GenomeNet

Database: Pfam
Entry: Centro_C10orf90
LinkDB: Centro_C10orf90
Original site: Centro_C10orf90 
#=GF ID   Centro_C10orf90
#=GF AC   PF17730.1
#=GF DE   Centrosomal C10orf90 
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   cORF:C10orf90
#=GF GA   25.00 25.00;
#=GF TC   42.10 35.60;
#=GF NC   19.60 22.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   20844083
#=GF RT   Centriolar association of ALMS1 and likely centrosomal functions
#=GF RT   of the ALMS motif-containing proteins C10orf90 and KIAA1731.
#=GF RA   Knorz VJ, Spalluto C, Lessard M, Purvis TL, Adigun FF, Collin
#=GF RA   GB, Hanley NA, Wilson DI, Hearn T;
#=GF RL   Mol Biol Cell. 2010;21:3617-3629.
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This is the N-terminal region found on proteins encoded by
#=GF CC   C10orf90. Most of the family members carry ALMS motif on their
#=GF CC   C-terminal Pfam:PF15309.SiRNA mediated functional analysis
#=GF CC   suggest that the C10orf90 encoded proteins have a role in
#=GF CC   centrosomal functions [1].
#=GF SQ   127
#=GS H2Q2R6_PANTR/52-563       AC H2Q2R6.2
#=GS A0A091PUL4_HALAL/16-513   AC A0A091PUL4.1
#=GS M3WGU0_FELCA/118-479      AC M3WGU0.2
#=GS A0A1S3N3W3_SALSA/297-483  AC A0A1S3N3W3.1
#=GS A0A2G9SGH8_LITCT/1-233    AC A0A2G9SGH8.1
#=GS G3INC3_CRIGR/5-366        AC G3INC3.1
#=GS A0A1U8CDW2_MESAU/5-363    AC A0A1U8CDW2.1
#=GS A0A091QHJ7_MERNU/15-510   AC A0A091QHJ7.1
#=GS A0A1U7SLD7_TARSY/5-516    AC A0A1U7SLD7.1
#=GS G1LL74_AILME/45-560       AC G1LL74.1
#=GS A0A091JVY4_COLST/14-502   AC A0A091JVY4.1
#=GS A0A087QZQ2_APTFO/15-514   AC A0A087QZQ2.1
#=GS Q5T025_HUMAN/5-516        AC Q5T025.2
#=GS A0A286XKX3_CAVPO/5-85     AC A0A286XKX3.1
#=GS G1NGT1_MELGA/5-497        AC G1NGT1.2
#=GS M7CLX3_CHEMY/5-285        AC M7CLX3.1
#=GS M0R7T5_RAT/60-310         AC M0R7T5.1
#=GS M3XTV1_MUSPF/51-551       AC M3XTV1.1
#=GS A0A0Q3UR94_AMAAE/1-494    AC A0A0Q3UR94.1
#=GS F6SFA2_CALJA/52-414       AC F6SFA2.1
#=GS A0A093NUE5_PYGAD/15-514   AC A0A093NUE5.1
#=GS U3JEB2_FICAL/51-377       AC U3JEB2.1
#=GS CJ090_HUMAN/52-563        AC Q96M02.2
#=GS W5PSX1_SHEEP/149-658      AC W5PSX1.1
#=GS H7C3F8_HUMAN/53-106       AC H7C3F8.1
#=GS A0A0G2K7C9_RAT/60-565     AC A0A0G2K7C9.1
#=GS G3UZQ0_MOUSE/5-83         AC G3UZQ0.1
#=GS A0A218UTB9_9PASE/76-553   AC A0A218UTB9.1
#=GS G1KG74_ANOCA/5-289        AC G1KG74.1
#=GS F1PC74_CANLF/93-515       AC F1PC74.2
#=GS F6YJ21_MACMU/5-208        AC F6YJ21.2
#=GS A0A1L8FJ63_XENLA/74-308   AC A0A1L8FJ63.1
#=GS A0A093QWQ2_PHACA/15-511   AC A0A093QWQ2.1
#=GS A0A2K5J588_COLAP/52-555   AC A0A2K5J588.1
#=GS A0A1S3N540_SALSA/70-256   AC A0A1S3N540.1
#=GS A0A093GR35_DRYPU/15-495   AC A0A093GR35.1
#=GS A0A1S3FN91_DIPOR/104-424  AC A0A1S3FN91.1
#=GS G1QJH5_NOMLE/44-555       AC G1QJH5.2
#=GS I3M3E2_ICTTR/142-654      AC I3M3E2.2
#=GS A0A091PFG8_LEPDC/15-514   AC A0A091PFG8.1
#=GS A0A091HTM8_CALAN/15-517   AC A0A091HTM8.1
#=GS A0A091GVC4_9AVES/15-514   AC A0A091GVC4.1
#=GS S4R3N7_HUMAN/5-209        AC S4R3N7.1
#=GS A0A0A0AZU2_CHAVO/15-514   AC A0A0A0AZU2.1
#=GS S9Y2G4_CAMFR/744-801      AC S9Y2G4.1
#=GS A0A091IYM6_EGRGA/15-512   AC A0A091IYM6.1
#=GS A0A1U8CD56_MESAU/5-512    AC A0A1U8CD56.1
#=GS G1PA28_MYOLU/5-370        AC G1PA28.1
#=GS F7ID75_CALJA/149-660      AC F7ID75.1
#=GS S9Y2G4_CAMFR/293-579      AC S9Y2G4.1
#=GS M3WGU0_FELCA/477-535      AC M3WGU0.2
#=GS H2NBY9_PONAB/5-369        AC H2NBY9.1
#=GS G1T596_RABIT/5-365        AC G1T596.1
#=GS A0A091FAL8_CORBR/14-501   AC A0A091FAL8.1
#=GS G7PEC3_MACFA/111-621      AC G7PEC3.1
#=GS G3UZF7_MOUSE/52-557       AC G3UZF7.1
#=GS A0A1S3N4C4_SALSA/297-483  AC A0A1S3N4C4.1
#=GS H2NBY9_PONAB/366-419      AC H2NBY9.1
#=GS A0A2I3LT04_PAPAN/52-563   AC A0A2I3LT04.1
#=GS A0A094LBY4_9AVES/15-514   AC A0A094LBY4.1
#=GS A0A091MDK1_CATAU/15-463   AC A0A091MDK1.1
#=GS F6UM76_CANLF/97-519       AC F6UM76.1
#=GS A0A286Y546_CAVPO/2-152    AC A0A286Y546.1
#=GS H0XDG2_OTOGA/45-548       AC H0XDG2.1
#=GS A0A091E6Q9_FUKDA/103-609  AC A0A091E6Q9.1
#=GS A0A096NSR5_PAPAN/149-660  AC A0A096NSR5.1
#=GS F6YRK0_MONDO/52-565       AC F6YRK0.2
#=GS F6WET6_RAT/9-185          AC F6WET6.2
#=GS A0A2K5M715_CERAT/52-563   AC A0A2K5M715.1
#=GS F7B477_HORSE/45-555       AC F7B477.1
#=GS G5BE48_HETGA/461-588      AC G5BE48.1
#=GS A0A091XBF9_OPIHO/15-514   AC A0A091XBF9.1
#=GS G3UY66_MOUSE/5-42         AC G3UY66.1
#=GS A0A091TSQ9_PHALP/15-513   AC A0A091TSQ9.1
#=GS G3UZA2_MOUSE/1-20         AC G3UZA2.8
#=GS A0A2I0MEF1_COLLI/92-513   AC A0A2I0MEF1.1
#=GS G3T7A1_LOXAF/5-514        AC G3T7A1.1
#=GS A0A093ESW0_GAVST/15-514   AC A0A093ESW0.1
#=GS A0A091KGR7_9GRUI/15-511   AC A0A091KGR7.1
#=GS Q9D4E0_MOUSE/1-151        AC Q9D4E0.1
#=GS A0A093D558_TAUER/15-480   AC A0A093D558.1
#=GS A0A0A0MSX2_HUMAN/52-563   AC A0A0A0MSX2.1
#=GS A0A1S3N401_SALSA/297-483  AC A0A1S3N401.1
#=GS A0A091HN62_BUCRH/15-513   AC A0A091HN62.1
#=GS A0A2I2YZZ5_GORGO/1-149    AC A0A2I2YZZ5.1
#=GS A0A091UQ23_NIPNI/15-518   AC A0A091UQ23.1
#=GS A0A093QEG8_9PASS/15-496   AC A0A093QEG8.1
#=GS A0A093C890_9AVES/15-518   AC A0A093C890.1
#=GS A0A1U8CDW2_MESAU/361-414  AC A0A1U8CDW2.1
#=GS A0A091RXP8_NESNO/14-513   AC A0A091RXP8.1
#=GS U3ITX9_ANAPL/15-320       AC U3ITX9.1
#=GS A0A226PST8_COLVI/1-355    AC A0A226PST8.1
#=GS A0A1U7SWX8_TARSY/52-563   AC A0A1U7SWX8.1
#=GS A0A0D9QWR7_CHLSB/111-622  AC A0A0D9QWR7.1
#=GS G5BE48_HETGA/45-420       AC G5BE48.1
#=GS V8P2M7_OPHHA/28-529       AC V8P2M7.1
#=GS L5MEQ4_MYODS/136-315      AC L5MEQ4.1
#=GS S9Y2G4_CAMFR/573-630      AC S9Y2G4.1
#=GS A0A151P496_ALLMI/74-200   AC A0A151P496.1
#=GS F7ID85_CALJA/53-564       AC F7ID85.1
#=GS A0A093LBP2_FULGA/15-516   AC A0A093LBP2.1
#=GS A0A1V4KI17_PATFA/1-474    AC A0A1V4KI17.1
#=GS G3QKX7_GORGO/44-555       AC G3QKX7.2
#=GS A0A093J3C1_EURHL/15-512   AC A0A093J3C1.1
#=GS L5KMM1_PTEAL/61-564       AC L5KMM1.1
#=GS A0A1U8D649_ALLSI/16-527   AC A0A1U8D649.1
#=GS A0A093F651_TYTAL/15-504   AC A0A093F651.1
#=GS H0VIF8_CAVPO/55-564       AC H0VIF8.2
#=GS G3U8X3_LOXAF/1-118        AC G3U8X3.1
#=GS U3JEB0_FICAL/1-84         AC U3JEB0.1
#=GS L5MEQ4_MYODS/5-145        AC L5MEQ4.1
#=GS G1U3C4_RABIT/3-141        AC G1U3C4.1
#=GS H7C3F8_HUMAN/1-55         AC H7C3F8.1
#=GS A0A151P4C3_ALLMI/74-341   AC A0A151P4C3.1
#=GS CJ090_MOUSE/5-510         AC D2J0Y4.1
#=GS A0A226PST8_COLVI/365-455  AC A0A226PST8.1
#=GS L9L4K1_TUPCH/45-380       AC L9L4K1.1
#=GS G3WKR9_SARHA/9-522        AC G3WKR9.1
#=GS F1SDM2_PIG/5-512          AC F1SDM2.3
#=GS L9L4K1_TUPCH/376-527      AC L9L4K1.1
#=GS A0A091NBA7_APAVI/15-509   AC A0A091NBA7.1
#=GS A0A1U8D631_ALLSI/90-601   AC A0A1U8D631.1
#=GS F6YJ13_MACMU/149-659      AC F6YJ13.2
#=GS E1B835_BOVIN/54-563       AC E1B835.1
#=GS K7FEJ8_PELSI/63-568       AC K7FEJ8.1
#=GS A0A151P496_ALLMI/227-383  AC A0A151P496.1
#=GS A0A1A6GEE0_NEOLE/1-93     AC A0A1A6GEE0.1
H2Q2R6_PANTR/52-563                  ..........................IVISQMIDENKSREDRASLPLPC.AIAQSRA..HHAKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPEAELPPKEER.PC.GGPRRGFASITITARRVGPPARALAW...GTAGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLK.VPEAHTGL.CDRR.KYWVTHADDKETSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPNSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGLV.NREPIS...EALKQELVEGDQDLVGQRWNPGLQESH-LKETPSLGRVHLG...tGACPWSGSFPLENT.ELANV--.GANQVIVRKGEKDHTT.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRH..QS.FLKPRILFPGFLCPLQD....VCASPQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.SPAAPSPAP---..RDGAGSPGLSEDCSESQ......................
