KEGG   Plasmodium falciparum 3D7: PF3D7_1441300
Entry
PF3D7_1441300     CDS       T00095                                 

Definition
(RefSeq) serine/threonine protein kinase, putative
  KO
K08282  non-specific serine/threonine protein kinase [EC:2.7.11.1]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PF3D7_1441300
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PF3D7_1441300
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 811974
NCBI-ProteinID: XP_001348566
PlasmoDB: PF14_0392
GeneDB: PF14_0392
UniProt: Q8IL57
Position
14:join(1681791..1681910,1682020..1682080,1682228..1682470,1682565..1682773,1683047..1689157)
AA seq 2247 aa
MTTTDTWKVEWDNELRQLPNVESVTCFDLQLTENVFLIWQFLKLYLSTSPQVRSIIDFIA
IKKAQSLQWGDHIDSVMSSGLRKGQELFHVFLSNGKKIQTTYSKKKLCDRLEYYHIKNYI
ILEKINTGSVGQVHVALDKSTDTFVAAKAIDKSTVQGDIGLFEKLKDEIKISCMMNHPNV
VKTLNILETKDKIIQIMEYCDAGDLISYVRNKLYLDEVSAQYFFRKIVEGLKYMHKNNIA
HRDLKPENIFLCKIQISQKEKTLIRVGKLPSCIEYDLKIGDFGACCINEKNKLHHDIVGT
LSYAAPEVLNCNNNNGYNSEKADIWSLGIILYAMLFGLLPYDSEDKDVKEAYNEIIKKKI
VFPKNRVNKFSTSVRSLLLAMLNINPQNRLSLDEVMKHEWLAGTAKNRLEMSNINKKINF
PISSTVGYPIYSNKNIMDYNIYKRLALIKNDHNSSTNSLYSNGNSTTISNSNTTNMNNNV
NNNVNSNVNNNVNNNVNNNVNNNMHNNIMNNVYNNMSNNISAILKVNNLRDKNNIAENTY
KLDSITNSLYGVHNNNVNSNNLKEVLYNHMKYYLKGDNKYNNTPGEHKNDYNLETLLKKK
EDQVVGDLKVINKKVGHYLSSKNTKEININNKIANLVVGNKNGNNNIIAKKNIMINNNNN
DNNNISSDNIPNKMCKVDNNIVSYNKFNVEHYEYNNKGCMQSKCNQNKKDEEVVHMNKLH
SICSSNDHKLYEMYMYQKNDNNMNEHVNFINKSSNKEISRLENKYVEKIYYLKNNDMHIN
DDYIKDKAIKNVEKYNFINKDKNSSTYKIKDYINNNTLNRTKYNIRADKFNNIIALNNHI
ISNDTNRHLYINNKLSINKQKYNNTPYYNYYYYYYDDDDDRKKEYNKYVYKKNKKCGTNN
SELISYNSSVYEKGSTPSSYNINNVPISYIKHDSIYNGSLSQYVNNSSYDKKILSSSYIK
DNESHVNKMNIEKSTIWYCSTNELPNDTIKKDSVHKKESLSQEFPVNNNDDVLDIKNDEQ
SKCAYNNSVVDEKENNNINVGEFKIISPNNLDSNNISSTKHITVRDTYNDNINKTKEAYI
LIKKDVNNAKCDNIFELSKMNEHSENGNNSKHTNSDIEINDRAKNLNDFVSMHEMNNFNK
VDDTQLYKKKISELSNNNEKCCNINEDKNKENKNIHMHVIKEDPNNNNNDNNNTNISADN
NYSYKYVDGDIKRECVYSTDDINYVYVKPSVCSLNADGNENTEKIIKNMNFYGMDKIYST
IVQEKNEETKEDINMDHIKYNINGNIKEDIINSNNVFNTHNEQPFIDNKIMMSNINSKDN
TKMYGNIFQNRNSNSIYEIKRKEKIYIINVDTPDECNEVKCDFSYNDHKIEANKDGDNKE
HNNKDKDGENDEHNNKDKDGDNDEHNNKDKYGDNNEHNYIDNNEDNYIDKDEYVNYYHDY
NNPENIDHNKYEQISGLNIKEYDINEKGNYNNKKKKKQKNEHKKEANFTKHKMFILEDQK
MLNTRRGNNHMKLMDKDYINEYIKIETSNYFNKEHIKKYSSLYGKNEKKNDIINIRNFND
CISDYKNSICDGFQDIKNNSVKNIFNQDKKIYHDLSNNCVLYNNIFTQTNLEHFSSNKLE
YNKNCKYPYNNLMKNYSYSEYSFDIQNKTSTYTNKVDINKADLKEAYSDKKIKYKISNIT
KNEQINIYDDIKKCSSNNNNTFYIDDEASCLDITNLSDKEIKNKKERAKKKNILNNKKCI
LSNGSNIFIGKEYKKNQHMDYMNKIKKNENDVLYLNNSVSLKRSFSMLHFNRNIKNHVNY
