KEGG   Plasmodium falciparum 3D7: PF3D7_1348100
Entry
PF3D7_1348100     CDS       T00095                                 

Definition
(RefSeq) GTPase, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: Ras MMR_HSR1 Roc Dynamin_N ATPase_2 AIG1 Septin cobW FeoB_N
Other DBs
NCBI-GeneID: 813801
NCBI-ProteinID: XP_001350194
PlasmoDB: MAL13P1.241
GeneDB: MAL13P1.241
UniProt: Q8IDL8
Position
13:join(1925049..1925164,1925312..1925421,1925581..1925682,1925812..1925915,1926015..1926054,1926249..1926297,1926429..1926489,1926588..1926653,1926754..1926780)
AA seq 224 aa
MILLQLTVVGYLNTGKTSLINSIMNNEIFTNYSHTPLPMIYYKVHKDKNRAFCVEIEDTS
VDVDINNFTNMMRKEITTNSKNMKNPVFSYFENPCIPFQAHDPYNSISYGRMAYFLVFDL
TNPSTFEYVKMIYLNMSSIYEKYYTLKPFISLVGNKSDLADENCALVREAENFSNEHMVQ
LWLTSAYTGKNVKKLFLHTINMVYNNTNLWKYDIEESGSESSES
NT seq 675 nt   +upstreamnt  +downstreamnt
atgatattattgcagttgactgttgtaggatatttaaatactggaaaaacatccttaata
aattctattatgaataatgaaatattcacaaattattcacatacccccttaccaatgata
tattataaagttcataaggataaaaatagagctttctgtgttgaaatagaagatacgtct
gttgatgttgacataaataattttacaaatatgatgaggaaagaaattacaacaaatagt
aagaacatgaagaatcctgtgtttagttatttcgaaaatccgtgtattccattccaggca
catgatccttacaattctattagttatggaagaatggcatattttcttgttttcgattta
actaatccatcaacttttgaatatgttaaaatgatatatttaaatatgtctagtatttat
gaaaaatattatacgctgaaaccatttatatctcttgtgggaaataaatctgatttagca
gatgaaaactgtgctttagttcgagaagcagaaaatttttctaatgaacatatggttcaa
ctttggctgacttcagcttatacaggaaaaaacgtaaagaagctatttcttcatactatt
aatatggtctacaacaatactaatttgtggaaatatgacatagaagagtctggatctgag
tcgtctgaaagttaa

DBGET integrated database retrieval system