KEGG   Plasmodium falciparum 3D7: PF3D7_1311400
Entry
PF3D7_1311400     CDS       T00095                                 

Definition
(RefSeq) AP-1 complex subunit mu-1
  KO
K12393  AP-1 complex subunit mu
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_1311400
Membrane trafficking [BR:pfa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    PF3D7_1311400
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s SPK
Other DBs
NCBI-GeneID: 814040
NCBI-ProteinID: XP_001349842
PlasmoDB: PF13_0062
GeneDB: PF13_0062
UniProt: Q8IEK4
Position
13:487511..488824
AA seq 437 aa
MACISAIFIIDLKGKVIINRNYRGEVNVNLTEVFYNCVIDQEDNLIKPIFHVNGLTYCWV
AHNNIYFLAVTRKNSNATLIIAFLYKLIQVLKDYFKVLEEESIKDNFVITYELLDEMIDN
GFPQLSEVKILREYIKNKAHQLTVNNFKIPSALTNSVSWRSEGIKYKKNEIFLDVVESLN
IIISSNGTVLRSEILGCLKMKSYLSGMPELKLGLNDKLLFNKNLNNYPNSSNNNLNNKTK
LVELEDIKFHQCVRLSKFENDRTISFIPPDGIFNLMTYRLSTHVKPLFWLDINITKKSLT
KIEYNVKAKSQFKNKSIANNVEFHLPVPADVDSPHFQTYIGTVKYYPDKDILIWKIKQFQ
GQKEYIMNAQFGLPSIVSNENKDLYYKRPVNVKFEIPYFTVSGITVRYLKIIEKSGYQAL
PWVRYITQNGDYQVRMS
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcatgtataagcgctatctttataattgatttaaaaggaaaagtaataattaataga
aattatcgaggagaagtaaatgtaaatttaacagaggtgttttataattgtgttattgat
caagaagacaatttaataaaaccaatatttcatgttaatggtttaacatattgttgggta
gctcataataatatatactttttagcagtaacacgtaagaatagtaatgctacattaatt
atagcatttttatataagctcatacaagtattaaaagattattttaaggtattagaagaa
gaaagtattaaagataattttgtaatcacatatgaattattagatgaaatgattgataat
ggtttccctcaattaagtgaagtaaaaattttaagagaatatataaaaaataaagctcat
caactaacagttaataattttaaaataccttcagctttaacaaattctgtatcatggaga
agtgaaggtattaaatataaaaaaaatgaaattttcttagatgttgttgaaagcttaaat
attattatatcttctaatggaacagtattaagaagtgaaattttaggatgccttaaaatg
aaatcctatttatcaggtatgcctgaattaaaattaggattaaatgataaactacttttt
aataaaaatcttaataattatccaaattcatcaaataataatcttaataataaaacaaaa
ctagtcgaattagaagatattaaatttcatcagtgtgttagattatcaaaatttgaaaat
gatagaactatttcatttataccacctgatggtatttttaatttaatgacgtatcgtcta
agtactcatgtcaaaccattattctggctagatattaatatcacaaagaaatccctcaca
aaaatcgaatataatgtaaaagcaaaatcacaatttaaaaataaaagcatagcaaataat
gtagaatttcatctacccgtacctgctgatgttgattcaccacattttcaaacatatata
ggaacagtcaaatattatcctgataaagacatactaatatggaaaattaaacaattccaa
ggacaaaaggaatatattatgaatgcacaattcggtttaccttccattgtctcaaacgaa
aataaagatctttattataagagaccagtaaatgtgaaatttgaaatcccttatttcact
gtctcaggtattacagtaaggtatttaaaaattatagaaaaaagtggttatcaagccttg
ccctgggtcaggtatataacgcaaaatggcgactatcaggtcagaatgtcctag

DBGET integrated database retrieval system