KEGG   Plasmodium falciparum 3D7: PF3D7_1410600
Entry
PF3D7_1410600     CDS       T00095                                 

Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit gamma, putative
  KO
K03242  translation initiation factor 2 subunit 3
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    PF3D7_1410600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pfa03012]
    PF3D7_1410600
Translation factors [BR:pfa03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    PF3D7_1410600
SSDB
Motif
Pfam: eIF2_C GTP_EFTU GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Other DBs
NCBI-GeneID: 811685
NCBI-ProteinID: XP_001348277
PlasmoDB: PF14_0104
GeneDB: PF14_0104
UniProt: Q8ILY9
Position
14:427191..428588
AA seq 465 aa
MNINEKDKLAEQNLETLDVTKLTPLSEDVISRQATINLGTIGHVAHGKSTLVHAISGVHT
VRFKHEKERNITIKLGYANAKIYKCTNPDCLPPECYKSYESSKEDNPICPRKDCNHEMKL
LRHVSFVDCPGHDILMATMLNGAAVMDAALLLVAGNESCPQPQTSEHLAAVEIMRLKHIL
ILQNKVELIKEEQALKQQEEIRNFVSGTAADSAPIIPISAVLKYNIDVVCEYIVTQISIP
KRDFISSPHMIVIRSFDVNKPGEDIETLQGGVAGGSILHGVLKVGDKIEIRPGIISKDDK
GEITCRPIISQILSMFAENNNLKYAVPGGLIGVGTKIDPILTRADRLVGQVIGHLNKLPD
CFAEIEISYYLLRRLLGVKSQDGEKNTKVAKLKNGEFLMINIGSTSIGCRVTGIKTELAK
LELTGPVCTKIGDKIALSRRVDKHWRLIGWGQINKGKPLELQEPI
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaatataaatgaaaaggataaattagctgagcagaatttagaaactttagatgtaact
aaattgacaccattaagtgaagatgttataagcagacaagctacaataaatttaggtacc
attggtcatgtggctcatggaaaatcaaccttagtgcatgcaatatcgggggttcataca
gttagatttaagcatgaaaaggagagaaatattactattaaattaggatatgctaatgca
aagatatataaatgtacaaaccctgattgcttaccacctgaatgttataaatcatatgaa
agtagtaaagaagataatccaatatgtccacgtaaagattgtaatcatgaaatgaaatta
ttaagacatgtgtcatttgtagattgtccaggacatgatattttaatggcaactatgtta
aatggtgctgctgttatggatgctgctttattattagtagctgggaacgaatcctgtcca
caacctcaaacctctgaacatttagctgctgtagaaattatgagattaaaacatatatta
attttacaaaataaagtagaattaattaaagaagaacaagcattaaaacaacaagaagaa
attagaaattttgtttcaggaacagctgcggatagcgctccaattattcctatcagcgct
gtcttaaaatataatattgatgtagtttgtgaatatattgttactcaaattagtatacct
aaaagggattttatatcatctccacatatgattgttattcgttcatttgatgtaaacaaa
cctggtgaagatattgaaaccttacaaggtggtgtagcaggtggtagtatattacatggg
gtattaaaagttggagataaaattgaaattaggcctggtattatatcaaaagatgataaa
ggagaaataacatgtagacctatcatttcacaaattctttctatgtttgcagaaaataat
aatttaaaatatgctgtaccaggaggacttattggtgttggtaccaaaatagatcctatc
ttaacaagagctgatcgtttagttggtcaagttatcggacatctaaataaattacctgac
tgcttcgctgaaattgaaatatcttattacttattaagaagattattaggtgttaaatca
caagacggagaaaaaaatactaaagttgccaaacttaaaaatggagaattccttatgatc
aacatcggttctacttctattggttgtagagttactggaatcaaaactgaactagccaaa
ttagaactaactggtccagtatgtaccaaaattggagataaaattgctctcagtagaaga
gttgataagcattggcgtttaattggatggggacaaattaataagggaaaacccttggag
cttcaagaaccaatttga

DBGET integrated database retrieval system