KEGG   Plasmodium falciparum 3D7: PF3D7_1472600
Entry
PF3D7_1472600     CDS       T00095                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PF3D7_1472600
Enzymes [BR:pfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PF3D7_1472600
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2
Other DBs
NCBI-GeneID: 812276
NCBI-ProteinID: XP_001348868
PlasmoDB: PF14_0694
GeneDB: PF14_0694
UniProt: Q8IKB2
Position
14:complement(join(2962986..2963069,2963181..2963287,2963415..2963742,2963944..2965086))
AA seq 553 aa
MHIDKLLIVFIFLIKLCVCHTEKGVKKEIVSINIDEFNNILKDEGNYTLLIVYTHWSYNS
NLLLENLDKLSKLLLYEENIKLCKINAAANTFIIDKLDVYSYPSLFMIRNKEIYRYNGVN
NIRGLLLWIYQYLDFKIYEINNIERLDVFIDLNEYNNTILFFIFKDLGTANNNINNISRI
NDLINICLLTNKTLCYYIKENNVIDYFEKNIIQDKYHYNLKNINQDSYYAILFKNDEFDD
YFFPLNKKELDMLSNNEYTNEEKIDHLYNWINEREQPLVIQFSEHFFSMLFSNDAVTLFI
IYNNINNINKDDIIKCAKKYNHKIKFAISGTTQIFEKRLLNELLIEDNIKKPLMRITEFK
NYIRFPYKYKPQSDDQEINEKTIDDFINGYLQEKKYFYRKSERALPDEYNNGYIKIIVAD
NYDQYVYKNDMNVIVLYYAPWCGHCYKFEPVYREVGKRLNLYAAKFKNYKNDIIISKIDA
VNNEIYNIHIEGYPTIYLYKKGDKLNPVRYMEGRTVKNIITWICKETQSNIDISEFLNID
LDNEQLFENYEEL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgcatattgataagttgctgattgtttttatttttttaataaagttatgtgtgtgccat
acagaaaaaggagttaagaaggaaatcgtttctataaatattgatgaatttaataatatt
ttaaaagacgaaggaaactatacacttttaatagtgtacacacactggtcatacaattca
aatttattattagaaaacctagacaaactatccaaacttttattgtatgaagagaatata
aagttatgtaaaataaatgcagcagcaaatacatttattatagataagttagatgtgtat
agttatccatctttatttatgattcgaaataaagaaatatatagatataatggtgtgaat
aatattagaggattattattatggatatatcaatacttagattttaaaatatatgaaatt
aataatatagagagattagatgtttttatagatttgaatgaatataataataccatttta
ttttttatatttaaagatttaggaacagcaaataataatataaataatatatcaagaata
aatgatttaataaatatatgtcttctaactaataaaacactttgttattatataaaagaa
aataatgttatagattatttcgaaaaaaatataatacaggataaatatcattataattta
aaaaacataaatcaagattcatattatgcaatattatttaaaaatgatgaatttgatgat
tatttcttccctcttaataaaaaagaattagatatgttaagtaataatgagtatacaaac
gaggaaaaaatagatcatttatataattggataaacgaaagagaacaaccattagttata
caattttctgaacatttcttttctatgctattttcaaatgacgctgttacactttttatt
atttataataatataaataatattaataaagacgatataataaaatgcgcgaagaaatat
aatcataagataaaatttgcaatatctggtacgacacaaatttttgaaaagcgattactc
aatgagttgcttatagaggataatattaaaaaaccccttatgaggataacagagtttaaa
aattatataagatttccttataaatataagccacaaagtgatgaccaggaaataaacgaa
aagacaattgatgattttattaatgggtatttacaagaaaaaaaatacttttatagaaaa
agtgaacgagccttaccagatgaatataacaacggatatataaaaattattgtcgcggat
aattatgatcaatatgtttataaaaatgacatgaatgttattgtattgtattacgctcct
tggtgtggacactgttataaattcgaacctgtttatagagaagtaggaaaaagattaaat
ttgtatgcagccaagttcaaaaattataaaaatgatattattataagtaaaattgatgcc
gtaaataatgaaatatataacatacatatagagggatatcctactatatatctatataaa
aagggggacaaattaaatcctgtaagatatatggagggaaggaccgtcaaaaatattatc
acgtggatttgcaaagagacccaatcaaatatagacatatcagaatttcttaatatcgat
cttgacaatgaacaactatttgaaaattatgaagaattataa

DBGET integrated database retrieval system