KEGG   Plasmodium falciparum 3D7: PF3D7_1353600
Entry
PF3D7_1353600     CDS       T00095                                 

Definition
(RefSeq) ER lumen protein retaining receptor
  KO
K10949  ER lumen protein retaining receptor
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_1353600
Membrane trafficking [BR:pfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    PF3D7_1353600
SSDB
Motif
Pfam: ER_lumen_recept
Other DBs
NCBI-GeneID: 813646
NCBI-ProteinID: XP_001350248
PlasmoDB: PF13_0280
GeneDB: PF13_0280
UniProt: Q76NM1
Position
13:complement(join(2146181..2146527,2146704..2146882,2147008..2147147))
AA seq 221 aa
MNIFRLIGDILHLVSMYILIMKLKKSKNCIGISCRMQELYLIVFLCRYIDLFFVFVSFYN
TVMKITFILTIAYTIYLIRLKLPISQTYNRKVDNFKSEKYLIPPCLVLSLLTCKTYNLYN
ILWSFSIWLESVAILPQLVLLEKQREVENITSHYVITMGLYRAFYILNWIYRYFFDDKPY
INVVGWIGGLIQTLLYIDFFYYFALAKWYGKKLVLPFNGEV
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaatatatttagactgatcggtgatattttgcacttagtaagtatgtatatacttatt
atgaagttaaagaaatcaaagaattgtataggtatatcatgtcgtatgcaagaattgtat
ttaatagtatttttatgcagatatattgatctcttctttgtttttgtgagcttttacaat
acagttatgaaaataacttttatactgacaatagcgtatactatatatttaataagattg
aaattacccatatctcaaacatacaatagaaaagtagacaattttaaaagtgaaaaatat
ttgattcctccatgtttagttttgagtttgttaacctgtaaaacttacaacttgtataac
attttatggtccttttccatatggttagaaagtgtggctatattacctcaactagtatta
ctggaaaaacaaagagaagttgaaaatattacttcccattatgttattaccatgggatta
tatagagccttttatatattaaattggatatatagatatttctttgatgacaaaccatat
attaatgtagtaggatggattggtggcttaatacaaacattattatatatagatttcttt
tattattttgccttagcaaaatggtatggaaaaaaattagttcttccatttaatggtgaa
gtataa

DBGET integrated database retrieval system