KEGG   Plasmodium falciparum 3D7: PF3D7_1113900
Entry
PF3D7_1113900     CDS       T00095                                 

Name
(RefSeq) mitogen-activated protein kinase 2
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfa01001]
    PF3D7_1113900
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_1113900
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_1113900
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PF3D7_1113900
Protein kinases [BR:pfa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   PF3D7_1113900
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PF3D7_1113900
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_1113900
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase APH
Other DBs
NCBI-GeneID: 810694
NCBI-ProteinID: XP_001347818
PlasmoDB: PF11_0147
GeneDB: PF11_0147
UniProt: Q7KQK7 Q25917
Structure
PDB: 
3NIE

Position
11:complement(534973..536499)
AA seq 508 aa
MLKKKKDYENADLEDCNTKEIKGYSKVGSEKNIKKKMTSIKESSSRDEEEEDANVNKNIK
KFKEGNKKDNISKNCNIVEKKNNKSKEEKINIKEAIIKNVKVPDNYEIKHLIGRGSYGYV
YLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLHDLIIPEDLLKF
DELYIVLEIADSDLKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLL
NQDCSVKICDFGLARTINSDKDIHIVNDLEEKEENEEPGPHNKNLKKQLTSHVVTRWYRA
PELILLQENYTNSIDIWSTGCIFAELLNMMKSHINNPTNRFPLFPGSSCFPLSPDHNSKK
VHEKSNRDQLNIIFNVIGTPPEEDLKCITKQEVIKYIKLFPTRDGIDLSKKYSSISKEGI
DLLESMLRFNAQKRITIDKALSHPYLKDVRKENLENFSTEKIILPFDDWMVLSETQLRYI
FLKEIQSFHADLIIPAKLNIHQKSFYNM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgttaaaaaaaaaaaaggattacgaaaatgctgatttagaggattgcaataccaaagag
ataaagggatattcaaaagtagggagcgaaaaaaatataaaaaaaaaaatgacttctata
aaagagtctagtagtagggatgaagaagaagaagatgctaatgtaaataaaaatattaaa
aaatttaaagaaggcaataaaaaagacaatatttcaaaaaattgtaatattgtagaaaag
aaaaataataaaagcaaagaagagaaaataaatatcaaagaagctattattaaaaatgta
aaggtaccagataattacgaaataaaacatttgattggtagaggatcctatggatatgta
tatttagcttatgataaaaatgcaaataaaaatgtggctataaagaaggttaatagaatg
tttgaagatttaatagattgtaaaagaatattaagagaaataacaatattgaatagatta
aagagtgattatattataagattacatgatttaattattcctgaagatttattaaaattt
gatgagttatatatagtattagaaattgcagattctgatttaaagaaattatttaaaaca
ccaatatttttaacagaacaacatgtaaaaacaatattatataatttattactaggagaa
aaatttattcacgaatcaggtataatacacagagatttaaagccagctaattgtttatta
aatcaagattgttcagtaaagatatgtgactttggtttagctagaacaattaattcagat
aaagatattcatattgttaatgatttagaagaaaaagaagaaaatgaagaaccaggtcca
cataataaaaatttaaaaaaacaattaactagtcatgtagttactaggtggtatagggca
ccagagcttatattattacaagagaattatacaaattctatagatatatggtcgactggt
tgtatatttgctgaactattaaatatgatgaagagtcatataaataatccaactaataga
tttcccttatttcctggatcttcttgttttcctttatcacctgatcataattcaaaaaaa
gttcatgaaaaaagtaacagggatcaattaaatataatatttaatgtaataggtacacca
ccagaagaagatttaaaatgtataacaaaacaagaagttattaaatatattaaattattt
cctacaagggatggtatagatttaagtaaaaaatattcatctatatctaaagaaggtata
gatttattagaatccatgttacgatttaatgctcaaaaaagaataactattgataaggct
ttatcacacccttatcttaaggatgtaagaaaagaaaatttagaaaatttctcaaccgaa
aaaataatacttccatttgatgattggatggttctatcagaaacacaacttagatatatt
ttcttaaaggaaattcaatcatttcatgctgatttaattatacctgcaaagttaaatata
catcaaaaaagtttctacaatatgtaa

DBGET integrated database retrieval system