KEGG   Plasmodium falciparum 3D7: PF3D7_1304200.1
Entry
PF3D7_1304200.1   CDS       T00095                                 

Definition
(RefSeq) CorA-like Mg2+ transporter protein, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: CorA Cbl_N LIN52
Other DBs
NCBI-GeneID: 813788
NCBI-ProteinID: XP_002808996
UniProt: C0H599
Position
13:complement(join(226669..226805,227021..228262,228846..228873))
AA seq 468 aa
MLTCFLFYIYEKKASNKKYDYDEIDLNDDDDDIIDNKSFDKNNYSYNIKNRLFKHYKKVH
DNGDCLSRKENSINSSTLMNREKSSINDENDTKSRLRCSLCHKNESKIKLEGIMNENDYL
IQINKLRRHVIIEIFGGKCFIREYLCTEFLRRIKHCCHINYVKYNVGLINYRDCKQLLAD
NNNIASIEARLNSILVSLPPLTCVILHSSVFLVVKEDLIRDDLIKKLCSVSKKFINSYKP
DMKKSEQRPFEFCALECIFSSALEHLNAEMKLLNKDFADIKFSLKVTKYQDILSNLHNLK
EPTNILINKINSFIKAFHDVSENHMDLKKMELTRCYFNPNINEEDNNNNNNKEHPNQDLE
MLFEYFDQELNQLHDQVKHLYDLMINLENKIISDLSLSRNNLIRMDIVISLINSGFGIGT
LITGVFGMNLKIRLEEHDYAFLYVTSLVIVLCLMTVIMSVYFFKCIRL
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgttaacttgtttcctgttctatatatatgagaagaaggcatcaaataagaaatatgac
tacgacgagatagatttgaatgatgatgatgatgatattatagataacaaaagttttgat
aagaataattattcttataatataaagaatcgtttatttaaacattataagaaggtacat
gacaatggggattgtttatctaggaaggaaaattcaataaacagttctactttaatgaat
agagagaagagttctattaatgatgagaatgatacgaagagtagattaagatgttcttta
tgtcataagaacgagtcgaaaataaaattagaaggtataatgaatgagaatgattattta
atacaaataaataaattaagaagacatgtaataattgagatatttggtgggaaatgtttt
attagagaatatttatgtactgaatttttaagaagaataaaacattgttgtcatataaat
tatgtaaaatataatgtaggtttaataaattatcgtgattgtaaacaattattggctgat
aataataatattgctagtatagaagctcgtttaaattctatattagtttctttaccacct
ttaacttgtgttatattacattcaagtgtttttttagttgtaaaagaagatttaataaga
gatgatttaataaaaaaattatgttcagtatctaaaaaatttataaattcgtataaacct
gatatgaaaaaatcagaacaaagaccatttgagttttgtgcacttgaatgtattttttcg
agtgccttagagcatttaaacgcagaaatgaaattattaaataaagattttgctgatatt
aaattttcattaaaggtaacaaaatatcaagatatcttaagtaatttacataatttaaaa
gaacctacaaatatacttatcaataaaattaattcttttattaaagcttttcatgatgta
tcagaaaatcatatggatttaaaaaaaatggaattaacaagatgttattttaatcctaat
attaatgaggaagataataataataataacaataaagagcatcctaatcaagatttagag
atgttgtttgaatattttgatcaagaattgaatcagttgcatgatcaagttaagcactta
tatgatttaatgataaatctggagaataaaattatatccgacttgtctttatcaagaaat
aatttgataagaatggatatagtcataagtttgatcaattcgggttttggtataggaacc
ttaataacaggagtttttggtatgaacttaaaaatacgtctggaggagcacgattatgca
tttctttacgttaccagccttgtgattgtattatgtttgatgactgtaattatgtctgtt
tacttttttaagtgtatacgtctttaa

DBGET integrated database retrieval system