KEGG   Plasmodium falciparum 3D7: PF3D7_1231100
Entry
PF3D7_1231100     CDS       T00095                                 

Definition
(RefSeq) ras-related protein Rab-2
  KO
K07877  Ras-related protein Rab-2A
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_1231100
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_1231100
   04031 GTP-binding proteins [BR:pfa04031]
    PF3D7_1231100
Membrane trafficking [BR:pfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    PF3D7_1231100
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_1231100
  Exosomal proteins of other body fluids (saliva and urine)
   PF3D7_1231100
  Exosomal proteins of colorectal cancer cells
   PF3D7_1231100
GTP-binding proteins [BR:pfa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    PF3D7_1231100
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU Gtr1_RagA DNA_pol_E_B AAA_22 MEKK4_N DAP3
Other DBs
NCBI-GeneID: 811352
NCBI-ProteinID: XP_001350706
PlasmoDB: PFL1500w
GeneDB: PFL1500w
UniProt: Q8I5A9
Position
12:join(1276257..1276305,1276437..1276575,1276750..1276833,1276973..1277174,1277287..1277355,1277491..1277542,1277688..1277734)
AA seq 213 aa
MSPYEYLFKYIIIGDTGVGKSCLLLQFTDKRFRADHDLTIGVEFGARLINLDNKQIKLQI
WDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLNRWLDEVRQNSNPHMAIILVGN
KCDLERREVSAEEGAQFARQNGLIFLETSAKTAKNVEEAFLYTARKIYDNILEDVYDLSN
ESYGIKYGPNSQYSRVKLDIPSMPESRSGFSCC
NT seq 642 nt   +upstreamnt  +downstreamnt
atgtctccttatgaatatttgtttaaatatataataattggtgatacaggggttgggaaa
agttgtcttttattacaatttacagataaaagatttagagcagatcatgatttaacaata
ggtgtggaatttggagcacgattaattaatttagataataaacaaataaaacttcaaata
tgggacactgctggtcaagaatcatttagatctataacaaggtcatattatcgtggagca
gcaggagccttattagtttatgatattactcgaagagaaacatttaatcatttgaataga
tggttagatgaagtcagacaaaattcaaatccacatatggctataattttagtaggaaat
aaatgtgatttagaaagaagagaagtatcagcagaagaaggtgcacaatttgctagacaa
aatggattaatatttttggaaacatctgcaaaaacagccaaaaatgttgaagaagcattt
ttatatactgcaagaaaaatatatgataatatcttagaagacgtttatgatctaagcaat
gaatcttatggtattaaatatggaccaaatagtcaatactcaagagtgaaattagatata
ccttctatgccagaatcaagatcaggatttagctgttgttaa

DBGET integrated database retrieval system