KEGG   Plasmodium falciparum 3D7: PF3D7_1357100
Entry
PF3D7_1357100     CDS       T00095                                 

Definition
(RefSeq) elongation factor 1-alpha
  KO
K03231  elongation factor 1-alpha
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    PF3D7_1357100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pfa03019]
    PF3D7_1357100
   03016 Transfer RNA biogenesis [BR:pfa03016]
    PF3D7_1357100
   03012 Translation factors [BR:pfa03012]
    PF3D7_1357100
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_1357100
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_1357100
Messenger RNA biogenesis [BR:pfa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     PF3D7_1357100
Transfer RNA biogenesis [BR:pfa03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    PF3D7_1357100
Translation factors [BR:pfa03012]
 Eukaryotic type
  Elongation factors
   PF3D7_1357100
Membrane trafficking [BR:pfa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    PF3D7_1357100
Exosome [BR:pfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   PF3D7_1357100
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 FlpD GDPD Met_asp_mut_E
Other DBs
NCBI-GeneID: 814268
NCBI-ProteinID: XP_001350282
PlasmoDB: PF13_0305
GeneDB: PF13_0305
UniProt: Q8I0P6
Position
13:2268901..2270232
AA seq 443 aa
MGKEKTHINLVVIGHVDSGKSTTTGHIIYKLGGIDRRTIEKFEKESAEMGKGSFKYAWVL
DKLKAERERGITIDIALWKFETPRYFFTVIDAPGHKDFIKNMITGTSQADVALLVVPAEV
GGFEGAFSKEGQTKEHALLAFTLGVKQIVVGVNKMDTVKYSEDRYEEIKKEVKDYLKKVG
YQADKVDFIPISGFEGDNLIEKSDKTPWYKGRTLIEALDTMEPPKRPYDKPLRIPLQGVY
KIGGIGTVPVGRVETGILKAGMVLNFAPSAVVSECKSVEMHKEVLEEARPGDNIGFNVKN
VSVKEIKRGYVASDTKNEPAKGCSKFTAQVIILNHPGEIKNGYTPVLDCHTSHISCKFLN
IDSKIDKRSGKVVEENPKAIKSGDSALVSLEPKKPMVVETFTEYPPLGRFAIRDMRQTIA
VGIIKSVEKKEPGAVTAKAPAKK
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgggaaaggaaaaaacacatattaacttagttgttattggtcacgtcgatagtggaaaa
tcaaccactacaggtcacattatttacaaattaggaggtatagatagaagaactattgaa
aaatttgagaaagaatctgctgaaatgggtaagggtagttttaaatatgcatgggtttta
gataaacttaaggcagaaagagaaagaggtattaccattgatattgccttatggaaattt
gaaaccccaaggtatttctttactgtcattgatgcaccaggtcacaaggattttattaaa
aatatgattacaggtacatcacaagcagatgttgctttattagttgtcccagctgaagta
ggtggtttcgaaggtgccttttcaaaggaaggtcaaacaaaggaacacgctttattagca
tttaccttaggtgtaaaacaaattgttgtcggtgttaacaagatggatactgtcaaatat
tctgaagacagatatgaagaaattaaaaaagaagttaaggattacttgaagaaagtagga
taccaagctgataaagttgattttattccaatttctggttttgaaggtgataatttaatc
gaaaaatcagataaaacaccatggtataaaggaagaaccttaatagaagcccttgatact
atggaaccaccaaagagaccttacgacaagccattaagaattccacttcaaggtgtttac
aaaatcggtggtattggtaccgtccctgttggtcgtgttgaaacaggtatcttaaaagcc
ggtatggttttaaacttcgctccatcagctgttgtgtctgaatgtaaatcagttgaaatg
cacaaggaagttttggaagaagctagaccaggagacaacattggttttaacgtaaagaat
gtttctgttaaagaaatcaagagaggttacgttgcttcagatactaaaaatgaaccagca
aaaggatgctccaaatttactgctcaagttattatattgaaccaccctggtgaaatcaaa
aatggttataccccagttttggattgtcacacatctcacatttcatgtaaatttttaaac
attgattccaagatcgacaaacgttcaggtaaagttgttgaagaaaatccaaaagctatc
aaatcaggagattcagctttagttagtttggaacctaagaaacctatggttgttgaaacc
tttactgaatatccaccattaggaagattcgctattcgtgatatgagacaaaccattgct
gtcggtatcattaaatcagttgaaaagaaagaacctggagctgttacagctaaagcacca
gccaagaaataa

DBGET integrated database retrieval system