KEGG   Plasmodium falciparum 3D7: PF3D7_1212000Help
Entry
PF3D7_1212000     CDS       T00095                                 

Definition
(RefSeq) glutathione peroxidase-like thioredoxin peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00480  Glutathione metabolism
pfa00590  Arachidonic acid metabolism
pfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PF3D7_1212000
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PF3D7_1212000
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PF3D7_1212000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 811172
NCBI-ProteinID: XP_001350528
PlasmoDB: PFL0595c
GeneDB: PFL0595c
UniProt: Q8I5T2
Position
12:complement(join(534912..535061,535231..535401,535619..535915))
Genome map
AA seq 205 aa AA seqDB search
MFFSMFIKFILPISFICYNFGKKFNMFSYFQKIKVSEQELLSSIYDYEVKDLSGSNVSMS
KFKNKVLIIFNSASKCGLTKNHVEQFNKLHEKYNARGLEILAFPTSQFLNQEFDNTKDIC
TFNEKNKIKYNMFSPIEVNGDNTHPLFKYLKKNCDSMHDENGTLKSIGWNFGKFLVDKNG
EVVNYFSPKTNPLDLEKIIIQLLQK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctcaatgtttattaaattcattttacctatatcttttatatgctacaatttt
ggaaagaaatttaatatgtttagttattttcaaaaaatcaaagtatcagaacaggaatta
ttatcatccatttatgattatgaagtaaaggatttatcaggatcaaatgtatccatgtct
aaatttaaaaacaaagttttgattatttttaattctgcttcaaaatgtggattaacaaaa
aatcatgtagaacaatttaataaattacatgaaaaatataacgcaagaggattggagatc
ttagctttccccacaagtcaatttttaaatcaagaatttgacaacacaaaagatatttgt
acatttaatgaaaagaacaaaataaaatataatatgttttcacccattgaagtaaatggg
gataatacacacccactctttaaatacttaaaaaaaaattgtgattcgatgcatgatgaa
aatggaacgttaaaaagtatcggatggaattttggaaaatttctcgtcgataaaaatgga
gaagttgtaaattatttttcacccaaaacaaacccgttagatttagaaaaaattataatt
caattactacaaaaatga

DBGET integrated database retrieval system