KEGG   Plasmodium falciparum 3D7: PF3D7_1343700
Entry
PF3D7_1343700     CDS       T00095                                 

Definition
(RefSeq) kelch protein K13
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: Kelch_1 Kelch_6 Kelch_4 BTB_2 Kelch_3 Kelch_2 Kelch_5
Other DBs
NCBI-GeneID: 814205
NCBI-ProteinID: XP_001350158
PlasmoDB: PF13_0238
GeneDB: PF13_0238
UniProt: Q8IDQ2
Structure
PDB: 
4YY8 4ZGC

Position
13:complement(1724817..1726997)
AA seq 726 aa
MEGEKVKTKANSISNFSMTYDRESGGNSNSDDKSGSSSENDSNSFMNLTSDKNEKTENNS
FLLNNSSYGNVKDSLLESIDMSVLDSNFDSKKDFLPSNLSRTFNNMSKDNIGNKYLNKLL
NKKKDTITNENNNINHNNNNNNLTANNITNNLINNNMNSPSIMNTNKKENFLDAANLIND
DSGLNNLKKFSTVNNVNDTYEKKIIETELSDASDFENMVGDLRITFINWLKKTQMNFIRE
KDKLFKDKKELEMERVRLYKELENRKNIEEQKLHDERKKLDIDISNGYKQIKKEKEEHRK
RFDEERLRFLQEIDKIKLVLYLEKEKYYQEYKNFENDKKKIVDANIATETMIDINVGGAI
FETSRHTLTQQKDSFIEKLLSGRHHVTRDKQGRIFLDRDSELFRIILNFLRNPLTIPIPK
DLSESEALLKEAEFYGIKFLPFPLVFCIGGFDGVEYLNSMELLDISQQCWRMCTPMSTKK
AYFGSAVLNNFLYVFGGNNYDYKALFETEVYDRLRDVWYVSSNLNIPRRNNCGVTSNGRI
YCIGGYDGSSIIPNVEAYDHRMKAWVEVAPLNTPRSSAMCVAFDNKIYVIGGTNGERLNS
IEVYEEKMNKWEQFPYALLEARSSGAAFNYLNQIYVVGGIDNEHNILDSVEQYQPFNKRW
QFLNGVPEKKMNFGAATLSDSYIITGGENGEVLNSCHFFSPDTNEWQLGPSLLVPRFGHS
VLIANI
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggaaggagaaaaagtaaaaacaaaagcaaatagtatctcgaatttttctatgacgtat
gatagggaatctggtggtaacagcaatagtgatgataaaagcggaagtagtagcgagaat
gattctaattcatttatgaatctaactagtgataaaaatgagaaaacggaaaataatagt
ttccttttaaataatagtagttatggaaatgttaaagatagcctattagaatccattgat
atgagtgtattagattcgaactttgatagtaaaaaagattttttaccaagtaatttatca
agaacatttaataatatgtctaaagataatataggaaataaatatttaaataaattgtta
aataaaaaaaaagatactattacaaatgaaaataataatattaatcataataataataat
aataatctgacagcaaataatataactaataatcttattaataataatatgaattctcca
tcaattatgaataccaacaaaaaagagaattttttagatgcagcaaatcttataaatgat
gattctggattaaacaatttaaaaaaattttcaactgtaaataatgtaaatgatacttat
gaaaagaaaattattgaaacggaattaagtgatgctagtgattttgaaaatatggtaggt
gatttaagaattacatttattaattggttaaaaaagacacaaatgaattttattcgagaa
aaagataaattatttaaagataagaaagaactagaaatggaaagagtacgattgtacaaa
gaattagaaaaccgtaaaaatattgaagaacagaaattacatgatgaaagaaagaaatta
gatattgatatatctaatggttataaacaaataaaaaaagaaaaagaagaacataggaaa
cgatttgatgaagaaagattaagatttttacaagaaatcgataaaattaaattagtatta
tatttagaaaaagaaaaatattatcaagaatataaaaattttgagaatgataaaaaaaaa
attgttgatgcaaatattgctactgaaactatgattgatattaatgttggtggagctatt
tttgaaacatctagacataccttaacacaacaaaaagattcatttatagagaaattatta
agtggaagacatcatgtaaccagagataaacaaggaagaatattcttagatagggatagt
gagttatttagaattatacttaacttcttaagaaatccgttaactatacccataccaaaa
gatttaagtgaaagtgaagccttgttgaaagaagcagaattttatggtattaaattttta
ccattcccattagtattttgtataggtggatttgatggtgtagaatatttaaattcgatg
gaattattagatattagtcaacaatgctggcgtatgtgtacacctatgtctaccaaaaaa
gcttattttggaagtgctgtattgaataatttcttatacgtttttggtggtaataactat
gattataaggctttatttgaaactgaggtgtatgatcgtttaagagatgtatggtatgtt
tcaagtaatttaaatatacctagaagaaataattgtggtgttacgtcaaatggtagaatt
tattgtattgggggatatgatggctcttctattataccgaatgtagaagcatatgatcat
cgtatgaaagcatgggtagaggtggcacctttgaatacccctagatcatcagctatgtgt
gttgcttttgataataaaatttatgtcattggtggaactaatggtgagagattaaattct
attgaagtatatgaagaaaaaatgaataaatgggaacaatttccatatgccttattagaa
gctagaagttcaggagcagcttttaattaccttaatcaaatatatgttgttggaggtatt
gataatgaacataacatattagattccgttgaacaatatcaaccatttaataaaagatgg
caatttctaaatggtgtaccagagaaaaaaatgaattttggagctgccacattgtcagat
tcttatataattacaggaggagaaaatggcgaagttctaaattcatgtcatttcttttca
ccagatacaaatgaatggcagcttggcccatctttattagttcccagatttggtcactcc
gttttaatagcaaatatataa

DBGET integrated database retrieval system