A0A091PUL4_HALAL/16-513              ..........................IVISQMTDENKSKENWPALPMQS.MIPQPRA..YHTKQSLANHGSVGINRVFM..VLPS.RLEIQASLDNATSPLDSPIAEEK.QC.QNQQKGFASITITARRVAVGSSDPARg.pGAVQEPSTVSPASSKv.pAAFRCWPPPGKA-----------------NQCASPLK.ISESCSQL.GEEP.RKQLFDPGNKENGVGLQSSDGR.EGV......PPSFTSCVHLQVSQQCPNTIYYLDKSLNVCIDQPRINYQKIHRSVLSFHINCSSSRLTAD..GVDGIA.NGEPIE...VIFQTKLLGENETPLRSNLSAHLTENNVINKEKTNEGYLGS....-KYPLQSVFVSELP.AFVDIPR.GPNNVATTEKDDGKQS......---GSY..H..ATFSLQLPNSSDE-.-AEMLSGSKKKQRTMGRSS.GTASGSLPDTASRKAIVAATDGSSKKRDPCKDTSRSKEIQA..QG.ILKPKKSVSSSMCNIKA....SSRILSEENVHRQN-.QLLKSDYEFCGSSDKIKEHKEEDERER.ASR.VTLSTARSPDVT..REKNDALTRPETGSQTE......................
M3WGU0_FELCA/118-479                 ..........................VVISQLIDENKSKANRAALPAPC.-APALHA..RPAKPSRATRSGVSISRAFA..LLPG.KRAIQTPARKPGPDPELPSNEEK.PC.SGPQRGFASITITARRVGPPASALAW...EAVGDPLCTKCAAQG...ALLGDPSAPAGGTYPRPHHGPFACTEFSRNCSVVTLK.LPETHPRP.CGGH.ECWVTNVDNRENGFPPGAPRA-.GKR......PLVFSSCIHLRVSQQCPNSIYYLDRSLSVPIEQPQLAGPKMHRSVLSLHLNCSSHRLTPD..GVDGTE.NGGPMS...RALKPELAEGNQTLLGPRWNPGLHKSL-LKENPSPEQVHLR...pSACAWSGSPLLENT.AFSEV--.GANQVTGRKGKEDCAA......RHAGDG..A..NQLSIHIPGWSYTA.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------g.....................
A0A1S3N3W3_SALSA/297-483             ................masvpnvlgg-----------------------.-------..--------------------..----.-----------------------.--.-RPKTGFSSITITSCRISQSGANRSH...YPHQPILPIRPSTSL...--NPVMSHVLSSA-IPKHSQVVTRNKATIVKVTVYRQ.SYSACAKVqMRGP.GMRIAWPEHRHSYTGEDSLKDN.GSSfrpfslQPSFRSCVQLEVRWRSANTVLYLDKSLSISIGQPEVTKPVVHRSTLSLYVGGSSD-----..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------igts..................
A0A2G9SGH8_LITCT/1-233               ..........................-----MIDESDTEEDRKLGSAHC.MITKAGItcRQIKPFLTNCNSVSFNRTFM..PLPI.TLKHQTSLDKTIHGTVLHPSSEE.CS.PAKKKGFSSITITARRYIASLSHAPK...EITTDPASSQCRSND...LLMKASVSSDEH---DQQCRY-------LNSEEYNTR.APEPCGFF.HSHE.-L-PLQP--SATTLKYLNGI-H.KKN......SRLFISGVHIKVAHTFPGSIYYIDRSFFLPLGQ--VANPTTYKSTMYFKIQ---------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------prprrhtg..............
G3INC3_CRIGR/5-366                   ..........................IVISRLIDKKKSMENGAVSPVPQ.AITQPQL..CHTKPTSARHSGVNMHRPLA..--PD.RLGILTPSEEQGLEREPLSTGDN.LG.RGPQRGFSSITITARRVGPPDNSLVW...DTVREPQCPNCRAKD...ALLQGPPALARGAHLCQHNGSFTCTEFPSNGSIEGLK.VPQAHTRL.CTRQ.EYWVTHMDDKEDSCSSDSSPS-.KKV......PLVFGSCVHLRVSQQCPNAIYYLDKSLSVPLEQPQIASPKMHRSVLSLSLRCSSHRLTAD..GVDSTA.NGEPIS...RALPQELLEGKQDLLSPQWGQPQEGYW-KENPALKVPVHLG...nGTCPRTGSPPLENV.KFADV--.GRNQVPVRKEKENRAT......CPTSSH..A..NQLSIHIPGWSYRA.GE-----------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------......................
A0A1U8CDW2_MESAU/5-363               ..........................IILSQLIDEKKSTENGALLPLPQ.AITQPQL..CHTKPTLARHTGVNMHRPFA..--PD.RLGILTPSEEQEMEREPLSTGDN.LG.RGSHRGFSSITITARRVGLPSNSLVW...DTVREPLCPNCRVKD...ALLQGPPALAGGDHLCQHNESFICTEFPSNGSIEGLK.VPQAHTRL.CARQ.EYWVTHMDDKGDSCSSDRSPS-.RKV......PLVFSSCVHFRVSQQCPNAIYYLDKSLSVPLEQPQIASPKMHRSVLSLSLRCSSHRLTAD..GVDSTA.NGEPIS...RALPQEHLERKQD-LSPQWGQLQEGHW--KERPALVPVHLG...sGACPRTGSPPQENV.KFADV--.GRNQVPVRKEDEDCAT......CPTSSH..A..NQLSIHIPGWSYRA.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------d.....................
A0A091QHJ7_MERNU/15-510              ..........................IVISQMIDETKAKENWPSLPMQP.MVPQPSA..YHKKQPLANHGLVNVNRALT..ILPS.RLEIQASLDDTTSPLDSPRAEVK.LC.PTQQKGFAFITVTARRVAGGSSHPRHg.aGAVQEPSAVSPTSSKapaAALLRWPPPDST-----------------TQRASPFK.SPESCSQS.AQK-.--QIFDPGNKENGVSLQSSDGR.EKV......PPSFTSWVHVQVSQQCPNTIYYLDKSLNVCIEQPQIKCQKIHRSALSFRLNCSSCRLTAD..GVDGIA.NGEPIE...EIHQTKLLGENKPPLRSNLSADLTENNAINKEKTNEDCLAR....-KYSLQSVFVSELP.AFVDIPR.RPHNVVTTKKDDAKQP......---GSS..H..TTFSLQLPHPSDEA.GTQMLSGSKKQQHTMGRSS.TTTSGSLPETASRKAI--ATDGSLKKTVHSKNTSKSKEIQA..QG.ILKPKTSVFGSMCNIKA....SSRALVEENPHRQN-.QLLKSDYEFCGSSDKTKEGVEEDEQEQ.ASR.VTLSAACLPDVS..PEKNDVFTQPETSS---lth...................
A0A1U7SLD7_TARSY/5-516               ..........................IVVSQMFDENKSKQNGPSLPLSC.VIPQPRA..DHREPSLAHRSGVNIHRAFA..LLPG.RSGIPAPSDEQGPETDLPPKEEN.PR.GDPHKGFSSITITARRVGPPARALVW...GTVGDPLCPKCRTED...TLLHDSPPLVNDTHPHPLHRSFSCTEFSRNGSMVRLK.FPETRARL.SEGR.EYWVTHVDDKETNFSPDTSLS-.GKG......PLVFSSCVHLRVSRQCPNSIYCVDESVSVPTAPPQIANPKMHRSVLSLNLNCSSHRITAD..GVDGIA.NGEPIS...RALKQEFTKGNQNLLGPRWNPDLQATH-LKENPSLGRVHLG...tGTCPWSDSPLLENS.EFADV--.ETNQVTVKKWKEYRST.....pCHASGH..A..NQLSIHIPGWSYTA.VDTKVFPGSIKK-QEGEAR.MTLSVPPVEQKLIKHFLPDGASSPSDACQSSDLSEPTERRH..QS.FSKPRVPFPGFFCPLKD....ACTSLQEDNGTQIEK.EYPKGDYTCCDLVVKIKECQKSEDCAT.SEP.SPPSPSPVP---..PKGPESPGLSEDCSEPQ......................
G1LL74_AILME/45-560                  ..........................LVISQLIDENKSKANRAALPAPC.-APALHA..HPARPSRVNRSGVSISRAFA..LLPGgRLGTQTPAEEPGPDTELRPNEDK.PC.SGSQRGFASITITARRVGPPASTLAW...EAVGDPRCTECRAQG...ALLRDPFAPVGAADPRRHQGPFPCAEFSRNCSVVRVK.ARDADPPL.CEGR.QYWITDVDNRENSFPPGAPRS-.GKA......PLVFSSCVHVRVSQQCPNSIYYLDRSLSVPIEQPPLAGPKMHRSVLSLSLNCSSHGLTPD..GADGTA.KEGPIC...RALKQELAKGNRNLLGPRWNPGLQGSF-LKENPSLEQVHLG...sRTCPWRGSRLLENE.AFSGV--.GVHQVTVRKGQEDDTT......GHMARC..T..NQLSIHIPGWSYTA.VEAKVFSGSSKK-QQGETR.VTLSAPSVEQELVKEFLPNGCSSPSNSCQPSNFSEPSESQQ..QS.FLKSGITLSGFLCPLQD....LCTSLQEDSEVQIER.EFPKGDYKCCDLVVKIKECRKSEEAEP.ANP.EPVPPEPVPPEPapPEPPETPDLSEDCSEGQ......................
A0A091JVY4_COLST/14-502              .........................r-VVSQMIDEDKSKGSWPALPMQS.MITQPNA..YPTKQA----GSVNINQAFT..VLPS.RLETQATLDDTTSPSNCPITEEK.QC.PKQQKGFASITVTARRVAAASSDAASg.pGAVQDPSAVSPTSCK...-VLRRWPLPGTT-----------------NQRVSPLQ.FSNTCSQL.DEEL.QKGLFDPGNKERGVGLPKGDGR.AKV......PPSFISCVHLPVSQQCPSTIYYLDRSLVVCIDQPRIKCQKIHRSALSFTINCSSSRLTAD..GVDGIA.NGEPIE...EMLQTKLPGESKTPLRYNSSPDLAKNNVINKQKPKGSYLGS....-KYPLQTVLVSKLP.AFVSIPR.GLHDTVTAKEDDDKQS......---GSY..H..TTLALQPHNPS---.GTQVL-FGNKKQCTMGRKS.TIASVSLPDTASSKAIAAATDGLSKQRDPSKDTSTSKEIQA..HG.ILKPKMSVSSSMCNVKA....SSRILLEENVHRQN-.QLLKSDDEFCGSSDKIKDHEEEEEREG.ASR.VTPSTARSPEAA..PEENHTLTQPDTGSQPQ......................
A0A087QZQ2_APTFO/15-514              ..........................IVILQMIDANKSKENWPALPMQS.MIPQPSA..YHMKQSLANRGSVNINRALM..VLPS.KLEIQASLDDTTSPSDSPITEGK.QC.QNQQKGFASITITARRVAAGFSDLAHg.aGSVQELKAVSPTSSKv.pAALRRWPPWGHT-----------------NQNVSPLK.ISESCSQL.GEEP.QKRIFDAGNKENGVGLQSSDGR.EKV......PPSFISCVHLQVSHQCPNTIYYLDKSLNVCIDQPRIKCQKIHSSVLSFNINCSSSRSTAD..GVDGIA.NGESIQ...EIFKTKLLGENKTPLRSNWGADLTENNVINRETTNEGYLGS....-KYPLQSVFVSEPP.AFVDMPR.GPNKIVTTKKDDDKQS......---GSY..H..TVFSLQLPNSSHEA.GTQMLLGSKKNQCTTGRSS.TTASGSLPDTASRKAIAAATDGSSKKRDPSKGTSKSKEIQA..QG.ILKPKMSASNSMCNRKA....SSRILLEGNVHRQN-.QLLKSDYEFCGSSDKIKECKEEDKWEQ.ASR.VTLSTARLPDVT..CEKNDTLTRPETVSEPE......................
