KEGG   Plasmodium falciparum 3D7: PF3D7_1246900Help
Entry
PF3D7_1246900     CDS       T00095                                 

Definition
(RefSeq) RAC-beta serine/threonine protein kinase
  KO
K08286  protein-serine/threonine kinase [EC:2.7.11.-]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PF3D7_1246900
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     PF3D7_1246900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C
Motif
Other DBs
NCBI-GeneID: 811502
NCBI-ProteinID: XP_001350854
PlasmoDB: PFL2250c
GeneDB: PFL2250c
UniProt: Q8I4W3
Position
12:complement(join(1943358..1944609,1944848..1945803))
Genome map
AA seq 735 aa AA seqDB search
MNHINFFKCFSERNREKNNIPSYTSDSTQQQKKKKDYKKYFNFLITKKNKRETHKSTNGE
EDYEHILYKNKTNVNIKEDNLKKDFDEYKEKKVNINGNVNNKKYSDKTTHINSVMTLEKN
MILNNDNNTLNNNKKKKKKKKKKKKKSYSVEGTKLLKIKEYKKRKFFKIHFFLNRKNKNN
DKREDPSKNIHDKRDISLEKNIINYNKYDMQFSFESVASNNINNNTHFKKDKKIINLKKY
NNAHRDLYKNNYTNVFLCKKSFSDDEYKNKNIINNDSPCKFQKQNYDSKSKQGIYKANYR
RFRDSCRQKLDLYKIHNRRNDVLFYGKGALKEIKKSMFDENKENAFYKDNMANCALNNMD
NKNRMENECLYKYDEKEEIGKKRLRNSMSLSYERKKRIRPESFNYLKVIGEGSYGKVMLV
KHVQNKKLYAMKILRKENILSRNQLEHTKVERNILKCVSHPFIVKMYYAFQTKQKLYFIL
EYCPGGELFFHLSKLREFSEETAKFYSSEIILALEYLHDLNIIYRDLKPENVLLDELGHI
RLTDFGLSKEGITETNLTKSLCGTPEYLAPEIIEQKGHGKAVDWWSLGIMLYEMLTGELP
FNNTNRNVLFESIKYQKLNYPKNLSPKAVDLLTKLFEKNPKKRLGSGGTDAQEIKKHPFF
KNINWNDVLYKKVKPPFKPKLFNQLDLQNFDKQFLNMPLKYSDQHENTNITFADPKNFVV
QDFNYNYYEFSGQQK
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatataaactttttcaaatgtttttctgaacgcaatcgagagaaaaataatatc
ccgtcctacacgtccgactctacacaacaacagaaaaaaaaaaaagactataaaaaatat
ttcaactttttaataacaaaaaagaataaaagagaaactcataaaagcacaaatggcgaa
gaagattatgaacacattttatataagaataaaacgaatgttaatattaaagaagataat
ttaaaaaaagattttgatgagtataaagaaaagaaggtaaatataaatggaaatgtgaat
aataaaaaatatagtgacaagactacacatataaatagtgttatgaccctcgaaaaaaat
atgatactaaataatgataataataccctaaataataataaaaaaaaaaaaaagaaaaaa
aaaaaaaaaaaaaaaaaaagttatagtgttgaaggtaccaaattattaaaaatcaaagaa
tataaaaaaaggaaattttttaaaattcatttttttttaaatagaaaaaataaaaataat
gacaaaagggaagatccatctaaaaatatacatgataaaagagatatttctttagaaaaa
aatataataaattataataaatatgatatgcaattttcattcgaatcagttgcaagtaac
aatattaataacaacacacattttaaaaaagataaaaaaataattaatttaaaaaaatat
aataacgcccatagagatttatataaaaacaattatactaacgtattcttatgtaagaaa
agtttttctgatgatgaatataaaaacaaaaatattataaataatgattctccttgtaaa
tttcaaaagcaaaattatgatagtaaatccaaacaaggaatatataaagcaaactatcgt
aggttcagagatagttgtaggcaaaagttggatctatataaaatacacaatagaagaaat
gatgttcttttttacgggaaaggagctttgaaagaaataaagaagagcatgtttgatgaa
aacaaagaaaatgctttttataaagacaatatggctaattgcgctctcaataatatggat
aataaaaatagaatggaaaatgaatgtctatataaatatgatgaaaaagaagaaatagga
aaaaagagactacgtaactctatgtccttatcatatgaaaggaaaaaaagaataagacct
gaaagttttaactaccttaaagttataggagaaggatcatatggaaaagtaatgctagta
aaacatgttcaaaataaaaaattatatgcaatgaaaattttaagaaaagaaaatatatta
tcaagaaatcaactagaacacactaaagtagaaagaaatatactgaaatgtgtttctcat
cctttcattgtaaaaatgtattatgcttttcaaactaaacagaaattatattttatatta
gaatattgtcccggtggagaactattttttcatttatctaaattaagagaattttctgaa
gaaacagcaaaattttattcttctgaaattatattagctcttgaatatttacatgattta
aatattatttatagagaccttaaaccagaaaatgtattattagatgaattaggacatata
agattaacagactttggtttatcaaaagaaggtattacagaaaccaatttaactaaatca
ttatgcggaactccagaatatttagctccagaaataattgaacaaaagggacatggaaaa
gctgttgactggtggagcttaggtattatgttatatgaaatgttaacaggagaattacct
tttaataatacgaacagaaatgttttattcgaaagtattaaatatcaaaaactaaattat
ccaaaaaatttatcaccaaaagctgtagacttattaacaaaattatttgaaaaaaatcca
aagaaaagattaggctcagggggaacggatgcacaagaaatcaaaaaacatccattcttt
aaaaatattaattggaatgatgttctatataaaaaagtcaaacctcctttcaaaccaaag
ttattcaatcaattagatttgcaaaattttgataaacaattcttaaatatgcctctaaaa
tattcagatcagcatgaaaatactaatattacatttgctgatccaaaaaattttgttgtt
caggattttaattacaactattatgaattttcaggtcaacaaaaatga

DBGET integrated database retrieval system