KEGG   Phascolarctobacterium faecium: PFJ30894_01475Help
Entry
PFJ30894_01475    CDS       T05784                                 

Definition
(GenBank) Farnesyl diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
pfac  Phascolarctobacterium faecium
Pathway
pfac00900  Terpenoid backbone biosynthesis
pfac01100  Metabolic pathways
pfac01110  Biosynthesis of secondary metabolites
Module
pfac_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:pfac00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFJ30894_01475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pfac01006]
    PFJ30894_01475
Enzymes [BR:pfac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     PFJ30894_01475
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     PFJ30894_01475
    2.5.1.29  geranylgeranyl diphosphate synthase
     PFJ30894_01475
Prenyltransferases [BR:pfac01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   PFJ30894_01475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: BBG63840
UniProt: A0A3G9H1A6
Position
1469874..1470749
Genome map
AA seq 291 aa AA seqDB search
MDFNKYYEDRQKLVNTFLEKRLEKKGISRVDEAMAYSLLAGGKRIRPIILMATADALGVS
GYNFLPVACGLEMIHTYSLIHDDLPCMDDDEYRRGRLTNHKVFGEALALLAGDALLTLAF
EVMLEQKNVPAEALIETVREVAMCAGNFGMVGGQVIDLDSEGRQISEEELRKLHAGKTGA
LFIAAVRSGARLSGAASDELLALTKFADLLGLAFQITDDILDVEGDAAQMGKAAHSDEKK
HKSTYVTLYTLEGAKALAQKTVDEALGCLEMFGENAEALREITKMMCGRKS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattttaataagtattacgaagacaggcagaagctggtcaatacttttctggaaaaa
cgtttggaaaaaaagggcatctcgcgtgtcgatgaagcaatggcttacagcctgctggca
ggtggcaagcgtatccgtcccataattttaatggcaacagccgatgctttgggtgtcagc
ggttataattttctgccggtagcctgtggtttagaaatgatccacacctattcgctgatc
catgatgatctgccttgtatggatgatgatgaatatcgtcgcggccgtttgaccaaccac
aaggtttttggggaagcgctggcgcttttggctggtgacgctttactgacccttgccttt
gaagtgatgctggaacaaaaaaacgtaccggcggaagctttgatcgaaactgtgcgcgaa
gtagcaatgtgtgccggaaacttcggtatggtcggcggtcaggtcattgatcttgattcc
gaaggcaggcagatcagtgaagaagaactgcgtaagctgcatgcaggcaaaacaggagca
cttttcattgcggcagttcgcagtggtgcgcgattgtctggtgctgccagtgatgaactg
ctggctttgacaaaatttgccgatcttttggggcttgctttccagatcacagacgatatc
cttgatgtcgagggtgatgctgctcagatgggcaaggcagcgcatagtgatgagaaaaag
cataagtccacttatgtgaccttatatactctggaaggcgccaaagcgctggctcagaaa
actgttgacgaggcgctgggctgtctggaaatgtttggagaaaatgccgaagctctgcgt
gagattacaaaaatgatgtgcgggcgtaaaagctaa

DBGET integrated database retrieval system