Q5T025_HUMAN/5-516                   ..........................IVISQMIDENKSRENRASLPLPC.AIAQSRA..HHAKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPEAELPPKEER.PC.GGPRRGFASITITARRVGPPARALVW...GTAGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLK.VPEAHTGL.CERR.KYWVTHADDKETSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGLV.NREPIS...EALKQELLEGDQDLVGQRWNPGLQESH-LKETPSLRRVHLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHTT.....hCHASDH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRH..QS.FLKPRILFPGFLCPLQD....VCASLQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.SPAAPSPAP---..RDGAGSPGLSEDCSESQ......................
A0A286XKX3_CAVPO/5-85                ..........................IVISQLIDENRSKENATALPLPC.AMAQPRA..CPTKPASAHLSRVNIHRAFA..LLPD.RLGIPTQSDGGGPQIDLLPSGQS.AC.G-------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------h.....................
G1NGT1_MELGA/5-497                   ..........................IVISQMIDETKLKENRSALLMQA.VTPQPSA..CHTKQSLANDGSVNITSTFA..VLAS.RLEIQSSLDDTTSPSGCPIADGK.QC.QK-QKGFASITITARRVTAGSSDPTWg.pRAVPEPHAATPTLSEi.pAALRHRLSPDQA-----------------NPQVTPSR.VSDCCSKL.SREL.RERFFSLRNRENGVGLQSSDGR.EKV......PPSFTSSVRFQVSQQCPNPIYYIDKSLNVCLDRPRIKCQRIYRSALSFNINCSSSRLTAD..GVDGIG.NGESIE...KMLQLSNSSGKLSL-LTHQEGSVDGKNVNERVWLLPNVGNS....-SIQRSGGPSAPLHgNVADV--.GDMDPRCKQEGKASST......CCNTRR..E..GCLHLHSIGWEKKApRKQMRSGSQKKQCTMSRRS.KTASASFLGTTLGKATTAATDGSPKKSDPSKGTSASKEIQA..QG.VLKPKMSISNCTCNIKA....SSRVLLEEKVHRQN-.QLLKS-YKCLVLEI--KLFGKEEEPDVgSEP.EKGSPT------..-----------------pltlqgsriapspssrr.....
M7CLX3_CHEMY/5-285                   ..........................IVISQLIDETKSKENVSALPMQS.VITQPNA..YHTKQSLANHSSVNINRAFM..LLSS.RLGIQASFDDNVSRTNS------.--.--RKKGFASITVTTRRVVPPFNNPVQ...VAVTDSLCLKCWGGD...-VLMNTTATSNNAGRAQHCKPLHNQESYRNRYATRLK.VSESYSQV.CGGH.GDWIFNIENKENRIFPPGSNHR.KKA......PVSFTSSVHFKISQDCPNTIYYFNKLLSVCIDQLQIKSQKIHRSILSFNINCSSPRLTPD..GADGIA.NGESIA...EILKTKLPEENKTPLRANSNADLKEN---------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------......................
M0R7T5_RAT/60-310                    ..........................VVISRLIDEKKSMENGAVLSQ--.AIAQPQL..CPPKPASARPGGVSKHRPFA..LSPD.GLGILAPSDEQGLEIEPLSTGDN.LG.KGPRSGFSSITITARRVGPPASNLVW...DTFRDPLCSKCGTKD...AGFQDPPVLASGAHLCQHNRPYSYTEFPSNGSVEGLK.VTQAHSRL.CARQ.DYWVTHADDNEDSFSSDNSPS-.RKV......PLVFSSCVHLRVSQQCPSAIYYLDKSLSVPLEQPQIASPKMHRSVLSLSLRCSSHQLTAD..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------......................
M3XTV1_MUSPF/51-551                  ........................ld--ISQLIDESKSKVDRAALLVPC.-TPALHA..HPARPSRGSRPGVCIGRAFG..LLPG.GLGTPTPAAGPGPDTEPP-RSPK.PG.SGPQRGFASITITARRVGAPASPAAW...AAVRDPRCPECRAQG...-------------APRRHQGPFACADFSRNGSVMRLR.VPETDPRL.CGGP.QYWIADVDSRESSFPPGAARS-.GEG......PLVFSSCVQVRVTQPCPNSTYYLDRSLSVPVEQPQLAGPQMHRSVLSLNLKCSSHGPTAD..GAGGPA.NAGPRS...GAGEPAIPEGNQSPLGPRWNPGLQGSF-LQEIPSLEQVPLG...pRTCPWRGSRLLEKQ.GFSSA--.AVHQVTGRKGREDDRT......TTGGGG..G..SQLSIHIPGWSYTA.VEAKVFSGSSEK-QQGEAC.GTLSAPPVEQKLIKEVLPDGYSSPSNSCQSSNFSELSESQQ..QS.FLKSGITLSGFLCPLQD....LCTSPQEDSDVQIER.EIPTGDYQGCDLVVKIKECRKSEEPEP.AAP.KPAPPKPVPPEPtpPEPPETPGLSEDCSE--gp....................
A0A0Q3UR94_AMAAE/1-494               ..........................-----MIDENKSKENWTILPMLS.MIPQPSA..YHTKQSLANCGAANXNRAFM..VLPS.RIEIQASLSDTTSPLESPITEEK.RC.QKQQKGFASITITARRVAAGFSDPAHg.sGAVQEPNAVPPTSSKvpaKSLHCWPPHGHT-----------------NQHASPLK.ISESCSQV.SKEP.PKQLFDSGNK-NSVGLQSSDGR.EKV......PPSFISCVHLQVSQWCXSTIYYLDKSLSVCIDQPRIKCQKIHRSALSLXINCSLSRLTAD..GVDGIA.NGEPIE...EIFQXKLLGENKTPLRSNLSADLTENSVINKEKTNGGYLGN....-KYPVQSVFVSELP.AFVDIPR.GPNXXVTAKKDDGEQS......---DSY..H..TTFSLQLSNSSDEA.GTQMLLGSKKIQCTTGRSS.XTDSGSLPDTAFRKAVAVASDGSLGKRDPSKGTSRSKEIQA..QG.ILKPKISVSRSLCSITA....SSRTLLEENVHREN-.QLLKSDYEFRGSNDKLKERQEEDEQEG.ASR.EALEIH------..-----------------kpqficrsrerlkrleqmvqlr
F6SFA2_CALJA/52-414                  ..........................MVMSQMIDESKSRENRASLPLQC.AMAQSRG..RHTKPSLANRSGVSIHRAFP..FLPG.TLGIPTPSDELGPGTELPPKEES.PC.EGPHRGFASITITARRVGTPASALVW...GTVGDSLCPKCRAED...TLFRAPPALANGPHPGRHRRAFACTEFSRNSSEVRLK.VPEAPTGL.CERR.EAWVTHADDKETNFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPTSIYYVDKSLSIPFEQPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGIV.NGEPIS...TAPKQELEEGDQDLLGQRWNPGLQESH-LKEAPSLGRVHLG...tGTCSWSDSFPLENA.EFADM--.GTNQVTVRKGIKDHEA.....hCHASGH..A..NQLSIHIPGWSYRA.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------......................
A0A093NUE5_PYGAD/15-514              ..........................IVILQMIDANKSKENWPALPMQS.MIPQPSA..YHMKQSLANRGSVNINRALT..VLPS.KLEIQASLDDTTSPSDSPITEGK.QC.QNQQKGFAYITITARRVPAGFSDLACg.aGSVQELKAVSPTSSKv.pAALRRWPPWGHT-----------------NQNISPLK.ISESCSQL.GEEP.RKRIFDAGNKENGVGLQSSDGR.EKV......PPSFISCVHLQVSHQCPNTIYYLDKSLNVCIDQPRIKCQKIHSSVLSFNINCSSSRLTAD..GVDGIA.NRESIQ...EIFKTKLLGENKTPFRSNWSADVTENNVINRETTNEGYLGS....-KYPLQSVFVSEPP.AFVDMPR.GPNNIVTTKKDDDKQS......---GSY..H..TVFSLQLPNSSHEA.GTQMLSGSKKNQCTTGRSS.TTASGSLPDTASRKAIAAVTDGSSKKRHPSKGTSKSKEIQA..QG.VLKPKMSVSNSMCNRKA....SSRILLEENVHRQN-.QLLKSDYEFCGSRDKIKECKEEDKQEQ.ASR.VTLSTARLPDVT..CEKNDMLTRPETVSEPE......................
U3JEB2_FICAL/51-377                  ...................aviaqaa--------EGKSRGSQPSLPMQA.LVPQPRA..CPS------HGSAIASRRFL..VPPS.RVEIQASSAETMAPSDCPGAQQS.--.PSQQRGFASITVTARRVPVGSAELA-...-------PVSPTSSNv.pAGLQRWPPPADQ---------------------PPPK.LSKSCSKS.GEQP.PEQLSVPGIKEDGVSLQSSDGR.EEM......PPSFISSVQLQVSQPCPNSIYYLDKSLSVCIDQPRVKCQKMYRSTLSLRLKCSLSGLTAD..GVDGIA.NGEPME...DRAPGEIPGANGAPLAAHLSTGCTGNKGIGKGRGKGGHWSS....-KYPLQSVFAPGLA.AFVAVPR.GPHQAAAAQEEDEQP-......---GGH..H..AVFSLQIPHASNET.G------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------kw....................
CJ090_HUMAN/52-563                   ..........................IVISQMIDENKSRENRASLPLPC.AIAQSRA..HHAKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPEAELPPKEER.PC.GGPRRGFASITITARRVGPPARALVW...GTAGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLK.VPEAHTGL.CERR.KYWVTHADDKETSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGLV.NREPIS...EALKQELLEGDQDLVGQRWNPGLQESH-LKETPSLRRVHLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHTT.....hCHASDH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRH..QS.FLKPRILFPGFLCPLQD....VCASLQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.SPAAPSPAP---..RDGAGSPGLSEDCSESQ......................
W5PSX1_SHEEP/149-658                 ..........................IVISQLIDENKSKENGAALPAPC.------A..YPMKPSLANRSRVTINRAFE..FLPG.GLGVQTPAGEPGLETKLPPKEEK.PC.SGSQKGFASITITARRVGPPASTLVW...EAVGDPLCVKCRAQD...ALLGDPSALAGDADPTQHHGPFTCTEFSRNSCVMGSK.VPEAHAQL.CEGH.GYWITSVDHREDRFSPGTSRSRaGKS......PLVFSSCVHLRVSQSCPNPIYYLDRSLSVPVEPPQLAGPKMHRSVLSLNLSCSSHRLTPD..GVDDTE.NREPGS...GALKPELREGDQDLLGPRWNLGLQGSF-LKENPSLGQMRFGnleaGRGPWRGSLPSENA.EA-----.GTNQITMRKRKEDQAT.....rCPTRGH..HqaNQLSIHIPGWSYTA.VEPNVFSGSSEK-QQEGAH.ETVSAPPVEWKLVRDPLPDGSSSPSNSSQSSDLSEPTESQQ..QR.LPKPKVPLPGFLCPFQD....LCASPQEEHGVQIER.EAPEGDYTCCDLVVKIKECKESEHPAN.PKS.KPAPPEPAP---..PEDPETHVQPEDCSESQ......................
H7C3F8_HUMAN/53-106                  .........................r-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---AGDYTCCDLVVKIKECKKSEDPTT.PEP.SPAAPSPAP---..RDGAGSPGLSEDCSESQ......................
