KEGG   Plasmodium falciparum 3D7: PF3D7_1345700Help
Entry
PF3D7_1345700     CDS       T00095                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00020  Citrate cycle (TCA cycle)
pfa00480  Glutathione metabolism
pfa01100  Metabolic pathways
pfa01110  Biosynthesis of secondary metabolites
pfa01130  Biosynthesis of antibiotics
pfa01200  Carbon metabolism
pfa01210  2-Oxocarboxylic acid metabolism
pfa01230  Biosynthesis of amino acids
pfa04146  Peroxisome
Module
pfa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PF3D7_1345700
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PF3D7_1345700
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PF3D7_1345700
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PF3D7_1345700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 814208
NCBI-ProteinID: XP_001350171
PlasmoDB: PF13_0242
GeneDB: PF13_0242
UniProt: Q8I6T2
Position
13:complement(1828283..1829689)
Genome map
AA seq 468 aa AA seqDB search
MGKHIRILKNQYLQFMSKRCIQSKAAFNICGKINVENPIVELDGDEMTRIIWKDIKEKLI
LPYVNLKIKYFDLSIENRDKTNDQVTIEAAEEIKKTSVGIKCATITPDAARVKEFNLKEM
WKSPNGTIRNILDGTVFRTPILIKNIPKLVPNWKKPIVIGRHAYADQYKQKSLKIEKSGK
FEIVFTPDDNSQVLRETVFHFKSPGVCLGMYNTEESIRNFALSCFQYALDLKMPVYMSTK
STILKIYDGLFKDIFDEIYEKQFKKSFEQHNLWYEHKLIDDMVAQVLKSEGGFLWACKNY
DGDIQSDAVAQGYGSLGLMSSVLLCPDGVTCVSEAAHGTVTRHYRAYQKGEKTSTNPIAS
IFAWTKGLEHRAKLDKNDNLKQFCYALEKACIETVEDGLMSKDLAGCIKGIKNVTEKDYI
FTQDLINAINEKLKLKILQNQSKNDPQATSYKLKNDNWNFYAPQEHST
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcatatacgaattttaaaaaatcaatacctacaatttatgtcgaagagatgt
attcaaagcaaggcggcttttaacatatgcggtaaaattaacgtagaaaaccctattgta
gagttagatggagatgaaatgactagaataatttggaaagatataaaagaaaaattaatc
ttaccatatgttaacttaaagataaaatattttgatttatctattgaaaatcgagataag
actaatgatcaagttaccatagaagctgctgaagaaataaaaaaaacttcagtaggtata
aaatgtgcaactataacacctgatgctgcaagagttaaagaatttaatttaaaggaaatg
tggaaaagtccaaacggtactataagaaatatattagatggtactgtttttagaacacct
atacttattaaaaatatacctaaactagtacctaattggaagaaaccaattgttatagga
agacatgcatatgctgatcaatataaacagaaatctttaaaaatcgaaaaaagtgggaaa
tttgaaattgtatttactccagatgataattcacaagtacttagagaaactgtgtttcat
tttaaatctcctggtgtatgtttaggtatgtataatacagaagaatctatacgaaatttt
gcattgtcttgttttcaatatgctttagatcttaaaatgccagtttatatgagtactaaa
agtactatactaaaaatatatgatggtttatttaaagatatttttgatgaaatttatgaa
aaacaatttaaaaaatcttttgaacaacataatttatggtatgaacataaactaattgat
gatatggttgctcaagtattaaaatcagaaggtggatttttatgggcatgtaaaaattat
gatggtgatatccaatctgatgctgttgctcaaggttatggaagtttaggattaatgtca
tctgtgttattatgtccagacggtgttacgtgtgtttcagaagctgcccatggtaccgtc
actagacattatagagcttatcaaaagggagaaaaaacatcaacaaatcctatagcctct
atttttgcatggaccaaaggattagaacacagagcaaaattagataaaaatgataattta
aaacaattttgttatgctttagaaaaggcatgtatcgaaacggtagaagatggattgatg
tctaaagatctagcaggatgtattaaaggtattaaaaatgttactgagaaggattatatc
tttactcaagatttaatcaatgctattaatgaaaaactaaaattaaagatacttcaaaat
caatccaaaaatgatccacaagctacttcatataaattgaaaaacgataactggaatttt
tatgctccccaagaacattcaacataa

DBGET integrated database retrieval system