KEGG   Plasmodium falciparum 3D7: PF3D7_1353200
Entry
PF3D7_1353200     CDS       T00095                                 

Definition
(RefSeq) membrane-associated histidine rich protein 2, (MARHP2)
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: Ctr
Other DBs
NCBI-GeneID: 814241
NCBI-ProteinID: XP_001350244
PlasmoDB: PF13_0276
GeneDB: PF13_0276
UniProt: Q8IDG8
Position
13:join(2130531..2130812,2130934..2131065)
AA seq 137 aa
MQPCPYDVYNQINHVGTHWAQHLGEHLHHLAHMHQHTPHVHHHIPHVHTLAHDRPCMPIT
AFFCRHHEHCSSHLMLIFLLLAFFLVVVYRLYNEVVNSAKTVRIVNITPVNEEHKAEASK
EQSKSTSDSSTSTQQTL
NT seq 414 nt   +upstreamnt  +downstreamnt
atgcagccttgtccatatgatgtatacaatcaaataaaccatgtaggaactcattgggct
caacatttaggagaacacttacatcatttagcacatatgcatcaacatactccacatgta
catcatcacattccacatgtgcatacgctagctcatgataggccttgtatgccaataact
gctttcttttgtcgacatcatgaacattgtagttcccatttaatgttaatctttttatta
ttggctttcttcctagtagtagtttatagattatataacgaggttgttaattcagctaaa
actgtacgtattgtaaatataacaccagtaaatgaggaacataaggctgaagctagtaag
gaacaatcaaaatcaacaagtgattcttctactagtacacaacaaacattataa

DBGET integrated database retrieval system