A0A0G2K7C9_RAT/60-565                ..........................VVISRLIDEKKSMENGAVLSQ--.AIAQPQL..CPPKPASARPGGVSKHRPFA..LSPD.GLGILAPSDEQGLEIEPLSTGDN.LG.KGPRSGFSSITITARRVGPPASNLVW...DTFRDPLCSKCGTKD...AGFQDPPVLASGAHLCQHNRPYSYTEFPSNGSVEGLK.VTQAHSRL.CARQ.DYWVTHADDNEDSFSSDNSPS-.RKV......PLVFSSCVHLRVSQQCPSAIYYLDKSLSVPLEQPQIASPKMHRSVLSLSLRCSSHQLTADpxGVDSPA.NGEPIS...RALSQELSEGKQDLLGSQWGQPQEGHW--KESPALVPVHLG...sGTCPQTGSPPLENV.KFADV--.GRNQVPVHKEKEDHAT......CTNGSH..L..TN--SHIPGWITRA.ETKVLSRSKKQQ---HQAQ.RTLSAFPVGQKPIKHFPPDGDSLPSNDGQPNILSESHKRQH..SY.FMTPKVPLSGFFCPLQT....VCASLQEDDAIQIE-.TQFPKDYTCCDLVVKLKDCEKHEDPTVtPEP.SPATPSPAT---..RAGPQSSGPLEDSFEP-l.....................
G3UZQ0_MOUSE/5-83                    ..........................VVISRLIDEKKSMENGAILPQ--.AIAQPQL..CPTKPALARRDGVSMHRRFA..LSPD.RLGILTPSDDQGLETEPLSTGDN.L-.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------gkg...................
A0A218UTB9_9PASE/76-553              .........................i-IITQ-IDEDKSRGNQLSLPMQA.LIPQPRA..CHTKPSLTNQGSAIVSRTFL..VLPS.RLEIQASSEDSMSPSDSPSP--K.RC.PRQQRGFASITVTARRVPVGSGDLARg.pGAGQEPSTVSPTSSKv.pALLKHWPPPARA-------------------NQPPLK.VSKSCSNL.GEEP.QKQLFDPGIKEDGVALQSSDRR.EKI......PASFISCVQLQVSEPCPSTIYYLDKSLSVCIDQPPVKCQKMYRSTLSLSLKCSLSGLTAD..GVDGIA.NGEPME...ERAPRKLPGAHRAPLRSHLSADFTGNKVIKEKKTKEGHLGR....-KYPLQSVFASGLP.AFVDIPR.EPPKAAAAKEEDEQP-......---GSH..H..AVFSLQIPNSSNEA.GTPMLLGSRKRS------S.TTTPGSLPDAAPRETIAAAPDGSSNWADPSKDTSKSKEIQA..QA.VLKPKMSFSSSVCNITA....SSRILWEENVHGQK-.QLLKSNSESPAPRDRTKELEAQDQRGG.-RR.VTLPTVTLPTVT..-----------------lptvtlpr..............
G1KG74_ANOCA/5-289                   ..........................VVISQIINENNSNENKTVFTRHS.VITQSGA..NHVNQSLANHSSVNINRAFI..LLPR.RLGIQISSDDNVFGTEIDS---K.EC.HNQKKGFASITITARRVIPPRNRKIQ...VDTSDPSCLKCQENK...PLMNTLLASNET-VPHQLCRPLHTRGSCQNQNATKTK.VSEPHPQL.CKGL.----SNTENKENRVVPPGNNPN.KEA......PISFTSSVHLSVSQHNPNAIYYVDKSLSVPIHQPQTRSPKTHRSVASFRINCSSSSLTPD..GVNGLA.NGKIIT...EVLKTKLPEDAKTLLEAIWNADLEED---------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------y.....................
F1PC74_CANLF/93-515                  ......................ppge-----------------------.-------..--------------------..----.-----------------------.--.PGPPRGFASITITARRVGPPAGSLAW...EAQG-----------...ALLAEPCAPAA---PRGHQGPCTCAELSRTCSVMRLK.VPETQPRL.CEAH.GYWVTNLEDHQEDTFPPGAPQA.GKG......PLVFSSCVHLRVSQQCPSSGGYLDGALPGPAQQPQRAGPKMHRSVLSLHLSCSSHRLTPD..GADGPA.NGAPLC...SALKQELTQRSPDLPGRHWNPGLQESF-LKENPALEQVHLG...pSACPCSGSRRVEDR.AFSDV--.GVNQVTVSKGREDYPD......CGPGRG..A..SQLAIHIPGWSYAT.VETKVFSGSSKK-QLREAR.VTLSAPPVEHKLVKDFLLDEYSSPSNCCQSSNFSEPSESQQ..QS.LLKSRIPLSGFLCPLQD....LCTPPQEDSGVQIER.EFPKGDYKCCDLVVKIKECRKSEEPEP.APP.EPAPPKPAT---..PEPPETPDLSEDHSEG-q.....................
F6YJ21_MACMU/5-208                   ..........................LVISQMIDENKLRENRASLPLPC.TMGQARA..HHTKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPETELPPKES-.HC.GGPRRGFASITITARRVGPPASALLW...GTVGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSGNSSVVRLK.VPEAHTGL.CERR.KYWVTHVDDKGTSFSPDTPLS-.GKS......PLVFSSCVHLRV------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------......................
A0A1L8FJ63_XENLA/74-308              ........................fn----KMTDGNETEGEKHLFSRQP.VIPQPNS..SHEKQSMADHNSVSTNRAFT..ALPI.KLEIQTTLDKSIHGPNLNSNHQK.QS.HTVRKGFSSITITAKKNNPQSNHAEI...KTVPEPIMSLCRNNN...MAFQGSDFSSELHQPSQD------KHRHLSLSASRCR.TFHTCLQT.SSST.PCRACIC-RKENSHLS-SSNG-.-ED......RVSFISSIYSTTNQVSPAVISYVDKSLALCLGKIKTSSQNIYKSEMSFKIN---------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------hh....................
A0A093QWQ2_PHACA/15-511              ..........................ILILQMIDENKSEKNHPTLPVRP.MILQPSA..YHTQWSLANHGSVNVNRARM..VLPS.RLEIQASLEDIMSPSDSPITEGK.QC.QNQQKGFASITITARRVAAGSSDPARg.aGAVQEPNAVSPTLSKi.rAALRHWRPPGHT-----------------NQNVSPLK.ISESCSQL.GEEP.QKWIFDPGNKESGVGLQSSGGR.EKV......PPSFISCVHLQVSQQCPNTIYYLDKSLNVCIDQPQIKCQKIHRSALSFSINCSSSRLTAD..GVDGIA.NGEPIE...EIFKTKLLGENKTPLRSNWSADLTENNIINRETTNEGYLGS....-KYPLQTVF--ELP.AFVAIPG.GPNDVVTTKTDDDKQS......---GSY..H..TT-SLQLPNSSDEA.GIQMLLGSKKQQCTTGRSS.TAASGSLPDTTSKKAIAAATDGLLKKRDPSKGTSKSKAIQA..QA.ILKPKMSVSDSMCNRKA....SLRILLEANVHGQN-.QLLKSDYEFCGSSDKIKERKEEDERER.ASR.VTLSAARSPDVT..REKNDALTRPETSSQPE......................
A0A2K5J588_COLAP/52-555              ..........................LVISQMIDENKPRENRASLPLPC.TIGQARA..HHTKQSLANRSGVSIHRAFA..LLPG.RLGIPAPSDERGPETELPPKEES.PC.GGPRRGFASITITARRVGPPASALLW...GTVGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSGNSSVVRLK.VPEAHTGL.CERR.KYWVTHVDDKE----PDTPLS-.GKS......PLVFSSCVHLRVSQQCPNSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLSCSSHRLTAD..GVDGLV.NREPIS...GALKQELVERDQDLVGQRWNPGLQESH-LKETPSLERVHLG...tGARPWSGSFPLENT.ELANV--.GVNQVTVRKGEKDHAT.....hCRASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEAC.MTLSAPPVEQKPTRHFLPIGDSSPSDDCLSGDLSEPTERRH..QS.FLKPRILFPGFLCPLQD....VCASPQEDTGVQIES.KCPKGDYTCCDLVVKIKECKKSEDPTT.PEP.STAA----P---..PERAGSPGLSEDCSEPQ......................
A0A1S3N540_SALSA/70-256              ................masvpnvlgg-----------------------.-------..--------------------..----.-----------------------.--.-RPKTGFSSITITSCRISQSGANRSH...YPHQPILPIRPSTSL...--NPVMSHVLSSA-IPKHSQVVTRNKATIVKVTVYRQ.SYSACAKVqMRGP.GMRIAWPEHRHSYTGEDSLKDN.GSSfrpfslQPSFRSCVQLEVRWRSANTVLYLDKSLSISIGQPEVTKPVVHRSTLSLYVGGSSD-----..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------igts..................
A0A093GR35_DRYPU/15-495              ..........................IVPSQMV-EQKSKLNWPALPMQP.TIPQPSP..YH--------------RAFK..IHPS.RLEIQASLDDTTSPLDSTTAEEQ.QC.QKQQQGFAFITVTARRVAAGSSNLAPg.pGAVQEPNTVSPSLSKv.pAVLCHCPPPNHV-----------------PQHDSSLK.IAESLSQA.AQRQ.---FFDPGNKENHASLQSSDGR.EKV......PPSFTSCVHFQVSQHCPNTIYYLDKSLNVCIDQPRIKCQKLHRSALSFSRNCSSSRLTAD..GVDGIA.NGEPIE...EIHRTKLLGGNKTLLSSKLSADLTGNNAINKKKTNEGDLTS....-KHPLQSVSDSELP.VFVDIPR.RLNNIATKR-HDAKQA......---GSY..H..TAFSLQIPNSNDEA.GTQMLSGSEKQPCTMGRSS.TTTSGSLPDTVSRKSVTAATDDSLKQRDSSKGTSKFKEIQA..QG.ILQPKTFVSRSMCNIKA....S-RIVSEENVHEQN-.QLLKSDYEFRASSDKRKECEVEEGKRDgAHR.AALSVAYLLDVP..NDKNDPRSQPQTR----nlle..................
A0A1S3FN91_DIPOR/104-424             ..................afadpggg-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.------------------SPS-.GQA......PLVFSSCVHLRVSRPCPRAIYYLDKTLWVPAEPAPGPRAGTHRSVLSLSLDCSSHTPTAD..GVDGTA.NGEPRG...GGLEPGPGRPPLHLPGPAWLPPWGPAP-----PPDGRPKEK....-PGPGPERVCLGTG.GFADA--.GTPQLAVKKRRGEHAG......----GP..G..GQLSIRIPGWSCRA.VETKVFSGSSKE-QQGQSR.VTLSAPSVEHKPFKHSPPDGDSSPSDDGQSSDLSEPTERQS..PR.FLIPKAPLPGFLCPFRD....SCSSPQEDSGVQIGR.EFPKGDYTCCDLVVRIKECEKEDRGTP.-ES.SSAPLSP---VQ..PARPQTPDLLEDGSEPQ......................
G1QJH5_NOMLE/44-555                  ..........................IVISQMIDENKSRENRVSLPLPC.AIAQSHA..HHAKQSLANCSGVNIHRAFA..LLPG.RLGIPASSDERGPETELPPKEES.PC.GGPRRGFASITITARRVGPPASALVW...GTVGDSLCPKCRAED...TPFQAPPALANGAHPGWHQRSFACTEFSRNSSVVRLK.VPEAHTGL.CERR.KYWVTHADDKETSFSPDTPLS-.GKS......PLVFSSCVHLRVSQRCPNSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGLV.NREPIS...GALKQELVEGDQDLVGQRWNLGLQESH-LKETPSLGRVHSG...tGACPWSGSFPLENT.ELANV--.GANHVTARKGEKDHAT.....hCHASSH..A..NQLSIHIPGWSYSA.VHTKVFSGCSKR-QQGEVC.ITMSAPPVEQKPTRHFLPIGDSSPSNDCLSRDLFEPTERRH..QS.FLKPRILFPGFLCPLRD....VCASLQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.SPAAPSPAP---..SDGAGSPGLSEDCSEPQ......................
