagatatttcaaaagcttataggcagctagctaaa
gaatatcatccagatatagcgcccgacaaagaaaaagattttatagaaattgcaaacgcc
tatgaaacgttatcagatcctgagaaaagaaaaatgtatgatatgtatggtgaggactat
gcccaaggaggtatgggaggaggaagtcccgggagaggggaacatgcacatggttttcat
tttgatcaagatgtagtaaatgaaatatttaaacaatttgcaggaggtggtggtgcgggt
gcgagtggtggtagagcggggaattttcattttaaatttacatctggtggtcctagtttt
aatcattttgaagatgaatatgaagatatatataaaaatgaagttttaaaaataaattct
aagaatattgaatctgttttaaatgacatatcattttctttaataataaatttttattca
cctacatgttctcattgtatatcttttaaaaagaaatatttaaaattacgtaagaaattt
gatggatatataacatttgctgttgtaaattgtcaagaggaaaatatgttgtgtagaaaa
tataatgtaaaatccttaccacaattaatattaatgagatctgataaaacatatgaaaca
ttttatggtaatagaactgatgagaatttaacttattttataaagaataatattccgtct
gcaattattgaatgtaataatcagaaaaagttagataattttttaacacaaaatatagaa
atacctaaggtgcttttttttatatcgcataacgataatatcgttatgttaaaagcatta
tctctggaatttaagaagagaataaatattggtataatatataatacaaattatagtgtc
atgaaattatttaagaaaaaaaatataaagacaccatctttattacttgtcgatgatatt
gatagtttatcaggggatttaacacaattaaaaaatttcgattttaatattttgtcatta
aaattaagtcacattgttgcacaaaatagattaaaaaataatttatatggacatgtaaca
tcttaccaagaattaaccaaaaaaaaatatgaatcgggacaatgtcatgagaaggattca
caaatatgtttctttattttaaaattattaaaaaaaaattataaatcatttgatgaagat
attaaaaaggtagcaaacaaattctcaagtgaccccttaaaaattttatatattaatata
tatcaacaaccatatatattagattcttttggactatcgaataatattcaatattcaaat
ggtttaatcttggttgcctttagaccaaagagacaaaaatttaaagtatacgatggtgat
gtaaatgttgaaaatgttcataaatttgttgataatgtggttagtgggggtataccaata
aatcaaaatataaagagaagtctaaagtttgtgcatgttgagcaatatgatgatgaattg
tga

DBGET integrated database retrieval system