KEGG   Plasmodium falciparum 3D7: PF3D7_1354400
Entry
PF3D7_1354400     CDS       T00095                                 

Definition
(RefSeq) V-type proton ATPase 21 kDa proteolipid subunit, putative
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00190  Oxidative phosphorylation
pfa01100  Metabolic pathways
pfa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PF3D7_1354400
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    PF3D7_1354400
SSDB
Motif
Pfam: ATP-synt_C TCR_zetazeta
Other DBs
NCBI-GeneID: 813833
NCBI-ProteinID: XP_001350256
PlasmoDB: MAL13P1.271
GeneDB: MAL13P1.271
UniProt: Q8IDF7
Position
13:complement(join(2169314..2169369,2169475..2169578,2169727..2169907,2170044..2170144,2170313..2170416))
AA seq 181 aa
MYNSWFEIVRSISPYNWAMLGIALSLFLSIMGAAWGIFICGTSIVGASVKSPRIISKNLI
SIIFCEALGMYGVITAVFLQIKFSGLSTEVHPPLVLTNKTDPLIMNTIRGGWALFASGLT
AGLSNLVSGVSVGITGSSCAIGDAHSSDLFVRMLMIEICASVIGLYGLIVAIVSIGDIQL
T
NT seq 546 nt   +upstreamnt  +downstreamnt
atgtataattcatggtttgaaatagtgcgatccatatcgccatataactgggcaatgtta
ggcatagccctttcattatttctatctattatgggtgcagcatggggtatatttatatgt
ggtacaagtattgttggagcttcggttaaatcaccacgtattatttcaaaaaatttaata
tcaattattttctgtgaagcattaggtatgtatggtgttattacggcagtatttttgcaa
ataaaatttagcgggttatctacagaggtacacccaccattagtattaacaaataaaaca
gatcctttaattatgaatacaataagaggaggatgggcattatttgctagtggtctcact
gcaggattgtctaaccttgtttcaggagtttctgttggaataacaggaagttcatgtgcc
attggagatgcacatagttctgatctctttgtcagaatgttaatgattgaaatttgtgcg
agtgttataggtttatatggtttaattgtcgctattgtatcaattggagatattcaacta
acataa

DBGET integrated database retrieval system