I3M3E2_ICTTR/142-654                 ..........................IVISQLIDENKPREPGAALPLPC.AIAQPRA..CPTKPASTSRSRVSIHRALA..LLPG.KLGVHRRSDERGSEAERLPTAD-.--.PGLRKGFASITITARRVRPAASALVW...GTVGESPCPRCRAED...ALLGVPSAVTDGAQPHQHHGPFDCAECPRNGSVTRLK.VPEARAGL.CAGN.EYWVTHVDHQESGFSADPRPS-.GKT......PLAFSSCVHLQVSRQCQNSIYYLDKSLSVPVEPPQIASPKVHRSVLSLNLSCSSHGLTAD..GVDGPA.NREPMS...SGLRQELAEGNPNLQSPRWSPALQESH-SKENPSLGRVHLG...tGACPWSSSPLSENI.ELADV--.GTNLDTVRKGKEDHAA......PGTSSH..A..EQLAIHIPGWSYKA.VETKVYSGSTKE-QHGAAG.VSLSAPPEEQKPIKPFPPDGDRPPSDDCESSDLFEPRERQH..PS.LLSPKVPMPGFLCPSQE....ARPTLQEDNGAQIER.GLPEGEYTCCDLVVKIKECKKSEDPTV.PEP.PPAPPSPAPPSPaaPQGAETLDLSQEGSEL-e.....................
A0A091PFG8_LEPDC/15-514              ..........................IVISQMIDENKSKEDWPALPMQS.MIPQPSA..YRTMQSLANPGSVNINRAFM..VLPS.RLEIQASLDDTTSPLDSPIAAEK.QC.QNQQKGFASITITARRVVVDSSNPAHg.pGAVQEPNGVSPTSSKv.pAALHRWPPPGHS-----------------NHHAAPLK.ISEFCSQL.GEEP.RKRLFDPGNKENDASLQSSDGK.EKV......PPLFTSCVHLQVSQQCPNTIYYLDKSLNVRIDQPRIKCQKIHRSALSFNINCSSSRLTAD..GVDGIA.NGEPVE...EILQTKLLGENKTLLRSNLSADLTENNVINKEKTNEGYLGS....-KYPLQIVFVSELP.AFVDILR.GPNNRVTTKKDDDMRS......---GSY..H..TTLSLQLPNSSDEA.ETQTLRGSKGKPCTTGRSS.ATASDSVPDTAPSKAITAATDGSLKKRDHSKATSKSKEIQA..QG.ILKPKMSVSSSMCNIKA....SSRILLEENVHGQN-.QLLKSDYEFRGSSDKIKERKEEDEREP.ASR.GTLSVARSPDVT..RKKNDMLAQPETSSQPQ......................
A0A091HTM8_CALAN/15-517              ..........................IVISQMIDENKSKGICPALPLHS.TCPQPTA..WHMKQSLGSHGPANLDRTLV..ALPS.RLKIQAPPGDTTLSLDSAVAAKK.QC.PNQQKGFASITITARRVAMGFRSPKFg.aGTLQEPKNLSPTSSKv.lGDLQRWHPPGQA-----------------TQSAAVFR.ISESCSQT.ALKP.QKQLFDPGKKENSLSHPSSDGK.EKV......PPSFISCVHLQVSHQCPSTIYYLDKSLNLCIDQPRIKCQKIHRSTLSFTINCSSSRLTAD..GVDGIA.NGEPIE...ERCHTKLLGAKQAPLCSNFRANFRENNIVNKVKRLEGSLGS....-KYPWQSVFVSELP.AVVDMPR.GPNNSELMRKGNKKSQglekknVPMLKN..L..GLFFLFFPG-----.-TQMLLGRQKQQCPMGRSS.AMASGSPPDTASRNVTDAAPDCSLKERDLCKGTSKPKENEA..QH.VLNPKIFIFSSMCNKKA....SPRSLLEENVHRQN-.QLLKSDYEFCGSSDKMQEPQEEERQEP.ASR.MGLPRTLLPDVP..GEISSTSILPELGSQP-g.....................
A0A091GVC4_9AVES/15-514              ..........................IVILQTINGNKSKENWPTLPMLP.VIPQSGA..HHMKQSLTNNGSVNINKAFM..VLPS.RLEIRASLDDTTSPLESPVTGGK.EC.QNRQKGFASITITARRVAVGSSKPACg.aGAVQEPNAVLPNTSKv.pAALRCCPPLVHT-----------------NQHVSPLK.ISEASSQL.GEES.QKQNFGPGNKENGVGLQSSSRR.EKV......PPTFISCVHLQVSHQCPNAIYYLDKSLNVCIDQPRIKCQKIHRSALSFNIKCSSSRLTAD..GVDGIV.NGEPIK...GMFKTKLIGENKTPLRSTWSADLTENNVINRETTNEGYLGS....-KYSLQSIFVSEVP.ALVAIPR.GPNKVVTIMKDDDKHC......---GSY..H..TTFSLQLPNPSNEA.GTQVLLGRKKQPCTTGWSS.TVASGSLADTTSRKAIAAANDASSKKRERSKVTSKSKEIQV..PG.ILKPKMSVSSSVCNIKS....SSSIFSEENVHRQN-.QLLKSDYEFCGSSDKIKECKEEDEWER.ASR.VTLSTALLPDVT..REKNDMLIQPENSSQPE......................
S4R3N7_HUMAN/5-209                   ..........................IVISQMIDENKSRENRASLPLPC.AIAQSRA..HHAKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPEAELPPKEER.PC.GGPRRGFASITITARRVGPPARALVW...GTAGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLK.VPEAHTGL.CERR.KYWVTHADDKETSFSPDTPLS-.GKS......PLVFSSCVHLRV------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------......................
A0A0A0AZU2_CHAVO/15-514              ..........................ILISQMIDENKSKENWPALPMQS.TIPQPSA..YRMKQSLANHGSVNVNRAFM..VLPS.RLEIQASLHDTTSPLGSPITEEK.QC.QKRQKGFASITITARRVAAGSSDPARg.aGAVQEPNTMSPTSSEi.pAALRRWPPLGHA-----------------NQNVSPLK.ISEPCLQL.GEEP.RKRIFDPGNQENGVGLQSSDRR.EKV......PPSFISCVHLQVSQQCPNTIYYLDKSLNVCIDQPRIKCQKIHRSVLSFNINCSSSRLTAD..GVDGIA.NGEPIE...EILKTKLLGENKTPLRSNWSADLTETNVINRETTNEDYLGS....-TYPLQSGFVSELP.LFVEIPR.GPNNVVTTKKDDDKQC......---GSY..L..ATFSLQLPNSSDET.GTQMLSGSKKQQCTMGRSS.ATASGSLPGRASRKAIAAATDGSSEKRHPSKGTYKSKEIQA..QG.VPKPKMSVSRSMCNIKP....SARILSEENVHRQN-.QFLKCDYEFRGSSDKIKDRKEEDERER.ASR.VTLSTARSPDVA..RAKNDALTRPETGSQPE......................
S9Y2G4_CAMFR/744-801                 ....................vpgadq-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.--VMGDYTCCDLVVKIKECKRREDPTT.--P.EPTSPEPAP---..PGGPVAHDLSEDCPESQ......................
A0A091IYM6_EGRGA/15-512              ..........................IVILQMIDENKLKENWPASPVQS.MIPQPSA..YHMKQSLANHGSVKINRAFM..VPPS.RLEIQASLDDTTSPSNSPITEGK.QC.QNWQKGFASITVTARRVAAGSSNPACg.aGTMQEPNAVSPTLSKv.pAALHRWPPPGHT-----------------NQNASPLK.ISESCLQL.GEEP.QKRIFDPGNKENGMSLQSSDG-.-KV......PPSFISCVHLQVSQQCPNTIYYLDKSLNVCIDQRRIKCQKIHRSALSFNINCSSSRLTAD..GVDGIA.NGEPIE...EIFKTKLLGENKTPLRSSWSADLTEKNAINRETTNEGYLGS....-KYPLQSVFVSELP.AFADVPR.GPNNAVTTQKDEDKQS......---GSS..H..ATYALQLPNSSDEA.GTQMLSGSKKQQCTTDRSS.TTASGSLPNTASRKAIIAATDGSSKKRDPSKGTSKSKEIQA..QG.VLKPKMFVSDSMCNRKA....SSRNLLEENVCRQN-.QLLKSDYEFCGSSDKIKERKGEDKQER.ASR.VTLSTARSPDVP..REKNDALTQPETDSQPE......................
A0A1U8CD56_MESAU/5-512               ..........................IILSQLIDEKKSTENGALLPLPQ.AITQPQL..CHTKPTLARHTGVNMHRPFA..--PD.RLGILTPSEEQEMEREPLSTGDN.LG.RGSHRGFSSITITARRVGLPSNSLVW...DTVREPLCPNCRVKD...ALLQGPPALAGGDHLCQHNESFICTEFPSNGSIEGLK.VPQAHTRL.CARQ.EYWVTHMDDKGDSCSSDRSPS-.RKV......PLVFSSCVHFRVSQQCPNAIYYLDKSLSVPLEQPQIASPKMHRSVLSLSLRCSSHRLTAD..GVDSTA.NGEPIS...RALPQEHLERKQD-LSPQWGQLQEGHW--KERPALVPVHLG...sGACPRTGSPPQENV.KFADV--.GRNQVPVRKEDEDCAT......CPTSSH..A..NQLSIHIPGWSYRA.ETKVLSGNSKEQ--QGEAQ.VTLPSSPAGQKPIKHFPPVRDSPPSHDGQCSIFPEPQERRHlhPY.FLTHRVLLPGFLCPLQA....ACASLQEDDTVHIE-.KESPKDYTCCDLVVKLKEWEKRKDLIA.-TP.VPSSAMPSP-AT..AEGPQSPDPSEGSSEP-p.....................
G1PA28_MYOLU/5-370                   ..........................LVISQLIDENKPQEKGAAVPALC.ADAQPPT..WPGKRALASRSGVTINRAFA..FLPG.QLGPQPPAGVQGPEPALTPKEEK.QPgGSPQKGFASITITARRVGPPARALVW...GTGGDPLCSRCRAQD...PQLRDPPALASGADPGRHHGPLACTEPSGSSPVMRLG.FPEAHARL.CDGR.QYWVASVDRGEDRFSPGRPRS-.GQG......PLLFSSCVHLRVSRRCPNATCSPDRSPSVPMEPTQLAGPQTHRAVLSLNLNCSSHRRTPD..GADGPA.TGGPIS...SSLKPQLAEV-SGLQGPRWAPALH--------PSLGQVHLG...aGTCPWSGPPPTEST.ELADA--.GTRQITARKGKGDHGTph.htgGHTSAH..A..NQLSIHIPGWSYRK.Q------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------lsvhg.................
F7ID75_CALJA/149-660                 ..........................MVMSQMIDESKSRENRASLPLQC.AMAQSRG..RHTKPSLANRSGVSIHRAFP..FLPG.TLGIPTPSDELGPGTELPPKEES.PC.EGPHRGFASITITARRVGTPASALVW...GTVGDSLCPKCRAED...TLFRAPPALANGPHPGRHRRAFACTEFSRNSSEVRLK.VPEAPTGL.CERR.EAWVTHADDKETNFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPTSIYYVDKSLSIPFEQPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGIV.NGEPIS...TAPKQELEEGDQDLLGQRWNPGLQESH-LKEAPSLGRVHLG...tGTCSWSDSFPLENA.EFADM--.GTNQVTVRKGIKDHEA.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSDKR-QPGEAC.LTLSAPPVEQKPTKHFLPFGDRSPSDDCLSRDLSEPTERRR..QS.FLKPRIPFPGFLCPLQD....VCASPQEDNGIQIES.KFPQGDYTCCDLVVKIKEWKKSEDPAT.PEP.SPAAPSPAH---..PEGAGSPGLSEDCSEPQ......................
S9Y2G4_CAMFR/293-579                 ..........................IVISQLIDGKKSRENGAVLPV--.----PPA..CPMKPPLANRSAGTIHRAFA..FLPG.RLGIQTRLGERGPVTGLPPKEEKpPC.SGSPKGFASITITARRVVPPASTLVW...QAVEDPLCIRCRAQD...TLLGDPPALASGADPSQHHGPFTCAGFSRNSAVMRLK.VPEAHAGL.CAGH.EYWITNVDNRGGSFPPGTLRS-.GKS......PPVFSSCVHLRVSQQCPNSIYYLDRSLSVPIEPPRLAGPKMHRSVLSLSLSCSSHTLTPD..GAAGTV.NAEPMS...RALKPELTEGSQTLPGPSWNLGLQE----------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------fa....................
