KEGG   Plasmodium falciparum 3D7: PF3D7_1124000
Entry
PF3D7_1124000     CDS       T00095                                 

Definition
(RefSeq) endoplasmic reticulum oxidoreductin, putative
  KO
K10950  ERO1-like protein alpha [EC:1.8.4.-]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PF3D7_1124000
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PF3D7_1124000
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 810798
NCBI-ProteinID: XP_001347922
PlasmoDB: PF11_0251
GeneDB: PF11_0251
UniProt: Q8IIC3
Position
11:join(948591..949171,949413..949756,949921..950147,950359..950462,950566..950707)
AA seq 465 aa
MKICLIPVFLSLIIYVILFLKGKKIGDLYITEHLRNKFENILLYFNIFEVQYPESYLNNE
KLLGLHVRDIEKDAYRAYPILKELKQKDYFRIFKVNLHLSCKVFLKGNEKCKEIKKCSVC
ECEQDEIPYNFRTNEIEIIENKMTNEDLKKTFIESKLYKDILGIYAPSNEGFISYVDLVY
NSPSFTAYEGRNIWNMIYKENCFQNEKSECEEMNSFYKIISGMQSNIAVLSSEYFYLKND
FLFGEIQINNKFNNDYFKNLNYDYSVTFFKEKIGLYPERIENLYFTFAILLRSMCRLKSL
FKQCKCNSGYEQNDKEAVRLLDDLLENFYHSCSSKEFLEPLFPQHGKDILSKFMNITNIL
DCVPCVKCRLHGKLKTTALQIALVEGVSDEHIGSLERNEITALINALYYFADSILIINKF
EDRLKLKKTIFIFYVLSFSLFLFLVIYSIIFLTIRNYKKKKKKVA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaaaatttgcttaataccagtatttttatccttaataatatatgttattttattttta
aaagggaagaaaataggtgatttatatattactgagcatttaagaaataagtttgaaaat
attttattgtattttaatatttttgaagtacaataccctgaaagttatttaaataatgaa
aaattattaggattacatgtaagggatattgaaaaagatgcatacagagcatatcctata
ttaaaagaattaaaacaaaaagattattttagaatattcaaagttaatttacatttatca
tgtaaagtatttttaaaaggtaatgaaaaatgtaaagaaataaaaaaatgtagtgtttgt
gaatgtgaacaagatgaaataccatataattttagaactaatgaaatcgaaattatagaa
aataaaatgacaaatgaagatctaaaaaaaacttttatagaaagtaaattgtataaagat
attttaggaatatatgcaccttcaaatgaaggatttatatcttatgtagatcttgtttat
aattctccatcctttacagcatatgagggtagaaatatatggaatatgatttacaaagaa
aattgttttcagaatgaaaaaagtgaatgtgaagaaatgaacagtttctataaaataatt
tctggaatgcaatccaatattgctgttttgtcatcagaatatttttatttaaagaacgat
tttctatttggtgaaatccagataaataataaatttaataatgattattttaaaaatcta
aattatgattatagtgtgactttttttaaagaaaaaataggtctatatccagaaagaata
gaaaacttatattttacttttgcaattttgttaaggtctatgtgccgtcttaagtcctta
tttaaacaatgtaaatgtaattcaggctatgaacagaatgataaagaagcagtgagacta
ttagatgacctattagaaaatttttatcattcctgttcctcaaaagaatttctggaacct
ctttttccacaacatggaaaagatatattatcaaaatttatgaacataacaaatattctt
gattgtgtaccttgtgttaaatgtaggctacatgggaagttaaaaacaacagcattgcaa
atagcacttgtggaaggagtgagtgacgaacatattggctcacttgaacggaacgaaatc
actgccctcataaatgccctatactactttgcagattctatattaataataaacaaattt
gaggacagactaaaattaaaaaagaccatttttattttttacgtattatccttttctcta
tttttattcctagtaatatattcaataatttttctaactattcgaaattacaaaaaaaaa
aaaaaaaaagtagcataa

DBGET integrated database retrieval system