KEGG   Plasmodium falciparum 3D7: PF3D7_1433500
Entry
PF3D7_1433500     CDS       T00095                                 

Definition
(RefSeq) DNA topoisomerase 2
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pfa03032]
    PF3D7_1433500
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_1433500
Enzymes [BR:pfa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     PF3D7_1433500
DNA replication proteins [BR:pfa03032]
 Eukaryotic type
  DNA Topoisomerases
   PF3D7_1433500
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    PF3D7_1433500
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    PF3D7_1433500
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB HATPase_c Toprim
Other DBs
NCBI-GeneID: 811898
NCBI-ProteinID: XP_001348490
PlasmoDB: PF14_0316
GeneDB: PF14_0316
UniProt: Q8ILC8
Structure
PDB: 
6CA8

Position
14:complement(join(1332363..1332404,1332533..1332604,1332729..1332847,1333116..1337301))
AA seq 1472 aa
MAKNKTIEERYQKKSQIEHILLRPDTYIGSVEMHTQLLWVWNKEKNRMVQKNITYVPGLY
KIFDEIIVNAADVKAREKEKSENPMTCIKIEINKENKRISVYNDGEGIPVDIHKEMNIYV
PHMIFGELLTSDNYDDAEDRITGGRNGFGAKLTNIFSKEFIVQCGDSSRKKEFKMTWSDN
MSKFSEPHIKNYNGKDYVKVTFKPDLNKFGMTEMDDDIESLLFKRVYDLAGTCSVRVYLN
GQRLAVKDFKSYVDLYLKDNSNDNKNNKGQNDNNNNNNNNNDENANQNNDNLDVSLSNEP
ADGTPTKNNNNNNNNNDEDEIVKIHEKQHRWEIVVSKSDGSQFQQVSFVNSICTTKGGSH
VNYIVEQLLSSLSKKANAKNKGGMEIKSGHIRNHLWVFVNCLIVNPTFDSQTKETLTTKP
VKFGSKCILSDKTINNVLKSPILSNILLWAQAKAQVELKKKMKAGSSKARERIIGIPKLE
DANDAGSKYSQECTLILTEGDSAKTSCLAGLSIVGRDKYGVFPLKGKLLNVRDASFKQLM
DNKEIQNIFRIMGLDITDKNKDDIKGLRYGSLMIMTDQDYDGSHIKGLLINMIHKFWPSL
LKHKGFLSEFVTPIVKVQKGSQEYSFFTIAEYEQWKENTNLLGWKIKYYKGLGTSTDREF
KQYFSDIKNHKIMFLWTGDRDGDSIDMAFSKKRIEDRKLWLQNFILGSYVDHKEKDLSYY
DFVNKELIYYSRYDTERSIPNIMDGWKPGQRKVLYGCFKRNLRNECKVAQLVGYIAEHSA
YHHGESSLQQTIINMAQTFVGSNNINFLEPCGQFGSRKEGGKDASAARYIFTKLASSTRS
IFNEYDDPILKYLNEEGQKIEPQYYIPVIPTILVNGCEGIGTGYSSFIPNYNYKDIIDNI
KRYINKEPLIPMVPWYKDFKGRIESNGKTGYETIGIINKIDNDTLEITELPIKKWTQDYK
EFLEELLTDEKHQLILDYIDNSSHEDICFTIKMDPAKLQKAEEEGLEKVFKLKSTLTTTN
MTLFDPNLKLQRYSTELDILKEFCYQRLKAYENRKSYLISKLEKEKRIISNKTKFILAIV
NNELIVNKKKKKVLVEELYRKGYDPYKDINKIKKEEIFEQELLDAADNPEDNEEIIAGIT
VKDYDYLLSMPIFSLTLEKVEDLLTQLKEKERELEILRNITVETMWLKDIEKVEEAIEFQ
RNVELSNREESNKFKVARKQGPSSMKKKKKKKKLSSDEESEGGDISDSSEFLVNTLNIKK
NTNKKTTTSSNNVNNSKKRLRKADDLNSNELDNTLSVSKTFDDNNNLTDNTPLINRLNDE
NNEFSSNNVDNKSTNKNSRKKKPKIADSTNDNNSELNSSIQINDNVNDDINITISPNKTI