M3WGU0_FELCA/477-535                 .........................t-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---AGDYKCCDLVVKIKECRKREEPEP.APP.KPAPPEPVPPEPapPARPETPDLSEDCSEYQ......................
H2NBY9_PONAB/5-369                   ..........................IVISQMIDENKSRENRVSLPLPC.AIAQSRA..YHAKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPETELPPKEKS.PC.GGPHRGFASITITARRVGPPARALVW...GTVGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLK.VPEAHIGL.CERR.KYWVTHEDDKETSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPNSIYYVDKSLSIPIEPPQNASPKMHRSVLSLNLNCSSHRLTAD..GVDGLV.NREPIS...GALKQELVEGDQDLVGQRWNPGLQESH-LKETPSLGPVRLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHTT.....hCHASGR..A..NKLSIHIPGWSYRA.G------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------d.....................
G1T596_RABIT/5-365                   ..........................VVIPQLMHEKESKEDGAALALPC.AIARPRA..CHMKTAPTTRSGVHLHSAFA..LLPG.GTGIPAPSDEPGPRTGLPPRGEA.RG.GGSRRGFASITITARRIGPPAGTLVW...GTVGDPPCPKCRVDD...ALAGGTRPQWRQ-------GPVACTEFSRNGSVARMK.VPELQAQL.CEGR.DSWVTHVDHREDSFSAEATPS-.GQG......PLVFSSCVHFRVSQQCPKSMHYLDKSLFIPIQPPATASPQWHRSVLSLNLNCSSHGLTAD..GVDGPA.NGEPRQ...RAQS---------LPSPGCNPALQECHLQGSPEGSGQAHLG....-AGPWTSSLPLENT.EFTGA--.GTDQDTIAKGAEDHAP.....hRHARGQ..A..SQLSIHIPGWSYTA.DEMLH--------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------islhkscski............
A0A091FAL8_CORBR/14-501              .........................p-VITAQIDEHKPKGNQPSLPMQA.LIPQPRA..CHTKPSLPNHGSAIVSRTFL..VLPS.GLEIQASLEDTMSPSDSPSTN--.QC.PSQQRGFTYITVTARRVPVGSGEDQVhgpGAGQEPNTMSPTSSKv.pAALGCWPPPAHS-------------------NQPPLK.ASKSCSKL.GEEP.QKQLFDPGIKEDGVGLQSNDGR.EKV......PPSFISCVQLQVSQPCPNTIYYLDKSLNVCIDQPRVKCQKTYRSTLSFSLKCSLSGLTAD..GVDGIA.NGEPME...ERAPRKLPGASRAPVRSHLGADFTGNKVIKKESTKEGHLGS....-KYPLQSVFASGLA.AFMDIPR.GPHNTVATKEEDEQP-......---GSH..H..TVFSLQIPNSSAEA.GTPMLLGSRKRN------S.TTAPGSLPDAASREAIAAATDGSSNRAVPSKDTSKSKEIQA..QG.VLKPKMPFSDSVCNRKA....SSRILREENVHRQK-.QLLKSDYEFCGSRDRTKELKAQDEVS-.LSR.VTLSRARSPGVT..WEKN-------------lltwpgsssqle..........
G7PEC3_MACFA/111-621                 ..........................LVISQMIDENKLRENRASLPLPC.TIGQARA..HHTKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPETELPPKES-.HC.GGPRRGFASITITARRVGPPASALLW...GTVGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSGNSSVVRLK.VPEAHTGL.CERR.KYWVTHVDDKGTSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPNSIYYVDKSLSVPIEPPQIAGPKMHRSVLSLNLSCSSHRLTAD..GVDGLV.NREPIS...GALKQELVEGDQDLVGQRWNPGLQESH-LKETPSLGRVHLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKHHAT.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTLSAPPVEQQPTRHFLPIGDSSPSDDCLSRDLSEPTEGRH..QS.FLKPRIPFPGFLCPLQD....VCASQQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.ATAAPSPAP---..PETAGSPGLSEDCSEPQ......................
G3UZF7_MOUSE/52-557                  ..........................VVISRLIDEKKSMENGAILPQ--.AIAQPQL..CPTKPALARRDGVSMHRRFA..LSPD.RLGILTPSDDQGLETEPLSTGDN.LG.KGSHSGFSSITITARRVGPPASSLVW...DTFRDPLCPKCKAKD...ALFQEPPVLAGDAHLCQHNRPFTCTESPSNGSVEGMK.VFQAHSRL.SARQ.DYWVTHTNDNEDSFSSDNSPS-.RKV......PLVFSSCVHFRVSQQCPNAIYYLDKSLSVPLERPQIASPKMHRSVLSLSLRCSSHQLTAD..GVDSSA.NGEPIS...TALSQELSEGKQDLLGPQWGQPQGGHW--KESPALVPVHLG...sGTCPRTGSPPLENV.KFADV--.GRNQVPVRKEKEDHAT......CTSSSH..T..NQLSIHIPGWSYRA.ETKVLSGSKKQQ---QEAQ.RTLPAFPVGQKTIKHFPPEGDSSPSSDGQPSILSESNERQH..PY.FMIPRVPLPGFYCPLQT....GCASLQEDGAVQIE-.THFPKDYTCCDLVVKLKECEKNEDPTVtPEP.SPATPSPST---..PEGAQSSDPSEDSYEP-l.....................
A0A1S3N4C4_SALSA/297-483             ................masvpnvlgg-----------------------.-------..--------------------..----.-----------------------.--.-RPKTGFSSITITSCRISQSGANRSH...YPHQPILPIRPSTSL...--NPVMSHVLSSA-IPKHSQVVTRNKATIVKVTVYRQ.SYSACAKVqMRGP.GMRIAWPEHRHSYTGEDSLKDN.GSSfrpfslQPSFRSCVQLEVRWRSANTVLYLDKSLSISIGQPEVTKPVVHRSTLSLYVGGSSD-----..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------igts..................
H2NBY9_PONAB/366-419                 .........................r-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---AGDYTCCDLVVKIKECKKSEDPTT.PEP.SPAAPSPAP---..PDGAGSPGLSEDCSEPQ......................
A0A2I3LT04_PAPAN/52-563              ..........................LVISQMIDENKPRENRTSLPLPC.TIGQARA..HHTKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDEPGPETELPPKEES.PC.GGPRRGFASITITARRVGPPASALLW...GTVGDSLCPKCRAED...TLLQAPPALANGTHPDRHQRSFACTEFSGNSSVVRLK.IPEAHTGL.CERR.KYWVTHVDDKGTSFSPDTPLS-.GKT......PLVFSSCVHFRVSQQCPNSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLSCSSHRLTAD..GVDGLV.NREPIS...GALKQELVEGDQDLVGQRWNPGLQESH-LKETPSLGRVQLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHAT.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTLSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTEGRH..QS.FLKPRILFPGFLCPLQD....VCASPQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.ATAAPSPAP---..PETAGSPGLSEDCSEPQ......................
A0A094LBY4_9AVES/15-514              ..........................IVISQMIDEKKSKENWPALPMQS.VIAQPSA..YHRKQSLANCGSVNISRVFT..VLPS.RLEIQASLDDTMSPLDSPIAEEK.QC.QNQQKGFASITVTARRVAVGSSNPVCg.pGAMQEPNAVSPTSSKv.pAALHRWPLPGHS-----------------NKNASSLK.TPEFCSRL.GEEQ.WKWLFDPGNKENGVGLQSSDGR.EKV......PPSFLSCVHLQVSQQCPNTIYYLDKSLNVCIDQPRTKCQKIHRSALSFNINCSSARLTAD..GVDGIA.NGEPIE...EIFQSKLLGENETPLSSNLSADLKEKNVINKKRTNKGYLGS....-KYPLQRVFLSEFP.AFVDIPR.GPNNVVATKKDDDKQS......---GSY..H..TTFSLQLPNASDEA.GTQMLLGSKKQQYTTGRSS.ATASGSLPDTASRKAIAAATDGSSKKKDPSKGTSESKEIQA..QA.ILKPKISVSNSMCNIKA....PSRILSEENFHMQN-.QLLKSDYEFCGSSDKVEECKEEDEQER.ADR.VTLSTAHSPDVT..REKNNVLTRPETGSQPE......................
A0A091MDK1_CATAU/15-463              ..........................IVISQMIDENKSKENWPALPMQS.MIPQPSA..YDRKQSLANHGSVNINRAFT..IFPT.GLEIQASLDNTTSPLDSPIAEEN.QC.QNQQKGFASITITARRVAVGSSNPAHg.pGPMQESNAVSLTLSKv.pAALRRWPPPGHA-----------------NQHASPLK.ISESCSQL.GEEP.RKRLFDPGNKENGVGLESSDGK.EKV......PPSFTSCVHLQVSQPCPNTIYYLDKSLNVCIDQPRIKCQKIHRSVLSFNINCSSSRLTAD..GVDGIA.NGEPIE...EAFQTRLLGENKTPLRSNLSADLTENNVINKEKTNEGYSGS....-KYPLQSVFVSELP.AFVDIPR.GPNNVVTTTKDDDKQS......---GSY..H..TTFSLQLPNSSDEA.GTQMLSGSKKQQCTTGRSS.TTASGSLPETAPRKAIAAATDGSSRKRDPSKGTSKSKEIQA..QG.VLKPKMSVSNSMCNIKA....SSRILSKENVRRQN-.QLLKS----------------------.---.------------..-----------------kvq...................
F6UM76_CANLF/97-519                  ......................ppge-----------------------.-------..--------------------..----.-----------------------.--.PGPPRGFASITITARRVGPPAGSLAW...EAQG-----------...ALLAEPCAPAA---PRGHQGPCTCAELSRTCSVMRLK.VPETQPRL.CEAH.GYWVTNLEDHQEDTFPPGAPQA.GKG......PLVFSSCVHLRVSQQCPSSGGYLDGALPGPAQQPQRAGPKMHRSVLSLHLSCSSHRLTPD..GADGPA.NGAPLC...SALKQELTQRSPDLPGRHWNPGLQESF-LKENPALEQVHLG...pSACPCSGSRRVEDR.AFSDV--.GVNQVTVSKGREDYPD......CGPGRG..A..SQLAIHIPGWSYAT.VETKVFSGSSKK-QLREAR.VTLSAPPVEHKLVKDFLLDEYSSPSNCCQSSNFSEPSESQQ..QS.LLKSRIPLSGFLCPLQD....LCTPPQEDSGVQIER.EFPKGDYKCCDLVVKIKECRKSEEPEP.APP.EPAPPKPAT---..PEPPETPDLSEDHSEG-q.....................
A0A286Y546_CAVPO/2-152               .......................pdh-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-ETKVFSGSNKK-QQGEAP.VTLSAPPVKQKPIKWFLPDEDSSQNDGCPSSDLSKLTERRP..PS.LLRPRVALPGFLCPFKD....SCTFTQEDSGAQIE-.TELPKDYTCCDLVVKIKECKKSENSTTpPEV.SPASPSPTL---..LKGPEAPGLSEDSPHPQ......................
H0XDG2_OTOGA/45-548                  ..........................LLISQLIDENKSRDNGAMLPLPC.MATRPPA..RCLKPSLANRGGVNIRRVFA..LLPG.RLGIPTPSDERGPERELPPKEEK.LC.SGPQKGFASITITARRVGPPASTLVW...GTVGSPLCPKCRAQD...TLLQDPPAVAESAHPRRH------TEFSRNSSMVWLK.VPEAHAQL.CEGH.EYWVTHVDDKETSFSPDGPPS-.EKG......PLMFSSCVHLRVSRQRPNSAYYLDKPLSVPVEQPQVAGPQVRKSVLSLTLNCSSHRLTAG..GVDGLA.NGEPMG...RALKQELSEGSQGLLGRRWSPGVQESHLLTGGPSLGQVHLG...tATCPWSGSPLLENT.AFADV--.GTNQVTVSKQAENQVK.....hCHPSGR..A..NQLSIHIPGWSYAA.VNTNVFPGSSEK--QGRGR.VALSAPPVERKPTKPFLPDGDSSPGDDCQSSDLSEPTERRH..QS.SLEPRIPFPGFLCPLQD....LCTSVQEDPGAQIER.ELPTGDHTCCDLVVKIKECQKHEDPTT.---.--PSPSPAP---..PKQPDGPDLSEDYSKPQqts...................
