KEGG   Plasmodium falciparum 3D7: PF3D7_1211800Help
Entry
PF3D7_1211800     CDS       T00095                                 

Definition
(RefSeq) polyubiquitin
  KO
K08770  ubiquitin C
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pfa04121]
    PF3D7_1211800
Ubiquitin system [BR:pfa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   PF3D7_1211800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 811170
NCBI-ProteinID: XP_001350526
PlasmoDB: PFL0585w
GeneDB: PFL0585w
UniProt: Q7KQK2 Q9U5M1
Position
12:join(526109..526136,526663..527780)
Genome map
AA seq 381 aa AA seqDB search
MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttttgtcaaaacattaactggaaaaactataacccttgacgtcgagccatct
gacaccatagagaatgttaaggcaaagattcaagataaagaaggaattccacctgaccaa
caaagattaatatttgcaggaaaacaattagaagatggaagaactttatcagattataac
attcaaaaggaatctacattacacttagtgttaagattaagaggtggtatgcaaattttt
gtcaaaacattaacaggaaaaacaataactcttgacgtcgagccatctgacaccattgaa
aatgttaaggcaaagattcaagataaagaaggaattccacctgaccaacaaagattaata
tttgcaggaaaacaattagaagatggaagaactttatcagattataacattcaaaaggaa
tctacattacacttagtgttaagattaagaggtggtatgcaaatttttgtcaaaacatta
acaggaaaaacaataactcttgacgtcgagccatctgacaccattgaaaatgttaaggca
aagattcaagataaagaaggaattccacctgaccaacaaagattaatatttgcaggaaaa
caattagaagatggaagaactttatcagattataacattcaaaaggaatctacattacac
ttagtgttaagattaagaggtggtatgcaaatttttgtcaaaacattaacaggaaaaaca
ataactcttgacgtcgagccatctgacaccattgaaaatgttaaggcaaaaattcaagat
aaagaaggaattccacctgaccaacaaagattaatatttgctggaaaacaattagaagat
ggaagaactttatcagattacaatattcaaaaggaatccactctacacttagtattaaga
ttaagaggtggtatgcaaatttttgtcaaaacattaacaggaaaaacaataactcttgac
gtcgagccatctgacaccattgaaaatgttaaggcaaagattcaagataaagaaggaatt
ccacctgaccaacaaagattaatatttgcaggaaaacaattagaagatggtagaacccta
tcagattacaatattcaaaaggaatccactctacacttagtgttaagattaagaggtggt
ttttaa

DBGET integrated database retrieval system