NVNEFSSIKNKLLELENKKKPRLTLSEKVKMKNNDKKDTPNKGSAGKRTPSKKLKGTLIG
DDSKSRQDSNFDSDASSKNNESYGDSDSSYNI
NT seq 4419 nt   +upstreamnt  +downstreamnt
atggcgaaaaataaaactattgaggagaggtatcagaagaagtctcaaatcgaacatatt
ttgttaagacctgatacctacataggaagtgtagaaatgcatactcagttattatgggta
tggaataaagaaaagaatcgtatggttcaaaagaatattacatatgtaccaggtttgtat
aaaatttttgacgagattatagtaaatgcagcagatgttaaagcaagagaaaaagagaag
agcgagaatcctatgacatgtatcaaaattgaaataaataaagaaaataagcgaataagt
gtatataatgatggggaaggtattcctgtagatatacataaagaaatgaatatatatgta
ccacatatgatttttggagaattattaacttctgataattatgatgatgcagaagatcgt
attacaggaggtagaaatggtttcggtgcaaaattaacaaatatatttagtaaagaattt
attgtacaatgtggagatagttcaagaaaaaaggaatttaaaatgacatggtcagataat
atgtcaaaattttctgaacctcatataaaaaattataatggtaaagattatgttaaggtt
acattcaaacctgacttaaacaaatttggtatgactgaaatggatgatgatatagaaagt
ttattatttaaaagagtatatgatttagctggtacatgcagtgtaagagtttatttaaat
ggtcaaagattagctgttaaggattttaaaagttatgtagatttatatttaaaagataat
tcaaatgataataaaaataataaaggacaaaatgataataacaacaataataataataat
aatgatgaaaatgcaaatcagaacaatgataatttagatgttagtttgtcaaatgaacct
gcagatggtacaccaacaaaaaataataataataataataataataatgatgaagatgaa
attgttaaaatacatgaaaaacaacatagatgggaaattgttgtttctaagtctgatgga
tcccaatttcaacaagtatcatttgttaatagtatatgtacaacaaaaggaggttcacat
gttaattatattgttgaacaattattatcttcacttagtaaaaaagctaatgctaaaaac
aaaggtggtatggaaattaaatcaggacatattagaaaccacttatgggtttttgttaac
tgcttgattgttaacccaactttcgattcacaaacaaaagaaacattaaccacaaaacca
gttaaatttggtagtaaatgtattttatctgataaaactattaataatgttttgaaaagc
cctatacttagtaatatcctcttatgggcacaagctaaagcacaagtggaactcaagaaa
aaaatgaaagccggttcatcaaaggctagagaaagaattataggaatacctaaattagaa
gatgctaatgatgctggtagtaaatatagtcaagaatgtacactaattctaaccgaagga
gatagtgctaaaacatcatgcttagctggattatccattgtaggtagagataaatacgga
gttttcccattaaaagggaaattattaaatgtaagagatgcttcatttaaacaacttatg
gataataaagaaattcaaaatatttttagaattatgggtttagatattaccgataaaaat
aaagatgatattaaaggattaagatatggatctttaatgattatgactgatcaagattat
gatggttcacatattaaaggattacttattaatatgatacataaattttggccaagctta
ttaaaacataaaggttttcttagtgaatttgtaacaccaattgtaaaagtacaaaaagga
agccaagaatattctttctttaccatagctgaatatgaacaatggaaagaaaatactaac
ttattaggatggaaaataaaatattacaaaggtcttggtacatctacggatagagaattt
aaacaatatttttcagatattaaaaaccataaaataatgtttttatggacaggtgatcgt
gatggtgattctatagatatggcatttagtaaaaaaagaattgaagatagaaaattatgg
ttacaaaattttatattaggttcctatgttgatcataaagaaaaagatttatcttattat
