KEGG   Plasmodium falciparum 3D7: PF3D7_1447000
Entry
PF3D7_1447000     CDS       T00095                                 

Definition
(RefSeq) 40S ribosomal protein S5
  KO
K02981  small subunit ribosomal protein S2e
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PF3D7_1447000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pfa03011]
    PF3D7_1447000
Ribosome [BR:pfa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    PF3D7_1447000
SSDB
Motif
Pfam: Ribosomal_S5 Ribosomal_S5_C
Other DBs
NCBI-GeneID: 812030
NCBI-ProteinID: XP_001348622
PlasmoDB: PF14_0448
GeneDB: PF14_0448
UniProt: Q8IL02
Structure
PDB: 
3J7A 6OKK

Position
14:join(1929931..1929937,1930287..1930365,1930507..1931092,1931233..1931379)
AA seq 272 aa
MEDRGGFSRGFGRGVRGTRGRGGRGARGRGRGSAEDDLKNWVPVTKLGRLVKEGKIVSIE
EIYLHSLPIKEYQIIDYFFQPNECSHPLKDDVVKIMPVQKQTRAGQRTRFKAFVAIGDGN
GHCGLGVKCAKEVATAIRGAIISAKLSLIPVRRGYWGNKIGDPHTVPMKVSGKCGSVRIR
LVPAPRGTQIVGAPTTKKMLNFAGIKDCFSSSCGKTKTKGNFLRAIFNALSKTYGYLTPD
LWKVTNFDKSPYEEWSDFLETYQNLKGIKGTV
NT seq 819 nt   +upstreamnt  +downstreamnt
atggaagatagaggaggtttttcaagaggttttggaagaggtgttagaggaactcgtgga
agaggcggcagaggagcacgaggaagaggaagaggctctgcagaagatgatttaaaaaat
tgggttcctgtaaccaagttaggtagattagtaaaagaaggaaagatagtttctattgaa
gaaatatatttacattcattaccaataaaggaatatcaaataatagattatttctttcaa
cctaatgaatgttctcatcctttaaaagatgatgttgtaaaaataatgccagtacaaaaa
caaacaagagctggtcagagaaccagatttaaagcatttgttgctattggtgatggtaat
ggtcattgtggtttaggtgtaaaatgtgcaaaggaagtagctacagctattagaggtgct
attatttcagcaaaactttccttaatacctgtaagaagaggatattggggtaataaaatt
ggagacccacatactgtccctatgaaagtttctggaaaatgtggtagtgttcgtattcgt
ttagtaccagctccaagaggtactcaaattgtcggagctccaacaaccaaaaaaatgttg
aactttgctggtataaaggattgcttctcatcatcttgtggaaaaacaaaaactaaagga
aactttttgagagccattttcaacgctttgagtaaaacatacggttatttaacacctgac
ttatggaaagttacaaactttgataagtcaccatatgaagaatggtcagactttcttgaa
acttatcaaaatttaaaaggaataaaaggaaccgtttaa

DBGET integrated database retrieval system