A0A091E6Q9_FUKDA/103-609             ..........................IVISQLIDENKSKENVAALPLPCgMMAQPGA..CRTNTTSPHSSGVNIHRVFA..SLPD.KLGIPTSSDERRPAIDLPPSGNR.VC.G-PHQGFASITITARRVGPLAGALVR...STVGDSLCPKYGAEG...ALRWGPSARAGGPHPRPHCGPLACTEFPKKGSAVRVK.VPEAYARR.YTDH.EYWVTCVDSKNNSFSPDTQPS-.GKD......PLVFSSCVHLWVSRQCPNSIYYLDRSLAVPVEQPQIVSPQMHRSVLSLNLSCSSHGLTAD..GVDGLA.NGEPIS...RALKQEVLEGNQNHLGSLWNPALPASH-SEENPL---RLGT....GTCPWSDCPPRRNT.EIADV--.GNHQVTVRKGKGHPAT......RPASGH..G..NQLSIHIPGWSHKA.EETKVFSGSSKK-QQGEAR.VTQSAPPVAQKPIKRFLPDGDSSPKADCQSSDLAKPTERRL..PS.FLRPRVTLPGFLCPSQD....SCTSPREDSGAQIER.ELPKGDYTCCDLVVKIKECKKSEDSTM.PEV.SPAPPSPTS---..LKGPVTPGLSEDSPDPQ......................
A0A096NSR5_PAPAN/149-660             ..........................LVISQMIDENKPRENRTSLPLPC.TIGQARA..HHTKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDEPGPETELPPKEES.PC.GGPRRGFASITITARRVGPPASALLW...GTVGDSLCPKCRAED...TLLQAPPALANGTHPDRHQRSFACTEFSGNSSVVRLK.IPEAHTGL.CERR.KYWVTHVDDKGTSFSPDTPLS-.GKT......PLVFSSCVHFRVSQQCPNSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLSCSSHRLTAD..GVDGLV.NREPIS...GALKQELVEGDQDLVGQRWNPGLQESH-LKETPSLGRVQLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHAT.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTLSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTEGRH..QS.FLKPRILFPGFLCPLQD....VCASPQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.ATAAPSPAP---..PETAGSPGLSEDCSEPQ......................
F6YRK0_MONDO/52-565                  ..........................LLISQLIDERRLRRSASALPGQC.MMLQPEA..HPMNLSLARHSPADIDQAFL..LLPG.RMGIKTSCREAGAGPELPLQEGK.PD.PNPRKGFSSITITARRVVPPASTLMW...GTAVEPLCSQCGAKEktdSSGDR--------EPPPRHRLFSGHGSLANGLATSFK.TSEPHGQV.CEGH.PCWILNPENKENELIPPAIPSHgEKV......PLLFSSCVHLRVSQPCSNTVHYLDKSLSIPLDQAPLAGSKVHKSVLSLNLSCSSHGLTAD..GADRMA.NAEEEAmggEPLSQKHAEQHEKRSPTSWAPDFKESCLKESPPWSGMSLGN....YPCPWSSAPHLGST.E---DPG.EGADPLAMGKTKGDSMv....aYHARSH..P..DKLSIHIPGWSYA-.AETKAFSGNIKM-QQGEQC.MALSATLVGPSPRNDFVPDVSGSPKDDYQSSKPLESQEIQP..QQ.FLKSKAPLPDYLCPLKA....LCPSSQEDIGVPVES.PFPPGDYRCCDLVVKLKKYERPVKEEE.MIP.ESPPAPAEPMSS..PEKPDTAQEQDVCPEAE......................
F6WET6_RAT/9-185                     nqgrgesckihhqkdfsqdailplvi-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..-----------MPA.SETKVLSRSKKQ--QHQAQ.RTLSAFPVGQKPIKHFPPDGDSLPSNDGQPNILSESHKRQH..SY.FMTPKVPLSGFFCPLQT....VCASLQEDDAIQIE-.TQFPKDYTCCDLVVKLKDCEKHEDPTVtPEP.SPATPSPAT---..RAGPQSSGPLEDSFEP-l.....................
A0A2K5M715_CERAT/52-563              ..........................LVISQMIDENKPRENRTSLPLPC.TIGQARA..HHTKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPETELPPKEES.PC.GGPRRGFASITITARRVGPPASALLW...GTVGDSLCPKCRAED...TLLQAPPALANGTHPGRHQRSFACTEFSGNSSVVRLK.VPEAHTGL.CERR.KYWVTHVDDKGTSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPNSIYYIDKSLSVPIEPPQIASPKMHRSVLSLNLSCSSHRLTAD..GVDGLV.NREPIS...GALKQELVEGDQDLVGQRWNSGLQESH-LKETPSLGRVHLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHAT.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTLSAPPVEQQPTRHFLPIGDSSPSNDCLSRDLSEPTEGRH..QS.FLKPRIPFPGFLCPLQD....VCASQQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPIT.PEP.ATAAPSPAP---..PETAGSPGLSEDCSEPQ......................
F7B477_HORSE/45-555                  ..........................IVISQLIDENKSKENGAALPAPC.AVAQPPA..CPMKQSLANRSGVTISRVFT..FLPG.RLGIQTPAEERGSESERPPKEEK.LC.GGPQKGFASITITARRVGPPASTLVW...EAVEDPMCNKCRAQD...ALLRDPSALASGVAPLQHHGPFACTEFSRNSSVMRLK.LPEAHTQL.CEGH.EYWITNGDNRENSFSPDTPQS-.GKS......PLVFSSCVHLRVSQQCPNSIYYLDRPLSVPIEQPHLTSPKMHRSVLSLNLNCSSHRLTPD..GVDGTA.NREPIS...SALKQELTEGNKNLLGPRWNPGLQESF-LKENVSLEQVHLG...tGTCPWSGSPPLENT.EFTDV--.GTNLVTVRKGREDHAT.....hCHTSGH..T..NQLSIHIPGWSYRT.VETKVFSGSNKK--QQETR.VTLSAPPVEQKLVKDFLPPGCSPPSNSCQSSDLSEPAESQQ..QS.FPKPGICVPGFLCPLQD....LCTSPQEDHGVQVER.EFPKGDYTCCDLVVKLKECKRREGPST.PEP.APAPPEPAA---..PQEPETPDLPEDCSK--gw....................
G5BE48_HETGA/461-588                 ......................ekee-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-------VEQKSIKLFLPDGDSLANDDCQSSDLSKPTERRL..PS.FLRPRAALPGFLCPLRD....SCTALPEDSGAQIEG.ELPKGDYTCCDLVVKIKECKKNEDSTT.PEI.SPVPASPTP---..LKGPATPGLSEDTPDPQ......................
A0A091XBF9_OPIHO/15-514              ..........................LVISQMIEDNKSKEIWPSSPMQS.MIPQPSA..YHTTKSLANHGSINTKGAFT..VLTS.RLEIQASLDDTTSPSDSPITGGK.QC.QSQQKGFASITITARRVAAGSSEPARg.pGAVQEPNAMCPTLSKa.pAALHHWPPLDRA-----------------KHRSFPLR.ISKSYSQL.GEEL.RKRLFDPGNKEYGVGLQSSDGR.EKV......PPSFISCVHLQVSPQYPNTIYYLDKSLNVCIDQPQTKCQKIHRSALSFNINCSSSRLTAD..GVDGIA.NGEPTE...EILKTKLLGENKTPLSSNWSADLAENNVINRETTNEGFLRS....-KYPLQSVFVSELP.AFVDIPR.GPSNVVTTKKDDDKHS......---DSY..R..ATFSFQLPNSSDEA.GTQMLLGSKKQQCTTGRSS.AAASGSLPDPASRKATTAATDGSLKKRDPPKSTSKSKETQA..QG.MLKPKVSASSSMCNIKA....SSRILSEENVHGQN-.QLLKSDYEFCGSSDKIRECKEEDEEER.ASR.VTLSTAHLPDVA..REKNDALTQPETGSQPE......................
G3UY66_MOUSE/5-42                    ..........................VVISRLIDEKKSMENGAILPQ--.AIAQPQL..CPTKPALARR----------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------......................
A0A091TSQ9_PHALP/15-513              ..........................IVISHVIDENKSKEYWSASPMQS.MIPQPSA..YHMKQSLPNRGSVNVDRAFM..VLPS.RLEIQVFLDDTTTPLDAPIAAEK.QC.QKQQKGFASITITARRVAVGSSDPTRg.aGAVEEPNAMSPTSSKv.pAALRCWPPPGYA-----------------NQTASPLR.ISESCSQL.GEEP.RRTIFDPGNKENGVGLQSSDGR.EKV......SPSFISCVHLQVSQQCPNTIYYLDKSLNVCIDQPRIKCQKIHRSALSFNINCSSSRLTAD..GVDGIA.NGEPIE...EIFKTKLL-GEKTPLGSNWSADLTENNVINKETTHEGYLGS....-KYPLQSVFASELP.AFAGTPR.GPNNMVTTKKDDDKWS......---GSD..H..TAFCLQRPNSSDEA.GTQMLSGSKQEQCTPGRSS.TVASGSLPETASRKSTAAATDGSLKKRDPSKGTSKPKEIQA..QG.IPKPKMSVSNSMCNIKA....SSRILSEENVHRQN-.QLLKSDYEFCGPSDKIKERKEEDGRER.ASR.VTLPTARSPDAT..REKNDVPTWPETGSQPE......................
G3UZA2_MOUSE/1-20                    ..........................-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...------------------------------ESPALVPVHLG...sGTCPRTG-------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------s.....................
A0A2I0MEF1_COLLI/92-513              ..........................MVISQMI-ENKSEENCHALPVQP.MIPQP--..------------ININRAFT..ALPS.RLEIQTTLDNTTSPLDSPIAEEK.QS.QNLRKGFASITITAKRVAAGSSDPA-...-----P--VSPTSSEd.pAALRHCRPPGYA-----------------NQNVSPSK.IPESCSQF.GEEQpRKRIFDPGNKENGVGLQSSDGR.EKV......PPSFISCVHLQVSQQCPNTIYYLDKSLNVCIDQPQIKCQKIHRSTLSFNINCSSSRLTAD..GVDGIA.NGEPIE...TMLKTKLLGENKTPLRSNWRADFAENNVINRETTNEGYLGS....-KYPLQTIFVSKLP.AFVDIPG.GPNNVVTAKKDDDKQS......---GSY..H..TTFSLQLPSSSDEA.GTQMLSGSKKQQ--YSSNT.ATASASPPGTASRRTTAAATDGASKKRDPSKDTSQAKEIQA..QG.LLKPKMSISSSTCNRKS....SSRILLEENVHRQN-.QLLK-----------------------.---.------------..-----------------nvt...................
G3T7A1_LOXAF/5-514                   ..........................IFISQLIDENKSREKRAVVPVLR.AVAQPHT..HHVKSSLADRGSEEISRALA..FLPG.RLGIQTPSDVRGYRTELPPQEES.PR.RGRHKGFASISVTARRVGPPAGTLLW...ESSGDPLCTQRRAGD...SVHTDPYSLASDVEPGGPHRPFTCAELSRNDSGVCLK.VPE---WL.CEGR.EYWVTNRGGREDNFSPGSPPP-.GRS......PLLFSSCVHLRVSQPCPNSICYLDKSLSVPIQQPPVASPKVHRSVLSLNLNCSSHRSTPD..GVGGLA.NGEPMS...SALRPTSMEGNQNLLARSWNPGLRESY-LEENPALARADLG...nSTCPWSGLPTLGNT.GLAGA--.GMNHGTIKKEKEDHRT.....lYHASGH..T..SQLTIHIPGWSYAA.VFNVVYGEKQKA-RRAQKW.LYHACGPLGKRRIRHFLPHGDSPPKGDCQSSNLSAPTESQH..QS.FPGPRALLAGFLCPLED....VCTPPQDDRGAQIKReELPKGDYTCCDLVVKIKECKKSEDVTV.LQP.SPAPPEKAS---..PKDPDTPGLSEDCSQPQ......................
