KEGG   Plasmodium falciparum 3D7: PF3D7_1333700
Entry
PF3D7_1333700     CDS       T00095                                 

Definition
(RefSeq) histone H3-like centromeric protein CSE4
  KO
K11253  histone H3
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_1333700
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_1333700
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    PF3D7_1333700
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_1333700
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S
Other DBs
NCBI-GeneID: 814155
NCBI-ProteinID: XP_001350068
PlasmoDB: PF13_0185
GeneDB: PF13_0185
UniProt: Q8IDZ1
Position
13:complement(1379109..1379621)
AA seq 170 aa
MVRTKKNIPNHNPLNAFNRDKSFKTNKTLPNRTVHHGISSKTTNINRPSVNRGGINEVAQ
KNLHRTNIRKPHRYRPGVLALKEIRAYQASTQLLIPKIPFVRVVKEITRLFELPDEQFRY
TPEALLALQTASEAYLVSLFEDAYLCSLHANRVTLMPKDIHLARRIRGRD
NT seq 513 nt   +upstreamnt  +downstreamnt
atggtgagaacaaaaaagaatataccaaatcataaccccttaaatgcatttaatagggac
aagtcatttaaaacaaacaaaacattaccaaatagaacagtacaccatggaattagttcc
aagactactaatataaacagacccagtgtaaatagaggaggtataaatgaagttgcacaa
aaaaacttgcacaggacaaatataaggaaaccccatagatacaggccaggtgtattagca
ttaaaagaaataagagcatatcaagcatcgactcaattattaatacctaaaattccattt
gttcgagtagtaaaagaaattacaagattatttgaattaccagatgagcaatttcgttat
acacctgaagcattattagctttacaaacagcatcagaagcatatttggttagtttattt
gaggatgcttatttatgttcattacatgcaaacagagtaacacttatgcccaaagatatt
catttagctagaagaatacgcggaagagactaa

DBGET integrated database retrieval system