KEGG   Plasmodium falciparum 3D7: PF3D7_1248500
Entry
PF3D7_1248500     CDS       T00095                                 

Definition
(RefSeq) uncharacterized protein
  KO
K24205  protein lifeguard
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    PF3D7_1248500
SSDB
Motif
Pfam: Bax1-I
Other DBs
NCBI-GeneID: 811517
NCBI-ProteinID: XP_001350869
PlasmoDB: PFL2325c
GeneDB: PFL2325c
UniProt: Q8I4U9
Position
12:complement(1983480..1984349)
AA seq 289 aa
MADTNGRNSIVGQNYGAAYNQGGYNYSQNKDKENYDKSNSGQKGYYYDARTNITANGGLY
DEFSLNEFSSTKIRHGFIRKVYSILSLQLLLTFGCAALAVLYKPFNAFVLTYYSPLFIVG
VLLSLPIMIALACAPHMARKYPSNYFILLSITLGMSLIVTLASARTNSEIFFYAFGTTAV
VVIGLTIFAFQTKWDFTGWYVFLFMAFLILIVMGIIGIFVRSKAFNLVFAGISAFILSIS
IIVDTQLIIGGKHKKYEFSVDDYIFATLALYMDIINLFLSILSIFSNAE
NT seq 870 nt   +upstreamnt  +downstreamnt
atggctgatacaaatggaagaaatagtatcgtagggcagaattatggagctgcttataac
caaggaggatataattattcacaaaataaagacaaagaaaattatgacaaatcaaacagt
ggacagaaaggatattattatgatgccagaacaaatataacagcaaatggtggattgtat
gatgaattttcacttaacgaattttcatcaacaaaaataagacatggatttataagaaaa
gtatattccatattatctcttcaattattattaacatttggatgtgcagcattagcagta
ttatataaaccatttaatgcttttgttcttacctattattctcctttatttatagttggt
gttttattaagtttgcctattatgatagctttagcttgtgcacctcatatggcaagaaaa
tatccaagtaattattttattttattatccataactttaggtatgtcattaattgtcaca
ttagcaagcgcaagaacaaactcagaaatatttttttatgcctttggtacaacggcggtt
gttgttattggtcttaccatctttgctttccaaaccaaatgggattttacagggtggtat
gtattcttatttatggcctttttaatcttaatagttatgggaattatcggaatatttgtt
agaagtaaagccttcaatctagtctttgcaggcataagcgcattcatattatctatctcc
attattgtagacacacaacttatcataggaggaaaacacaaaaaatatgaattctcggtt
gatgattatatttttgctactttagctttatacatggacattattaatttattcctttct
attttgtccatattctcaaacgcagaatga

DBGET integrated database retrieval system