KEGG   Phascolarctobacterium faecium: PFJ30894_00058Help
Entry
PFJ30894_00058    CDS       T05784                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pfac  Phascolarctobacterium faecium
Pathway
pfac00540  Lipopolysaccharide biosynthesis
pfac01100  Metabolic pathways
Module
pfac_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pfac00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    PFJ30894_00058 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pfac01005]
    PFJ30894_00058 (hldD)
Enzymes [BR:pfac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     PFJ30894_00058 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:pfac01005]
 Unusual sugar
  PFJ30894_00058 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: BBG62452
UniProt: A0A3G9H2H6
Position
complement(62316..63290)
Genome map
AA seq 324 aa AA seqDB search
MIIVTGGAGFIGSNIVKGLNDRGRDDILVVDNLTNMVKFKNIQGLKVMDYMDKMDFSEAL
KAGKFAHENVDVIFHEGACSDTMEYNGKYMMQNNFEYTKNLMHFAVDRKIQMIYASSAST
YGSGTNGFREEPACEEALNVYAFSKLFFDNYARRYFGKTNSQLVGLRYFNVYGPQENHKG
KMASMVFQMYNQWLAEKKVKLFDAYGDYGAGEQTRDFIYVKDVVKVNFFFWDHPEISGVF
NCGTGHAHTFNTLAQGVLKHFGSGELEYVPFPEVLKGKYQSYTQADATNLLAAGYDGGFT
DVNEAVAEYCAILDKSGGYYTHGA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtaaccggcggtgcaggttttatcggcagtaatatcgttaaaggcttaaat
gatcgcggacgcgatgatattttagttgtggataatctgactaatatggtcaaatttaaa
aacatccagggactgaaggtcatggattatatggataaaatggatttttctgaggcttta
aaggctggtaaatttgctcatgagaatgttgatgttattttccacgaaggcgcctgctct
gatacgatggaatataatggcaaatatatgatgcagaataactttgaatatacgaaaaat
ctgatgcattttgcagttgaccgtaagatacagatgatttatgcgtcgtcggcttctact
tacggcagcggtacaaacggatttcgtgaagagcctgcctgtgaggaagctttaaatgtt
tatgcgttttccaaattgttttttgataattatgcccgtcgttattttggcaagaccaac
agtcagttagtcggcctgcgctatttcaatgtttatggtccgcaggaaaatcataagggt
aaaatggcatctatggttttccagatgtataatcaatggctggcagagaaaaaggttaaa
ttatttgatgcttacggagattatggtgccggtgaacagacaagagattttatttatgta
aaagacgttgttaaagttaatttcttcttctgggatcatcctgaaatcagcggggtcttt
aactgcggaacagggcatgcccatacttttaatactttggcccaaggtgtactgaaacat
tttggcagcggcgaattggaatatgtgccgttcccagaagtattaaagggtaaatatcag
agctatactcaggcagatgcgacgaatcttttggcggcagggtatgacggaggttttact
gacgtgaatgaagctgttgctgaatactgcgctatcctggacaagagcggcggttattat
actcatggcgcataa

DBGET integrated database retrieval system