KEGG   Plasmodium falciparum 3D7: PF3D7_1204300
Entry
PF3D7_1204300     CDS       T00095                                 

Name
(RefSeq) eukaryotic translation initiation factor 5A
  KO
K03263  translation initiation factor 5A
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pfa03012]
    PF3D7_1204300
Translation factors [BR:pfa03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    PF3D7_1204300
SSDB
Motif
Pfam: eIF-5a EFP_N
Other DBs
NCBI-GeneID: 811095
NCBI-ProteinID: XP_001350451
PlasmoDB: PFL0210c
GeneDB: PFL0210c
UniProt: Q8I603
Position
12:complement(205491..205976)
AA seq 161 aa
MSDHEMYDNIDAGASQTYPVQAGAIKKNGHVMLKEHPCKVVDYSTSKTGKHGHAKAHIVG
IDIFTGRKYEDICPTSHNMDVPVVKRTELQLIDITEDGFVSLLYDNGDTKDDLSLPKDTE
GNLDEVAKQIRNLFDNGKSVLVSVLSACGQEKIIAAKELSS
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcagatcatgaaatgtacgataatattgatgctggagcatcacaaacgtaccctgtg
caagcaggtgcaataaaaaaaaatggtcatgtaatgttgaaagagcatccatgtaaggtg
gttgattattccacatcaaaaacaggaaagcatggtcatgcaaaagcacacattgtaggt
atagatatatttacaggaaggaaatatgaagatatatgtccaacatctcataatatggat
gtacctgttgtaaaaagaactgaattacaattaattgatattacagaagatggttttgtg
tctcttttatatgataatggagataccaaagatgatttaagtttaccaaaagataccgaa
ggaaacttagatgaagtagctaaacaaatacgaaatttattcgacaatggaaaatctgtt
ttggttagtgttctttcagcttgtggacaagaaaaaattattgcagcaaaggaattatca
tcataa

DBGET integrated database retrieval system