KEGG   Plasmodium falciparum 3D7: PF3D7_1320500Help
Entry
PF3D7_1320500     CDS       T00095                                 

Definition
(RefSeq) SNARE protein, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1664 Tropomyosin MCPsignal Mce4_CUP1 NPV_P10 DUF2203
Motif
Other DBs
NCBI-GeneID: 813661
NCBI-ProteinID: XP_002809023
PlasmoDB: MAL13P1.113
GeneDB: MAL13P1.113
UniProt: C0H5C6
Position
13:join(843639..843686,843965..844079,844330..844596,844674..844729,844850..844912,845025..845111)
Genome map
AA seq 211 aa AA seqDB search
MEEQNFYNKSTYSKRKKISEIEKKCEESLNEILRSASEAKEISKKAEEELQYQTEQIKHI
NNETDSIQENLKQTEYHLQGIKYWWKNIHSFLGLNSFNNNEDIKTKKAVVNNAKYNPKNN
FNDNYTKNNDNYKTSLNTKTPSQRKGTFDEKYENDLNTLSSMLDELHTRALVMGNTINEQ
NKMLNNVNEKMGHNIDKIRDQQKMMKEIMKK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacaaaatttttataataaatctacctattccaaaagaaaaaaaataagtgaa
attgaaaaaaaatgtgaagaaagtttaaatgaaatattaagatctgccagtgaagccaaa
gaaatttcaaaaaaagctgaagaagaattacaatatcagacagaacaaataaaacacata
aataatgagacggatagcatccaagagaatttaaaacaaacagaatatcatttacaaggt
ataaaatattggtggaaaaatattcattcctttttaggattaaatagttttaataataat
gaagatattaaaacaaaaaaagctgtcgtaaataatgctaaatataatccaaagaataat
tttaatgataattacacaaaaaataatgacaattataagacctccctaaatacaaaaaca
ccgtcacaaagaaaagggacatttgatgaaaaatacgagaatgatttaaatactttatct
tcgatgctggatgaattgcataccagagctctggttatggggaataccataaatgaacag
aataaaatgttaaataatgttaatgaaaaaatgggacacaatattgataagatcagggat
caacaaaaaatgatgaaagagattatgaaaaagtag

DBGET integrated database retrieval system