KEGG   Plasmodium falciparum 3D7: PF3D7_1337100
Entry
PF3D7_1337100     CDS       T00095                                 

Name
(RefSeq) protein kinase 6
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfa01001]
    PF3D7_1337100
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pfa03032]
    PF3D7_1337100
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_1337100
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     PF3D7_1337100
Protein kinases [BR:pfa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   PF3D7_1337100
DNA replication proteins [BR:pfa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    PF3D7_1337100
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PF3D7_1337100
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 813740
NCBI-ProteinID: XP_001350099
PlasmoDB: MAL13P1.185
GeneDB: MAL13P1.185
UniProt: Q8IDW1
Position
13:join(1495259..1495319,1495464..1495613,1495760..1495839,1495955..1496301,1496433..1496466,1496612..1496698,1496890..1496989,1497182..1497240)
AA seq 305 aa
MNRIDISNFDFLYVIGKGTYGIVYKALDKKENNFVAIKKIINLCDENYGISKCILRELTI
LQKIKHKNIINLKYVFYGKDIEDKLKGENLENSCLYLAFEYCDIDLFNLIKKHNLNIKEI
KYIIFELLLALSYFHSNNYIHRDIKPENIFITSEGEIKLGDLGMSVEKSDHMTPTVVTLW
YRAPEILLKSTNYDQKVDIWSLGCLFMELIQGRPLFPGKNDCTQLELIYLLLGDKDKLTT
VDKERKDMFPYFEINMLKDAIDDEHTLDLISKMLIYDPNYRISSKEALKHPCFQDIEQVK
FSYNF
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaatagaattgatatatcgaattttgattttctatatgtaataggaaaaggaacttat
ggaatagtatataaggccttagataaaaaagaaaataactttgttgcaataaaaaaaatt
ataaatctttgtgatgaaaattatggaataagcaaatgtatattaagagagttgaccata
ctacaaaaaatcaaacacaaaaatataataaatttaaaatacgttttttatggaaaagac
atagaagataaattgaaaggagaaaacctggaaaattcatgtttatatttggccttcgaa
tattgcgatatagatttatttaatttaattaaaaagcataatttgaatattaaagaaata
aagtatataatttttgaattattattggcgttaagttattttcattcaaataattatata
catagggatataaaaccagaaaacatttttattacgtctgaaggggaaataaaattagga
gacttaggtatgtctgttgaaaaaagtgaccacatgacacctactgttgtaaccttatgg
tatagagctccagaaattttattgaaatcaactaattatgaccagaaggttgatatatgg
agtttgggttgtttattcatggaattaatacagggaagacctttatttccaggaaaaaat
gactgcactcagctagaactgatttatttattacttggtgataaggataaattaacaact
gttgacaaagaaagaaaggatatgtttccatattttgagataaatatgttaaaagatgct
atagatgatgaacatacattagatttaatttctaaaatgttaatatatgaccctaactac
agaatatcatcaaaagaagctttgaagcatccttgtttccaggacattgagcaagtaaaa
ttctcttataatttttaa

DBGET integrated database retrieval system