KEGG   Planococcus faecalis: AJGP001_12100Help
Entry
AJGP001_12100     CDS       T04955                                 

Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
pfae  Planococcus faecalis
Pathway
pfae00300  Lysine biosynthesis
pfae01100  Metabolic pathways
pfae01110  Biosynthesis of secondary metabolites
pfae01230  Biosynthesis of amino acids
Module
pfae_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pfae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    AJGP001_12100
Enzymes [BR:pfae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     AJGP001_12100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2 Fucokinase
Motif
Other DBs
NCBI-ProteinID: AQU79971
Position
complement(2384383..2385096)
Genome map
AA seq 237 aa AA seqDB search
MKQMDATEIISYIQNAKKATPVKAYIKGQGVADLDYGTESKVFGQGNSVTVFGEWADIQT
ALEENAALIEDSVVENDRRNSAIPLLDMKNINSRIEPGAFIRENVEIGNNCIIMMGAVIN
IGAVIGDGTMIDMGVIMGGRATVGKNCHIGAGAVLAGVIEPASATPVIVEDDVMIGANAV
VLEGVRIGKGAVVAAGAIVIEDVPENSVVGGTPARVLKLMDEKTRSKTEIKHELRQL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatggatgcaactgaaataatctcgtacatacaaaatgcaaaaaaagcgaca
cccgtaaaagcgtacataaaaggtcaaggcgttgctgatttggattatggcacagagtcc
aaagttttcggacaaggcaattcagtaactgtattcggcgaatgggcagatattcaaacg
gcactagaagaaaatgctgcgcttatcgaagattctgtagtggaaaacgatcgtagaaat
tcagcgataccactactagatatgaaaaacatcaatagccgcattgaacccggtgcattt
atccgtgaaaatgtagaaatcggaaacaattgtatcattatgatgggtgctgtaattaat
atcggtgctgttattggcgatggtacaatgatcgatatgggcgtaattatgggcggtcgg
gcgacagttgggaaaaactgccacatcggtgctggagcagtactagccggcgttatcgaa
ccggcatcagcaactcctgttattgtcgaagacgatgttatgatcggcgccaacgcagta
gttctcgaaggcgttcgtattggtaaaggtgcagttgtcgcagcgggcgcaatcgtcatc
gaagatgtgcctgaaaactccgtagtgggcggcacaccagcgcgcgtattgaaattaatg
gacgaaaagactcgttcaaaaacagaaatcaaacacgaactaagacagctataa

DBGET integrated database retrieval system