gattttgtaaataaagaattaatatattattcaagatatgatacagaaagaagtatacca
aatattatggatggatggaaacctggacaaagaaaagttttatatggatgttttaaaaga
aatttaagaaatgaatgtaaggttgcacaattagttggttatattgctgaacatagtgca
tatcatcatggtgagtcttccttacaacaaactattataaatatggctcaaacttttgtc
ggatctaataatataaactttttagaaccatgtggtcaatttggtagtagaaaagaaggt
ggtaaagatgcatctgcagcaagatatatatttacaaaattggctagctcaaccagaagt
atatttaatgaatacgacgatcctattttaaaatatttaaatgaagaaggacagaaaatc
gaaccacaatattatataccagtgattccaacaatattagtaaatggttgtgaaggtatt
ggtacaggatattcttcatttataccgaattataattataaagatattattgataatatc
aaaagatacataaataaagaaccattaatacctatggttccatggtataaagattttaag
ggtagaatagaatctaatgggaaaacaggatatgaaactattggtattattaacaaaatt
gataatgatacattagaaataacagagttgcccataaaaaaatggacccaagattataaa
gaatttttagaagaattattaacagatgaaaaacatcagcttatattagattatatagat
aatagttcacatgaagatatatgttttactataaaaatggatccagctaagttacaaaaa
gctgaagaagaaggattagaaaaagtatttaaattaaaaagtacattaacaactacaaat
atgaccttgtttgatcccaatttgaaattacagagatattctacagagttagatattctt
aaagaattttgttatcaaagattaaaagcgtatgaaaataggaagagttatttaatatct
aaactagaaaaggaaaaacgaattataagtaataaaacgaaattcattttagctatagtt
aataatgaattaatagtaaataagaagaaaaaaaaagtcttagtagaagaattatataga
aaaggttacgacccatataaagatattaataaaataaaaaaagaagaaatttttgaacaa
gagttattagatgctgctgacaatcctgaagataatgaagaaataattgctggtattact
gttaaggattatgattatttattaagtatgcctatatttagtcttaccttagaaaaggtt
gaagatttattaacacagctaaaagaaaaagaaagagagttagaaattttaagaaatatt
actgttgaaacaatgtggctaaaagatattgaaaaagttgaagaagctatagaattccaa
agaaatgtagaattatctaatagagaagaaagtaataaattcaaagtagctagaaaacaa
ggacctagttcaatgaaaaagaagaaaaagaaaaaaaaattatctagtgatgaagaatct
gaaggaggtgatatatcagatagtagtgaattcttagttaatacattaaatataaaaaaa
aatactaataaaaaaacaacaacgtcatcaaataatgttaataatagtaaaaaaagatta
agaaaggcagatgatttaaatagtaacgaattagataatactttatccgtatcaaaaaca
tttgatgataataataatctaacagataatacaccattaattaatagattaaatgatgaa
aataatgaatttagtagtaataatgtagataataaatctactaacaaaaattcaagaaaa
aaaaaacctaaaattgctgatagtactaatgataataatagtgaattaaatagttcaata
caaattaatgataatgtaaatgatgatataaatattactatatcacctaataaaactatt
aatgttaatgagttttcatcaataaaaaataaattattagaacttgaaaacaaaaaaaaa
ccaagattaaccttatctgaaaaagttaagatgaaaaataatgataagaaggatacacca
aataaaggaagtgcaggaaaaagaacacccagcaaaaaattgaagggaacattaatagga
gatgattctaaatcgagacaagattccaattttgatagtgacgcttctagtaaaaataat
gaatcatatggagatagtgatagttcatacaacatttaa

DBGET integrated database retrieval system