KEGG   Plasmodium falciparum 3D7: PF3D7_1365900
Entry
PF3D7_1365900     CDS       T00095                                 

Definition
(RefSeq) ubiquitin-60S ribosomal protein L40
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03010  Ribosome
pfa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PF3D7_1365900
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PF3D7_1365900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pfa03011]
    PF3D7_1365900
   04121 Ubiquitin system [BR:pfa04121]
    PF3D7_1365900
Ribosome [BR:pfa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    PF3D7_1365900
  Archaea
    PF3D7_1365900
Ubiquitin system [BR:pfa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   PF3D7_1365900
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 814305
NCBI-ProteinID: XP_001350369
PlasmoDB: PF13_0346
GeneDB: PF13_0346
UniProt: Q8ID50
Position
13:complement(join(2632534..2632713,2633054..2633260))
AA seq 128 aa
MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAIEPSLAQLAQKYNCQKLICRKCYARLHPRATNCRNKKCGRTNQ
LRPKKKLK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcaaatttttgtaaaaacattaactggaaaaacaattacccttgatgttgagccatct
gatacgattgagaatgttaaggcaaaaattcaagataaagaaggaattcctcctgatcaa
caaagattaatatttgctggaaaacaattagaagatggaaggaccttatcagattataat
attcaaaaggaatcaactttacacttggttttaagattaagaggaggagccatagaacca
tccttagcacaactagctcaaaaatacaattgccaaaaattaatttgtagaaaatgttat
gctagattacacccaagagctaccaactgcagaaataaaaaatgtggaagaaccaatcaa
ctaagaccaaagaaaaaactcaaatga

DBGET integrated database retrieval system