KEGG   Plasmodium falciparum 3D7: PF3D7_1431900
Entry
PF3D7_1431900     CDS       T00095                                 

Name
(RefSeq) inner membrane complex suture component, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: Choline_transpo Fer4_16
Other DBs
NCBI-GeneID: 811880
NCBI-ProteinID: XP_001348472
PlasmoDB: PF14_0298
GeneDB: PF14_0298
UniProt: Q8ILE6
Position
14:join(1253540..1254847,1255061..1255152,1255241..1255314,1255426..1255491,1255612..1255767,1255895..1255956,1256112..1256204,1256315..1256383,1256521..1256595,1256675..1256878)
AA seq 732 aa
MNYIEMEEREYKPLIEEVDNGNNIIINNKEYYNMYENNNINNDNINIHERVPLGTPLTYI
SGNPGDYIQHIDMYNVEEEKKGKKRLATDIKYFNYFVTYFMISLIIIFYYFYYGKYSRIL
YGINYNGKICGKDLHKYPYLYFPLTPKNPKPEILSTYAKCLESCPSSNIVSKDIADLNKD
KNKDKNKYFVESYFFSYKKKNNNNNNIVIDKRGNSATNIVYSDYTKSPNNNLYVEYSLNS
PYYDTVNIMNICYPKDKLLREKVAKIIFTDRYKTFVNLFSLHNSFIFIFLFVFTTIVLCF
LYLLFLYISSTPTFHLFLISFVSLMFFLPIYFIHKHLYMIYNPVKTSLFSHQYFISIFIC
IIIFIQSFFFLSIFFIYKSTYKYTSQIIGITLNFIYKMTNIIYSPIIVSSISFVWFFVWL
YIYIMIMTAGGVHEKRLRMELDSNGFSEIMPLQKFFYYFKSSSFFSILWVYSYFFICEIL
QSLNQFTINYLGTVWYFSDKSNFPKQNNVWKVMKTIINYHLGSLVLSSFINLLFKPLRVI
FFWTNSTLSLPFFYNHIIHKIKHNFYIFLKPISKIIDSYTSAAYCEMSISSYNYLFACDT
SCKKLINSTSPAAALHGITYILNIIFPCFTTLIITFLSFNIFNNFQRYNDLYSSNFIPNP
FFASLIIGTLCGIISSYFITLISSLSDCILYCFVCECYKNQMIDEDPMRNIFTPPMLRNF
ILEIYDEYNSNL
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgaattacatcgagatggaagaacgtgaatataaaccacttatagaagaagtggataat
ggaaacaatattataataaataacaaggaatattataacatgtatgaaaacaataatata
aataatgataatattaatattcatgaacgtgtacctctaggaacacctttaacgtatatc
tctggtaatcctggggattatatacaacacatagatatgtataacgttgaagaggaaaaa
aaagggaaaaaaagattagcaacagatataaaatattttaactactttgttacttatttt
atgatttcattaattattatattttattatttttattatggtaaatatagtcgtatatta
tatggtataaattacaatgggaaaatatgtggaaaggatctacataaatatccatattta
tacttccctcttactcctaaaaatcctaaacctgaaatattaagtacctatgctaaatgc
ctagagtcttgtccatcatctaatattgtttcaaaagatatagcagatttaaataaagat
aaaaataaagataagaataaatattttgtggaatcttattttttttcttataaaaaaaaa
aataataataataataatatagttattgataaaagaggaaatagtgcaacaaatatagta
tatagtgattatacaaaaagcccgaataataatttgtatgttgaatattctttaaattct
ccatattatgatactgtaaatattatgaatatatgttaccctaaagataaattattaaga
gaaaaagttgcaaaaattatatttacagacagatataaaacatttgttaatttattttct
cttcacaactcttttatttttatatttctttttgtttttactactatagtattatgtttc
ctttatttacttttcttatatatatcatcaactccaacttttcatttatttttaatatcc
tttgtttctttgatgtttttcttacccatttattttattcataaacatttatatatgata
tataatcctgtcaagacatcccttttttcccatcaatattttatttccatatttatatgt
atcatcatatttattcaatcctttttttttctgtctattttttttatatataaaagtacc
tacaagtacacatctcagataataggaattaccttgaattttatctataaaatgacaaat
ataatttactcccccattattgtgtcaagtatatcatttgtctggtttttcgtttggtta
tatatttatattatgataatgacagctggaggggtgcacgaaaaaaggttgcgaatggaa
ttagattcgaatggttttagtgaaataatgccccttcaaaaatttttttattatttcaaa
agctcttcatttttttctatattatgggtgtattcctatttttttatttgtgaaatatta
caaagcttaaatcagtttactataaattatttgggcactgtatggtattttagtgataaa
tcgaattttccaaaacaaaataatgtctggaaggttatgaaaacaataataaattatcat
ttgggaagtttggttttatcaagttttattaatttgttgtttaagcctttacgtgttatt
ttcttttggacaaatagcactttatctcttccttttttttataatcatattatacataag
ataaagcataatttttatatttttttaaagcctatttctaagataatcgattcttataca
tcagctgcatattgtgaaatgtctatatcttcatataattatttgtttgcatgtgatacg
tcctgtaaaaaactaataaattcaacatcccctgcggctgcgttacatggaataacctat
atattgaatataatatttccatgttttactaccctcattattacctttttgtcatttaat
atttttaataattttcaaagatataatgatttgtattcatctaattttattccaaacccc
ttttttgcttcccttataattggtacattatgcggaattatttcgtcttattttattacc
cttatatcatctctgtctgattgcatattatattgttttgtttgtgaatgttataaaaac
caaatgattgatgaagatcctatgagaaatatatttacacctcctatgttaagaaatttt
atattggaaatatatgatgaatataactcgaatttgtga

DBGET integrated database retrieval system