KEGG   Plasmodium falciparum 3D7: PF3D7_1248100Help
Entry
PF3D7_1248100     CDS       T00095                                 

Definition
(RefSeq) methyltransferase, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_25 Methyltransf_11 Methyltransf_4 Methyltransf_PK Enkurin Presenilin
Motif
Other DBs
NCBI-GeneID: 811513
NCBI-ProteinID: XP_001350865
PlasmoDB: PFL2305w
GeneDB: PFL2305w
UniProt: Q8I4V3
Position
12:1975172..1976437
Genome map
AA seq 421 aa AA seqDB search
MRAFFDSDIVINFTLSEEAIEKEKRIIENNKRLVRDCQRDKLLCDVKKNWDKFYNQYKTN
FFKDRKWLKVEFDHIFKEGLKNYDETIDKSEIRKNEQTKLVLEIGCGVGNSLIPLLMEYE
DCNFIGIDFSKHAINFLNDKWEKLVSINNKLKYENMTVESNMKDKYEKETNKNVELDGKF
NCAFENSLNDICQKEIKNKNILLENNINDGTQNNNDNNNDNNDNNDNNNDNNNDNNNDNN
NDNNNNNNNNDCHILEEQNCTDIYELKSYKKFGNLIKTCVVDITSSDDDNSNFICEYGSV
DIILLIYVLSAVQPDKMINVINNCYKYLKKGGYVLLRDYGLYDLTQVRFAIKKEKNISEN
FYVRGDKTFVYFFKTEELHDLFCKNGQFEEVQNKYITRIVKNRKRNLEMKRIWVQSIFRK
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttttttcgattctgacattgtcataaattttaccctctcagaagaagcaatt
gaaaaagaaaaaagaattatagaaaataataaaagactagttcgagattgtcaaagagat
aaattgctatgtgatgtgaaaaaaaattgggataaattttataaccaatataaaacaaat
ttttttaaagataggaaatggttaaaagtcgaatttgatcatatatttaaagaaggttta
aaaaattatgatgaaactattgacaaaagtgaaataagaaagaatgagcaaaccaaactt
gttttagaaattggatgtggtgtgggaaattcattaattcctcttttaatggaatatgaa
gattgtaattttataggaatcgatttttcaaaacatgcgattaactttttaaatgataaa
tgggaaaaacttgtaagtatcaataataagttaaaatatgaaaatatgactgtagaaagt
aatatgaaggataagtatgaaaaggaaacaaataaaaatgttgaattggacggtaaattt
aattgtgcttttgaaaattcgttaaatgatatatgtcaaaaggaaataaagaataaaaat
attttattagaaaataatataaatgatggcacccaaaataataatgataataataatgat
aataatgataataatgataacaataatgataacaataatgataacaataatgataacaat
aatgataacaataataataataataataacgattgtcatatattggaggaacaaaattgt
acagatatttatgaattgaaaagttataaaaaatttggaaatttgattaaaacatgtgta
gtagatattacttcatcagatgacgacaattctaattttatttgtgaatatggttccgtt
gatattattttattaatctatgtattatccgctgtccaacctgataaaatgataaatgta
ataaataattgttataaatatttaaaaaagggtggttatgttttattaagagattatggg
ttatatgatttaacacaagtacgttttgccattaaaaaagaaaaaaatatatctgaaaat
ttttatgtaagaggtgataaaacatttgtgtatttttttaaaacagaggaattacatgat
ctgttctgtaaaaatggacaattcgaagaagtacaaaataaatatataaccaggattgtt
aagaataggaagagaaatttggagatgaaaagaatatgggttcaatccatatttaggaag
atataa

DBGET integrated database retrieval system