YYDDHNKDRREKDILLVDHMNNYVIEHKNKINIYNINLNNSNLNNINKNENNKIDSITSI
AKKCHSSDIFLIRDNILNNLSNKEFKNIIARNVSLSHEFPLIHTNEELNKKTKKQIINNN
IIYDKIGISNNKKCNIPTKKYVNNMYNLKYKKCEPNQQFNDNVKNYKVDNVVSDFILTSE
ESLMTKKNNKNYKNDKNDKNYFDNSNIISYNEMKKKVTMENINMDCVVKNKTYDNMNKSN
MKKINFNKLNISHNTQNNNNHIYNKINTYDNNLMNIKDTLGTYSVTEKHYCRQKNIMNEK
EIFHYDLISSNNWDNHLRDYMLYSLSKNHYTFLRKNTLSKDIPMHSDINLFNNKKEDTTS
KNKNEKNFKINHNEKNISEYPNLSNNSISHISHTNIKSKKVKQNNDQDNHFHKKIINEQS
NVFQPKLKWLNIFTRNFNKDQLGTKYK
NT seq 6744 nt   +upstreamnt  +downstreamnt
atgactacaacggatacctggaaagttgagtgggacaatgaacttcgccagctcccaaac
gttgagtccgtaacatgttttgatttacaactaacggaaaatgtatttctgatatggcag
tttttaaaactttatctatctacgagcccccaagttagaagtatcatagacttcattgca
attaaaaaagctcagagcttacaatggggtgatcacattgatagtgtaatgtcaagtggg
ctaaggaaaggacaagaattatttcatgtatttttgtcgaatggaaaaaaaattcaaaca
acttattcaaaaaaaaaattatgtgatagattagaatattatcacattaagaattatatc
attttagaaaaaataaatacaggttctgtgggtcaagttcatgtggccttagacaaatca
actgatacattcgttgctgcgaaggccatagataaatccacagtacaaggtgatattggt
ttatttgaaaaattaaaagatgaaataaaaatatcatgcatgatgaatcacccgaatgtt
gttaaaacattgaacattttagagactaaggataaaattatccaaattatggaatattgc
gatgcgggggatttaatatcatacgttagaaataaactctatttggacgaagtaagtgct
caatatttttttcgtaaaatcgtggaagggttgaaatatatgcacaaaaataatattgca
catagagatttaaagcctgaaaatatatttttatgtaaaatacaaatatcacaaaaagag
aagacattgattagggttggtaaattaccttcatgtatagagtatgatttaaagattggt
gattttggtgcatgctgtataaatgagaaaaataaactacatcatgatattgtaggcacg
ttaagttatgcagcacctgaagtattaaattgtaataataacaatggatataatagtgaa
aaagctgatatatggagcttaggtataatattatatgctatgttatttggtttacttcca
tatgatagtgaagataaagatgtaaaagaagcatataatgaaattataaaaaagaaaatc
gtatttcctaaaaaccgtgttaataaattttctacaagtgtacgaagtttattattagct
atgttaaatattaatccacaaaataggttatcgcttgatgaagttatgaaacatgagtgg
ctagctggaacagctaaaaatagattagagatgtctaacataaataaaaaaataaatttt
cccatatcctcaactgttggatatccaatatattcaaataagaatattatggattataat
atttataaaaggttggcattaataaaaaatgatcataatagtagtactaactctttatat
agtaatggtaacagcacaactatttcgaatagtaacactactaatatgaataataatgtg
aataataatgtgaatagtaatgtgaataataatgtgaataataatgtgaataataatgtg
aataacaatatgcataacaatataatgaataatgtgtataataatatgagtaacaatata
agtgctattttaaaagtgaataatttaagagacaaaaataatatagcggaaaatacctat
aaattggatagcattactaacagtttatatggtgtccacaataataatgttaatagtaat
aatttgaaggaggtattatataatcatatgaaatattaccttaagggtgataacaaatat
aataatactccaggtgaacataaaaatgattacaatttggaaacattattaaagaaaaaa
gaagatcaagttgtgggagatctcaaggtgataaataaaaaggtaggacattatttaagt
agcaaaaatacaaaagagatcaatataaataataagatagccaatttggttgtagggaat
