KEGG   Plasmodium falciparum 3D7: PF3D7_1361000
Entry
PF3D7_1361000     CDS       T00095                                 

Definition
(RefSeq) protein arginine N-methyltransferase 5, putative
  KO
K02516  type II protein arginine methyltransferase [EC:2.1.1.320]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    PF3D7_1361000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pfa03041]
    PF3D7_1361000
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_1361000
Enzymes [BR:pfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.320  type II protein arginine methyltransferase
     PF3D7_1361000
Spliceosome [BR:pfa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PF3D7_1361000
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     PF3D7_1361000
SSDB
Motif
Pfam: PRMT5 PRMT5_TIM PRMT5_C Methyltransf_31 Methyltransf_25 MTS Methyltransf_28 Methyltransf_12
Other DBs
NCBI-GeneID: 814284
NCBI-ProteinID: XP_001350321
PlasmoDB: PF13_0323
GeneDB: PF13_0323
UniProt: Q8ID96
Position
13:complement(2445090..2447264)
AA seq 724 aa
MTIKNKYGYLKLGIEIEYHKIPQCEENNIDPDFFACKLFNDNTKNIYNELTTNESLNNSS
MINGNGKRCSYEIDPLFGNIYEDKNIWEKNIYGLMSTWINPDDENENSSLYSMDALNKEL
QWSTYISISKLIINVPNIKCDNYARYINSCINNYNMLSLIMRIPIVIKKKKPFHKESYNN
NMTCDIINGWNLWAKFISYCNFNYSHLGLALELSNINNIDLSNIQLDVWKSEPVKLIIIP
LDAFLLDTKTGYPYLPKKLKDFLIYFFRKNIEVLLITNEDINKMNNHFIHLKNEYCNEYQ
HNICNNEMDSYDINDNNNNNNNNYNISNSIHTKTNNNYYLKCCIYYIKRLFMSIENFDND
SLFDSFYWDYLQIPLQPLKDNLSSQTYEVFEKDRKKYEQYELATSKYLSNWKKGKKINNK
NKQSNKNKNNNNNNNMEEQQNDHKITIFVVGAGRGPLVDTTLSALQKNEMTDYEIYAIEK
NDSAIIILNNRVQTEEWKNVKVIHSDIRYLDIPKKADIIISELLGSFGDNELFPECMDGI
KKFLKDDGISIPMNCVSYLEPISCSALYHKVMENNISGGNESFYVVNMYSYTKISQESSK
ECFFFQVPPIHTKQDNSHNYRYKNINFKIKMDTYIHGFLCYFKSQLYDDVYISIEPKTHT
PNLHSWFPLYIPINKIQFLKKGQNLSFSIWRLTDHQKIWYEWCINEPITTSIHNYNARYF
SIGR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgactataaagaataaatacggatacctaaaattaggtatagaaattgaatatcataaa
ataccacaatgtgaagaaaataatatagatcctgattttttcgcatgtaaactttttaat
gataatacgaaaaacatatataacgaattaactacaaatgaatctctaaataattcttct
atgataaatggaaatggaaaaagatgtagttatgaaatagatcctttgtttggtaatata
tatgaagataaaaatatatgggaaaaaaatatatatggattaatgtccacatggataaat
cctgatgacgaaaatgaaaattcaagtttatattctatggatgcattaaataaagaatta
caatggtctacttatatatctataagtaaattgattattaatgtaccgaatataaaatgt
gataattatgctagatatattaactcatgtataaataattataatatgttatccttaata
atgagaattcctattgttataaaaaaaaaaaaaccttttcataaggaaagttataataac
aatatgacttgtgatattataaatggatggaatttatgggcaaaatttatttcatattgt
aattttaattatagtcatttaggtttagcccttgaattatcaaatataaataatatagat
ttaagtaatattcaattagatgtatggaaatctgaacccgtaaaattaattatcatacca
ttagatgcatttctattggatacaaaaacagggtatccatatttaccaaaaaaattaaag
gatttcttaatatacttttttagaaaaaatatagaagttttattaataacaaatgaagac
attaacaagatgaataatcatttcattcatctcaaaaatgaatattgtaatgaataccaa
cataatatatgtaataatgaaatggattcatatgatattaatgataataataataataat
aataataattacaatattagtaatagtatccatacaaaaactaataacaactactattta
aaatgttgtatttattatataaagaggttatttatgtctatagaaaatttcgacaatgat
tcactttttgacagtttttattgggattatttacaaatacctttacaacccctcaaagat
aatttgtcctcccagacttatgaagtttttgaaaaggaccggaaaaagtatgagcagtat
gaactagccacaagtaagtatttatcaaattggaaaaaaggaaaaaaaataaacaacaaa
aataaacaaagcaacaaaaacaaaaacaacaataataataataatatggaagaacaacag
aacgatcataagattaccatttttgttgtgggtgcgggcagaggtcccttagtagatacg
accctatcagccttacaaaaaaatgaaatgacagattatgaaatatatgccatagaaaag
aatgatagtgctataattattttaaataatagggtacaaacagaagaatggaaaaatgta
aaggttattcatagtgatataagatatttagatatacctaaaaaagcagatattattatt
agcgaattattaggttcttttggtgataatgaattatttcctgaatgtatggatggaatc
aagaaatttttaaaagatgatggaattagtataccaatgaattgtgtatcttatttagaa
cctatatcatgttctgctttatatcataaagttatggaaaataatatatcagggggtaat
gaatctttctatgttgttaatatgtattcatatacaaaaatatcacaagaatcatctaaa
gaatgttttttttttcaagttccacctatacacaccaaacaagataatagtcataattat
cgctataaaaatattaattttaaaataaaaatggacacatatatacatggattcttatgt
tattttaaatctcaattatatgatgatgtgtatatatccatagaaccaaaaacacataca
ccgaatcttcatagttggtttcctctatatattcctataaataaaatacaatttttaaaa
aaaggtcaaaacctttcttttagtatttggagattaacagatcatcaaaaaatttggtac
gagtggtgtattaatgaacccataacaactagtattcataattataatgctagatatttt
tctataggaagataa

DBGET integrated database retrieval system