KEGG   Plasmodium falciparum 3D7: PF3D7_1447900Help
Entry
PF3D7_1447900     CDS       T00095                                 

Definition
(RefSeq) multidrug resistance protein 2
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N DEAD RsgA_GTPase AAA_22 AAA_16 AAA_18
Motif
Other DBs
NCBI-GeneID: 812037
NCBI-ProteinID: XP_001348629
PlasmoDB: PF14_0455
GeneDB: PF14_0455
UniProt: Q8IKZ6
Position
14:complement(1954601..1957675)
Genome map
AA seq 1024 aa AA seqDB search
MDVSNYEYLRSYGIKNELKRKRTHKKIIIYHLLDIIIFFLLFFSCYNFNLELCYKYEKAI
FYNFFKSSVDLFLLNVIRIIYTVILFRLHKKLTELNTLGKVYVLSRHITGILVILNVIKM
INYSYVIKSENPLYNTNMYLITLKVLFMVYSMISSIYYYFIQFKLYNIKKKYIIARVELE
KILINDIKSKKYNIYKSDENSGLLGTDSNSTIMNNEYLNLDYKNLLDMNISYNKLNEKIN
NDIINNTSDVQEKNMDYNDIHNFQKKKKSSNFAYLNFFHKESKDNKIDVKESFLNKRYGS
NKRSSKIYDNNNNNNNNNINSKIDYLENNITYTEFKKILLPYLWPSKRIDMKGNSSILRT
YIVLIFLFILVSKVFSVISPIYLGWASNEVLKKSLSSSVYYLGLYVTFFFISKFLKEVCG
VLFSQVQQSAFIELQESIFQTFHNLSYEWYSSKNSGGIMRIVDRGTESANNLMSSVLMYI
IPATIEGLITCIIFIFKYKNSLLGSVLFIGLTLYIYSTIKITKWRKKIRTKANEMDNVYH
DIAHDSLTNYENVKYFSNEKFEIKKFCNALSNYHRYNLKILNSLGILNTVQQFILNGTLF
FTLLCVIYMIVKEGSDPGTFISVVVYTSNVFAPLSILGTLYATIIKSFTDISDLIDILRD
KIDISNDKNLKNFDLTSQEKKFGVSIEFNNVHFNYPTQPLHTSLKDINIYIKPGTTCALV
GHTGSGKTTISKLLYRFYDSKGEIKIGGRNINEYTRNSIRNIIGIVPQDTILFNESIKYN
ILYGKLDATEEELIQAVKSAQLYDFIQSLPKKWDTLVGDKGVKLSGGERQRISIARCLLK
DPKIVIFDEATSSLDSRTEYLFQKAVEDLRKNRTIIIIAHKLCTITTAELIILLNKGKII
ERGTHLDLLKCNGEYTEMWNMQSKSNEPHTETNSSIDKDDVNKNNNKNNDVILNTCKNDI
TTSFRSNSEKSSQEFSDASNHIKQSKTSNDHNNNINVHKKNEQEQLFLTNDKTDMDDNMN
NKKK
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atggatgtatcaaattacgagtatttaagatcctatggaattaagaacgaactgaaaagg
aaaagaacgcacaagaagataataatatatcacttattagatattataatatttttctta
ttattttttagttgttacaattttaatttagaattatgttataaatatgaaaaggcaatt
ttttataatttttttaaatcatcagttgatttatttttgttgaatgttataagaataata
tacaccgtaattttatttagattacataaaaagttaacagaattgaatacattaggaaag
gtgtatgtattatccagacatataaccggtatcttagttatattgaatgtaataaagatg
ataaattatagttatgtaataaaatcagaaaatcctctttataatactaacatgtattta
ataacactcaaagttttgtttatggtttatagtatgatttcatctatatattattatttt
atacaatttaaattatataatataaagaagaaatatattatagctcgagttgaattagaa
aaaatattaataaatgatattaaatcaaaaaaatataacatatataaatctgatgaaaat
agtggcttattaggaacagatagtaatagtaccataatgaataatgaatatttaaacctt
gattataaaaatttattagatatgaatatatcatataacaaattaaatgaaaaaataaat
aatgatattataaataatacttctgatgttcaggagaaaaatatggattataatgatatt