aaaaatggtaataataatattattgcaaaaaaaaatataatgattaataataataataat
gataataataatatatcatcagataatattccaaataaaatgtgcaaagtagataataat
atagtatcctataataaatttaatgtagagcattatgaatataataataaaggttgtatg
caaagtaaatgtaatcaaaataaaaaggatgaagaagtagtacatatgaataaactacat
tctatatgttctagtaatgatcataaattatatgaaatgtacatgtatcaaaaaaatgat
aataatatgaatgaacatgtgaattttattaataagagttcaaataaagaaatatcccga
ttagaaaacaagtatgtagaaaaaatatattatttaaaaaataatgatatgcatataaat
gatgattatataaaagataaagcaattaagaatgtagaaaaatataattttattaataag
gataaaaatagtagtacatataaaattaaggattatataaacaacaacacactgaataga
actaaatacaacattagagcggataaatttaataatattattgcattaaataatcacatt
atttcaaatgatacaaatagacatttatatataaataataaattatctattaataaacag
aaatataataatacaccatattataattactattattattattatgatgatgatgatgat
cgaaaaaaggaatataataaatatgtatataaaaaaaataaaaaatgtgggactaataat
agtgagcttatttcatataattcaagtgtgtatgaaaaaggaagtaccccctcttcttat
aatataaataatgtacccataagttatataaaacatgatagtatatataatggaagcctt
tctcaatatgtaaataactcctcatatgataaaaaaatattatcatcatcctatataaag
gataacgaaagtcatgttaacaaaatgaatattgaaaaatctaccatatggtattgttca
actaatgaattacctaatgatactatcaaaaaagatagtgtacataaaaaagagtctcta
tcacaagaatttcctgtaaataataatgatgatgttttagatataaaaaatgatgaacaa
agtaaatgtgcatataataattctgtggtggatgaaaaggaaaataataatataaatgtt
ggtgagttcaaaattatttctcctaataatttagatagcaataatatatcaagcactaaa
catataactgtgagagatacatataatgataatataaataaaacaaaggaagcctatatt
cttatcaagaaagatgtaaataatgcaaaatgtgataatatttttgagctaagtaaaatg
aatgaacatagtgaaaacggtaataatagcaaacatacaaatagtgatattgaaataaac
gatagagcaaaaaatcttaatgattttgttagcatgcatgaaatgaataattttaataag
gttgatgatactcaattatataaaaaaaaaatttcagaattgtcaaataataatgaaaag
tgttgtaacattaatgaggataaaaataaagagaataagaatatacatatgcatgttata
aaagaagatccaaataataataataatgataataataatacaaatataagtgcggataat
aattattcatacaaatacgttgatggtgatattaagagggaatgtgtttattcgacagat
gatataaattatgtgtatgtaaaaccttcagtatgttcattaaatgcagatggaaatgaa
aatacggagaaaattattaaaaatatgaatttttatggaatggataaaatatatagtact
attgttcaagagaaaaatgaagagaccaaggaagatataaatatggatcacataaaatat
aacataaatggtaatataaaagaagatattataaattcaaataatgttttcaatacacat
aatgagcaaccttttattgataacaaaataatgatgtcaaatattaatagtaaggacaat
acaaaaatgtatggtaatatttttcaaaacagaaatagtaatagtatatatgaaataaaa
agaaaagaaaaaatatatattataaatgtagatacaccagatgaatgtaatgaagtaaaa
tgtgatttttcatataacgatcataaaattgaagcaaataaagatggggataataaagaa
cataataataaagataaagatggagaaaatgatgaacataataataaagataaagatgga
gataatgatgaacataataataaagataaatatggagataataatgaacataattatata
gataacaatgaagacaattatatagataaagatgaatatgttaattattatcatgattac
aataatcctgaaaatattgatcataacaaatatgaacaaatatcaggattaaatattaaa
