GenomeNet

Database: Pfam
Entry: CagY_I
LinkDB: CagY_I
Original site: CagY_I 
#=GF ID   CagY_I
#=GF AC   PF14585.6
#=GF DE   CagY type 1 repeat
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Bateman A
#=GF GA   25.80 25.80;
#=GF TC   36.60 137.70;
#=GF NC   20.10 20.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Repeat
#=GF RN   [1]
#=GF RM   12823823
#=GF RT   A novel sheathed surface organelle of the Helicobacter pylori
#=GF RT   cag type IV secretion system. 
#=GF RA   Rohde M, Puls J, Buhrdorf R, Fischer W, Haas R; 
#=GF RL   Mol Microbiol 2003;49:219-234.
#=GF RN   [2]
#=GF RM   18295231
#=GF RT   The highly repetitive region of the Helicobacter pylori CagY
#=GF RT   protein comprises tandem arrays of an alpha-helical repeat
#=GF RT   module.
#=GF RA   Delahay RM, Balkwill GD, Bunting KA, Edwards W, Atherton JC,
#=GF RA   Searle MS;
#=GF RL   J Mol Biol. 2008;377:956-971.
#=GF DR   INTERPRO; IPR029285;
#=GF DR   SO; 0001068; polypeptide_repeat;
#=GF CC   This repeat is found at the N-terminus of the CagY proteins -
#=GF CC   part of the CAG pathogenicity island - and involved in delivery
#=GF CC   of the protein CagA into host cells ([1]).
#=GF SQ   3
#=GS O25262_HELPY/269-333  AC O25262.1
#=GS O25262_HELPY/139-203  AC O25262.1
#=GS O25262_HELPY/9-73     AC O25262.1
O25262_HELPY/269-333             ETSKKTQQHSPQDLSNEEATEANHFENLLKESKESSDHHLDNPTETQTNFDGDKSEEITDDSNDQ
O25262_HELPY/139-203             ETSKKTQQHSPQDLSNEEATEANHFENLLKESKESSDHHLDNPTETQTNFDGDKSEETQTQMDSE
O25262_HELPY/9-73                ETSKKAQQDSPQDLSNEEATEANHFENLLKESKESSDHHLDNPTETQTHFDGDKSEETQTQMDSE
#=GC seq_cons                    ETSKKTQQHSPQDLSNEEATEANHFENLLKESKESSDHHLDNPTETQTNFDGDKSEETQTQMDSE
//
DBGET integrated database retrieval system