cataattttcagaaaaaaaaaaaatcttctaattttgcttatttaaattttttccataaa
gaaagtaaagataataaaattgatgtaaaagaatcatttttaaataaaagatatggtagt
aataaacgtagtagtaaaatatatgataataataataataataataataataatataaac
tccaaaattgattatttagaaaataatataacatatacagaattcaaaaaaatactttta
ccatatttgtggccaagcaaaaggatagatatgaaaggaaatagctctatattacgtaca
tatattgttctaatatttttatttatattagtatcaaaagtatttagtgtaatttctccg
atatatttaggttgggcatcaaatgaagtattaaaaaagagtttatctagttcagtatat
tatttaggtttatatgtaacatttttttttatatctaaatttttaaaagaggtttgtggt
gtattattttcacaagtacaacaatcagcttttatagaattacaagaatctatatttcaa
acatttcataatttatcatatgaatggtattctagtaaaaattcgggtggtatcatgaga
atagttgatagaggtaccgagagtgctaataatttgatgagttctgttttaatgtatatt
attccggcaacaatagaaggattaataacatgtattatatttatttttaaatataagaat
agtttattaggtagtgtattatttataggtttaactttatatatatattcaacaataaaa
attacaaagtggagaaaaaaaattagaacaaaagcaaatgagatggataatgtatatcat
gatatagctcatgattcattaacaaattatgaaaatgtgaaatattttagtaatgaaaaa
tttgaaatcaaaaaattttgtaatgcattatcaaattatcatagatataatttaaaaata
ttaaatagtttaggtatattaaatactgttcaacaatttatattgaatggtaccttattc
tttacattattatgtgtaatatatatgatagttaaggaaggatcagatccaggtaccttc
ataagtgtagttgtatatacatctaatgtatttgctccattaagtatattaggaacatta
tatgctactattattaaatcatttactgatattagtgatttgatagatattttaagagat
aaaattgatatatcaaatgataaaaatttgaaaaattttgatttaacatcacaagaaaaa
aaattcggtgttagtattgaatttaataatgtacattttaattacccaacacaaccatta
catacatcattaaaagatattaatatatacataaaaccaggtacaacatgtgctcttgta
ggtcatacaggttctggaaaaacaacaatttcgaaattgttatatcgattctatgattca
aaaggagagattaaaattggaggacgtaatataaatgaatataccagaaactccattaga
aatattataggtatagtaccacaagataccatattatttaatgaatctataaaatataat
attttatacggaaaattagatgccactgaagaagaattaatacaagctgttaaatcggct
cagttatatgattttatacaatctcttccaaaaaaatgggacactttagttggtgataaa
ggagtcaaattatcaggaggagaacgacaaagaatatctatagcaagatgtttattgaaa
gatcctaaaattgttatatttgatgaagcaaccagttcattagattcaagaaccgaatat
cttttccaaaaagctgtagaagatttaagaaaaaatagaaccattattattatagcacat
aaactatgtactatcacaaccgctgaattaattatcttattgaacaaaggaaaaattata
gaaagaggaacacatctagatttattaaaatgtaatggagaatacacagaaatgtggaat
atgcaatcaaaatcaaatgaaccacatactgaaacaaattcatcaattgataaagacgat
gtaaataaaaataataacaaaaataatgatgtcatacttaatacatgtaaaaatgatatc
accacaagttttagatcgaacagtgaaaaaagtagtcaagaatttagtgacgcaagtaat
catattaagcaatcgaaaacttctaatgaccataataataatattaacgtacacaaaaaa
aatgaacaagaacaactttttttaacaaatgataaaacagatatggatgataatatgaat
aacaaaaaaaaatag

DBGET integrated database retrieval system