gagtatgatataaatgaaaaaggtaactataacaataaaaaaaaaaaaaaacaaaaaaat
gaacataagaaagaagccaattttacaaaacataaaatgtttatattagaagatcaaaaa
atgttgaatacaagacgagggaataatcacatgaagctaatggataaggattatataaat
gaatatataaaaatagaaacgtctaattattttaataaagaacatattaaaaaatatagt
tctttgtatggaaaaaatgaaaaaaaaaatgatataattaatattaggaattttaatgat
tgtatttccgattataaaaatagtatatgtgatggattccaagatataaaaaataattcg
gtaaaaaatatttttaatcaggataaaaaaatataccacgatttatctaataattgtgta
ttatataataatatatttactcaaactaatcttgaacatttttcttcaaataaacttgaa
tataacaaaaattgcaaatacccctataataatttaatgaaaaattattcctatagtgaa
tattcgttcgatatacaaaacaaaacgtctacatatacaaataaggttgacattaataaa
gctgatttgaaagaagcatactcagacaaaaagataaaatataaaattagcaatataacg
aaaaatgaacagatcaatatatatgatgatataaaaaaatgtagttctaataacaataat
actttttatattgatgacgaagcctcttgcttagacattacaaatttgagtgataaagaa
ataaagaacaaaaaagaaagagcgaaaaaaaaaaatatattaaataataaaaaatgtata
ttatcaaatggaagtaatatatttattggtaaggaatataaaaagaatcaacacatggat
tatatgaacaaaattaaaaagaacgaaaatgatgtgttatatctaaataattccgtttct
cttaaaagatcatttagtatgttacattttaatagaaatataaaaaatcatgttaattat
tattatgatgatcataataaagataggagagagaaggatatattattagtagatcatatg
aacaattatgtgatagaacataaaaataaaataaacatatataatataaacctaaataat
tctaatttaaataatataaataaaaatgaaaacaacaaaatagatagtataactagtata
gctaaaaaatgtcatagtagtgatatatttttaataagagataatatattaaataattta
tcaaataaagaattcaaaaatattatagcaagaaatgtgtcattaagtcatgaattccct
cttatacatacaaatgaagaattgaataaaaaaacaaagaaacaaattattaataataat
ataatatatgataaaattggtatttcaaataataaaaagtgtaacataccaaccaaaaaa
tatgttaataatatgtataatctaaaatataagaaatgtgaaccaaaccaacaatttaat
gataatgtcaaaaattataaagtcgataatgttgtatccgatttcatattaacaagtgaa
gaaagtctaatgaccaagaaaaacaacaaaaattataaaaatgataaaaatgataaaaat
tattttgataactcaaatataatatcatataatgaaatgaaaaaaaaagtaactatggaa
aacataaatatggattgtgtagtaaagaataaaacatatgataatatgaataaaagcaat
atgaaaaaaattaacttcaataaattaaatatatcgcataatacacaaaataataataat
catatatataataaaataaatacatatgataataatttaatgaatataaaggatacatta
ggtacatattcagttaccgaaaaacattattgtcgacaaaaaaatattatgaatgaaaag
gagatatttcattatgatcttatatcatcaaataattgggataatcatctacgtgattat
atgttatattctttatcaaaaaatcattatacatttttaagaaaaaacactttatcaaaa
gacattcctatgcatagtgatatcaatttatttaataataaaaaggaagatacaacaagt
aaaaataaaaatgaaaaaaattttaaaataaatcataatgaaaaaaatatttctgaatat
ccaaatttaagtaataattcgatttcacatatttcacacacaaatattaaatcaaaaaaa
gttaaacaaaataacgatcaggataatcatttccataaaaaaataataaatgagcaatca
aatgtatttcaaccaaaattaaagtggttaaatattttcactcgtaattttaataaggac
caattaggtactaaatataaatga

DBGET integrated database retrieval system