KEGG   Plasmodium falciparum 3D7: PF3D7_1467100Help
Entry
PF3D7_1467100     CDS       T00095                                 

Definition
(RefSeq) DNA-3-methyladenine glycosylase, putative
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    PF3D7_1467100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pfa03400]
    PF3D7_1467100
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     PF3D7_1467100
DNA repair and recombination proteins [BR:pfa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     PF3D7_1467100
 Prokaryotic type
     PF3D7_1467100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pur_DNA_glyco
Motif
Other DBs
NCBI-GeneID: 812221
NCBI-ProteinID: XP_001348813
PlasmoDB: PF14_0639
GeneDB: PF14_0639
UniProt: Q8IKG6
Position
14:complement(2745815..2747320)
Genome map
AA seq 501 aa AA seqDB search
MEKMNEFSNNNNNNNNDDDDRGSLKLKQLRNSIKGKKRKHDSITKDNDIINASKVIIKKN
VMTTQLFDDINKLSYVYFLLKYYFDNNPLKILNENFYLKDDVLYITEILIGHILWVFDEK
QNKLYGSRIIELESYNGVNDKASHAYNNRKTNRNMSMFEKGGISYVYLCYGIHNCLNIVT
NIQNIPDAILVRSTEPLYNIEYFLSNKFEKISQYLLSNSIFIHKNIKEQQKNNSTPKNKR
NQQGNISNKDGNIINETNYLTKIDELINIFKMIKKKQLLKLCSGPGCVTKSQDITRQDDK
QYFFVGTNIEKENKTNTINNNNNNKRNNCSNLQKNSKYFNNNDYIKKNNNKSNNIHSDND
CSIDISNCTKENKQTNHCKNEYIQDHVNYNELMEYYYFLGNIHEIHKSRFFITLCPSIND
IMLFFENLNNPTYQNKHNYIYNIFNEHKNVLLQYFHFMKWDKENFIVQKDKRIGISYAQE
AALYDYRFLLKNHPSVSIFPK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgaacgaattctcgaataataataataataataataatgatgatgatgat
agaggttcactaaaattaaaacaattacgtaattctattaagggaaagaaaagaaaacat
gatagtataacaaaagacaatgatataataaatgcatccaaggttattataaaaaaaaat
gttatgacgacacaactgtttgatgatattaataaattgagttatgtatatttcttatta
aaatattattttgataataatccattgaaaatattaaatgaaaatttctatcttaaagat
gatgtattatatattacagaaatattaataggtcatattttatgggtttttgacgagaaa
caaaataaattatatggttctaggattattgaattggaatcttataacggtgtaaatgat
aaagcatcacatgcttataataatagaaaaacaaataggaatatgtctatgtttgaaaaa
ggtggaatcagttatgtatatttatgttatggtattcataattgtttaaatattgttaca
aatattcaaaatatacctgatgcaattttagttagatcaactgaaccattgtataatatt
gaatattttttatcaaataaatttgaaaaaatatctcaatatcttttgtcaaattctata
ttcatacataaaaatattaaagaacaacaaaaaaataattcaacaccaaaaaataaaagg
aaccaacaagggaacatatcaaataaagatggaaatattattaatgaaacaaattaccta
acaaaaattgatgaattaattaatatatttaaaatgataaagaaaaagcaattgttgaaa
ttatgtagtggtcctggatgtgtaacaaaaagtcaagatataaccaggcaagatgataaa
caatatttttttgtgggcacgaatattgagaaggaaaacaaaacaaatacaattaataat
aataataataataaaagaaataattgttcgaaccttcagaaaaattcaaaatatttcaat
aataatgattatataaaaaaaaacaataacaaaagtaacaatatacatagcgataatgat
tgttctatagatataagtaattgcacaaaagaaaacaaacaaacaaatcattgcaagaac
gaatatattcaagatcatgtgaactataatgaactaatggaatactattattttttaggt
aacattcatgaaatacacaaaagcaggttttttattactctttgtccatccataaatgat
ataatgcttttttttgaaaacctaaataatcctacataccaaaacaaacataattatata
tacaatatatttaatgaacataaaaatgtattattacaatatttccattttatgaaatgg
gataaagaaaattttattgttcaaaaggataaaaggataggaataagttatgcccaagaa
gctgccctatatgattatcgatttttattaaagaatcatccatccgtatctatttttccc
aaataa

DBGET integrated database retrieval system