KEGG   Planococcus faecalis: AJGP001_14065Help
Entry
AJGP001_14065     CDS       T04955                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfae  Planococcus faecalis
Pathway
pfae00071  Fatty acid degradation
pfae00072  Synthesis and degradation of ketone bodies
pfae00280  Valine, leucine and isoleucine degradation
pfae00310  Lysine degradation
pfae00362  Benzoate degradation
pfae00380  Tryptophan metabolism
pfae00620  Pyruvate metabolism
pfae00630  Glyoxylate and dicarboxylate metabolism
pfae00640  Propanoate metabolism
pfae00650  Butanoate metabolism
pfae00900  Terpenoid backbone biosynthesis
pfae01100  Metabolic pathways
pfae01110  Biosynthesis of secondary metabolites
pfae01120  Microbial metabolism in diverse environments
pfae01130  Biosynthesis of antibiotics
pfae01200  Carbon metabolism
pfae01212  Fatty acid metabolism
pfae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AJGP001_14065
   00630 Glyoxylate and dicarboxylate metabolism
    AJGP001_14065
   00640 Propanoate metabolism
    AJGP001_14065
   00650 Butanoate metabolism
    AJGP001_14065
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AJGP001_14065
   00072 Synthesis and degradation of ketone bodies
    AJGP001_14065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AJGP001_14065
   00310 Lysine degradation
    AJGP001_14065
   00380 Tryptophan metabolism
    AJGP001_14065
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AJGP001_14065
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AJGP001_14065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AJGP001_14065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfae04147]
    AJGP001_14065
Enzymes [BR:pfae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AJGP001_14065
Exosome [BR:pfae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AJGP001_14065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AQU80333
Position
complement(2823208..2824401)
Genome map
AA seq 397 aa AA seqDB search
MAKTVIIDGARTAFGKFGGNLSTLTASDLGAEAIKAAMSRAAIQPEDVQEVIMGNVLQAG
QGQIPSRQAATKAGIPYNVKSETINKVCASGMRSVTLADQLIRLGDEEVIVAGGMESMSN
APYYLPKARWGLRMGDAQVVDGMVHDGLSCSFHPDRVHMGTYGNSTAEDFDLSREEQDKW
SARSHERAIKAKDLFAEEIVAIDIPQRKGDPITVDVDEAPRANSTIEALAKLKPAFGKDG
TITAGNAPGINDGAAALVLMSEERAQKEDKKVLAHILSHTEVAIEPHRFPETPGIVINEL
LQKTGKSLDDIDLFEINEAFAAVALASSKIAGLDAEKVNVNGGSVALGHPIGASGARIIL
TLAYELKRRGGGIGIAAICSGGGQGDAIMISVPKEEK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagtcattatcgacggggcacgtacagcatttgggaaattcggcggtaac
ttgagcacgctaacagcaagtgaccttggagcagaagccatcaaagccgcgatgagccgc
gcagctattcaaccagaagacgttcaagaagtgatcatgggtaatgtgctgcaagcagga
caaggccaaattccttctcgtcaagctgcgacaaaagcaggaattccatacaacgtaaaa
tctgaaacaatcaataaagtctgtgcatcgggtatgcgcagtgttacattagccgatcaa
cttatccgtttaggtgatgaagaagttattgttgcaggtggcatggaatcgatgtccaat
gcaccttattatttaccaaaagcacgctggggtcttcgtatgggagacgctcaagtcgtt
gacggcatggtccatgacggtttgtcatgctcattccacccagaccgtgttcacatggga
acttacggcaattcaactgctgaagactttgacttgtctcgtgaagagcaagacaaatgg
tcggctcgttcgcatgaacgtgcgatcaaagcaaaagatttgtttgcagaagaaattgtg
gcaatcgacattccgcagcgcaaaggagatccaattacagttgatgtggatgaagctccg
cgcgccaattcaacaattgaagcattggcaaagctaaaaccagcattcggtaaagatggt
accattactgctggaaacgcacctggaattaatgacggagcggcggcacttgtcttaatg
agtgaagaacgagcacaaaaagaagacaaaaaagttttggctcacattctttcacataca
gaagtcgcaatcgaaccacatcgtttcccagaaactcctggaatcgtcatcaacgagcta
ttacagaaaacaggtaaatcgttagacgacatcgatttattcgaaattaacgaagcgttt
gcagcagtagcattagctagctcgaaaattgctggacttgacgctgaaaaagtgaacgtc
aacggggggtctgtagcacttggtcacccaattggtgcaagtggtgcacgcattattctg
acactcgcttacgaattaaaacgtcgcggaggcggcatcggtatcgcagcaatctgctca
ggtggcggacaaggcgacgcgattatgatcagcgttcctaaggaggaaaaataa

DBGET integrated database retrieval system