A0A093ESW0_GAVST/15-514              ..........................IVISQMIDENKSKENWLALPMQS.IIPPSGA..YHTKQSVASHGSDNMNRAFT..VLPS.RLEIQASLDGTTSPSDSPITEGK.QC.QKEQKGFASITITARRVAAGSSDPACg.aGAVQEPNAVSPTSSKv.pAALRHWPPPGHA-----------------NQNVSSLK.ISESCSQL.GEEP.RKRIFDPGNEENSMGLQSGDGR.EKV......PPYFISCVHLQVSQHCPNTIYYIDKSLSVCVDQPRIKCQKIQRSVLSFNVNCSSSRLTAD..GVDGIA.NGEPIE...EIFKTKPLGENKTPLRPNWSADLTENNVINRETTNEGYLGS....-KYPLQSVFVSELP.AFVDIPK.GPNNVVTTKKDDDKQS......---GSY..H..STFSLQLPNSSDEA.GTQMLSGSKKKQCTTGRSS.ATASGSLPDTASRKAIAAATDGSSKKRDPSKGTSKSKEIQA..QG.VLKPKMSLSNSMCDRKP....SSRVLSEENVHRQN-.QLLKSDYEFCGSSDKIKERKEEDEWER.ARR.VTLSTAHSPDVP..HEKNNALTRAETVSQPE......................
A0A091KGR7_9GRUI/15-511              ..........................IAISQMIDENKSKENWSASPMQS.VIPQPSA..YHTKQSSANYGSVSISRAFT..VVPS.RLEIQASLDDTMSPLDSPIAEEK.QC.RNQQKGFASITITARRIAVGSSHPVRg.aVAVQEPSAVSPASSEv.pAALCHWPPLGHT-----------------NGIASPLK.ILESCSKL.GEEP.QKQIFDPGNKENGVGLQSSDGR.EKV......PPSFISCVHLQVSQQCPNTIYYIDKSLNMCIDQPRIKCQKIHRSTLSFNINCSSSRLTAD..GVDGIA.NGEPIE...KIFKTKLLGEKKTPLRLNWSADLTENNVINRETRDEGYLDS....-KYPLQSVFVSELP.AFVDAPR.GPNNVVPTRTDDDKQA......---GSY..H..ATFSLQLPNSS---.GTQVPPGSKKQQCTTSRRS.ATASGSLPDTASRKATAAATDDPSKKRDTSKGTPKSKETQA..QG.FQKPKISVCSSMCNRKA....SSRIPVEENAHRQN-.QLLKSDYEFCGSSDKIKERKEEDEREQ.ASG.VTLSAACSPDVT..HEKNDVLTQPETGSQPE......................
Q9D4E0_MOUSE/1-151                   ........................mp-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..-------------A.SETKVLSGSKKQ--QQEAQ.RTLPAFPVGQKTIKHFPPEGDSSPSSDGQPSILSESNERQH..PY.FMIPRVPLPGFYCPLQT....GCASLQEDGAVQIE-.THFPKDYTCCDLVVKLKECEKNEDPTVtPEP.SPATPSPST---..PEGAQSSDPSEDSYEP-l.....................
A0A093D558_TAUER/15-480              ..........................MVISQMIDENKSKENWSTLPMQS.MITQPSA..YHTKQFLDNHGSVNINRAFT..VLPS.RLEIQASLDDTTSPSDYPITEGK.RC.QNQQKGFASITVTARRVAAGSSDPARg.aGAVQEPNAVSPTSSKv.pAALRRWPPPGHA-----------------NQNVSLLK.ISESCSQL.CKEP.RKRIFDSGNKESGVGLQSSDGR.EKV......PPSFISCVHLRVSQQCPNAIYYLDKSLNVCIDQPRIECQKIHRAALSFKINCSSSRLTAD..GVDGIA.NGEPIG...EIVKTKLRGENKTPLRSNWRADLTENSVIKRETTNGGYLGF....-KHPLQSVFVSELP.VFVDIPR.GPNKVVTTKKDDDKQS......---GSH..H..TTFSLQLPNSSDGA.GTQM-SGSKKQQCTMGKSSsSTDFGSLLDTASGKSITAATDGSSKKRDPSKGTSKSKEIQV..QG.ILKPKMSVSNSMCNIKA....SSRILSEENIHRQN-.QLLKSDYEFCGSSDKLKEGEEEEE---.---.------------..-----------------e.....................
A0A0A0MSX2_HUMAN/52-563              ..........................IVISQMIDENKSRENRASLPLPC.AIAQSRA..HHAKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPEAELPPKEER.PC.GGPRRGFASITITARRVGPPARALVW...GTAGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLK.VPEAHTGL.CERR.KYWVTHADDKETSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGLV.NREPIS...EALKQELLEGDQDLVGQRWNPGLQESH-LKETPSLRRVHLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHTT.....hCHASDH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRH..QS.FLKPRILFPGFLCPLQD....VCASLQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.SPAAPSPAP---..RDGAGSPGLSEDCSESQ......................
A0A1S3N401_SALSA/297-483             ................masvpnvlgg-----------------------.-------..--------------------..----.-----------------------.--.-RPKTGFSSITITSCRISQSGANRSH...YPHQPILPIRPSTSL...--NPVMSHVLSSA-IPKHSQVVTRNKATIVKVTVYRQ.SYSACAKVqMRGP.GMRIAWPEHRHSYTGEDSLKDN.GSSfrpfslQPSFRSCVQLEVRWRSANTVLYLDKSLSISIGQPEVTKPVVHRSTLSLYVGGSSD-----..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------igts..................
A0A091HN62_BUCRH/15-513              ..........................ILISQMTDENTSKENWPALPMQS.MTPQPSA..YHEKQSLTDHGSLNIHRAFT..VLPS.RLEIQVSLDDTPVLPGSPTAEKK.QH.QNQQKGFASITVTARRVAAGSGDPALg.pGAVEEPITTSPTLSKv.pAALLHWSPPDHA-----------------IQHASPLK.ISESCSQL.GEEP.RKWLLDPGNKRNGVGLPSSDGR.EKV......PPSFTSCVHLQVSQQCPNTIYYLDKSLSVSIDQPQIKHQKIHRSTLSFNINCSSSRLTAD..GVDGIA.NGEPTG...EIFQTKLLEGNKTPLRSNLSADSTENNVFNKDRTNEGYLGS....-KYPLQRVFVSELP.AFVDIPR.GPNNVVTMKKDDDQRS......---GSY..H..TTFSLQLPNSSDEA.GTQVL-GSKKQQCTMGRRS.TMAARSLPDIASRVAMAAVTDISLKKRDPSKGTSKSKEIKA..KS.IPKPKMSVSSSMCNIKA....SSRILLEENVHRQN-.QLLKSDYEFCGSSDKIREREEEDERAP.ASR.VTLSAPRSPDAT..REKNDVLARPETGSQPE......................
A0A2I2YZZ5_GORGO/1-149               .........................v-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-HTKVFSGSSKR-QQGEVC.MTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRH..QS.FLKPRILFPGFLCPLQD....VCASPQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.SLAAPSPAP---..RDGAGSPGLSEDCSESQ......................
A0A091UQ23_NIPNI/15-518              ..........................IVILRTIDENKSKENWPALPIQS.MIPQPSA..CRMKQSLASHGSVNINRAFT..VLPS.RLEIQASLGDTTSPSDSPITERK.QF.QNQQKGFASITVTARRVSAGSSDPARg.aGTVQEPNAVSPTLSKv.pAALRRWPPPDHA-----------------NQNVSPLK.ISGSCSQL.GKER.RKRIFDPGNKENGMGLQSSDGR.EKV......PPSFISCVHLQVSQQCPNTIYYLDKSLNVCLDQPRIKCQKIHRSALSFNINCSSARLTAD..GVDGIA.NGEPIE...EIFKTKLLGENKTPLRSNWSADLTENNVINKETTHEGYLGS....-KYPFQSFFVSEFP.PFVDIPR.GPNNVATRKTDDDKQS......---GSY..D..TMFSLQLPNSSDEA.GTQMLSGSTKQQCTTGRSS.TMASGYLPDTAFRKAVASASDGSSKKRDPSKDTSKSKEIQA..RD.LLKPKMSLSDSMCNRKAssriSSRILSEENVHRQN-.QLLKSDYEFHGSSDKIKERKEEDERER.ASR.VTLSSPRSTDVT..REKNDALTQPENGSQPE......................
A0A093QEG8_9PASS/15-496              ..........................VIISQMIDGNKSKGKQPALPMQS.MIPQPSA..CHTKQSSSNQGSVKVTRAFL..VLPS.RLEVQASLEDTKSPLDSHITEEK.RC.PKQQNGFASITVTARRVAVGSGDTACg.pGAVQDPSIASPTSSRv.pALLPEWPPPGHT-----------------PQRASPGK.VSESCPRL.GEEP.QKQLFDPGIKETGLGLESSDGM.EKV......PPSFLSCVHLQVSQRCPSTIYYFDKSLDVCIAQPRIKCQKTYRSTLSFNIKCSLSRLTAD..GVDGIA.NGEPME...ETAPTKLPGANKTPLRSDLSADFTENKVINKVKTKEGCLGS....-KYPLQSVLISELP.AFVDIPR.GHNNVVATKKEDDEHS......---GSS..H..SLFSLQLPNSS---.GTQMLLGSRRRS-------.----CILPDAASREAITAAG--SSKRRDPSKDTSKSKEIQA..QG.VLKPKLSVSNCMCSIKT....SSRILSEENVHRQN-.QLLKSDSEFCGSADRIKELK--DEWER.ARR.VTLSTSHWPGVT..WEKNNVLTWPETSSQPE......................
A0A093C890_9AVES/15-518              ..........................IVIPQMI-ENKSKENGPTLPMQS.LTPQPSA..YQTKQPLSNHGSVNINRKLT..ELPS.RLEIQTSLDDTTPPSDSPTTEGN.QC.PNQQKGFSSITITARRVAGGSGDPARg.pRTGQEPNTVSPTLTKv.pAVLQRWPPLDHA-----------------NQSATPLK.ISESCLQL.SKEP.QKQLFNPGNKEKSVGLQSSDGR.EKV......PPSFISHVHLQVSQQGPSTIYYVDKSLNVCVDQPRIECQQIHRSALSFKINCSSSRLTAD..GADGIA.NGEPIE...ELLKTKLLGANKTPLRSNWSADLTENNVINKETTTKAYLGS....-KHLLQSVFASELP.AIVDIPR.GPNNVGTTKKDDAKQP......---GSY..H..TTFSLWLPNSS-KA.GTQMLPGNKKKQHTVDKSS.ATTSGALPDTASRNAIAAATDGSLKKIDPSKGTSKPKDIQA..QGiILKAKKSLSDSMCYVKA....SSRILVEEYVHRQN-.QLLKSDYEFCGSSDKIKEHVTREKNDTlAQPeSGTQPEEIPPAP..RT---------------lrealeihkpqfisrsqe....
A0A1U8CDW2_MESAU/361-414             .........................r-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.----ADYTCCDLVVKLKEWEKRKDLIA.-TP.VPSSAMPSP-AT..AEGPQSPDPSEGSSEP-p.....................
A0A091RXP8_NESNO/14-513              ..........................IVTSQMIDETKSKENWPVLSMLS.MIPQPSA..YHVKQALVNHGAVSINRAFM..VFPS.TIEIQASLDDTTSSSDSPTAEEN.QC.QDQHRGFASITITARRVAVGFSDPAHg.sGAVQEPNAMSPTSSKvpeRSLRCWPPQGHT------------------NHVSPLK.IPEYCSQF.SEEP.QKQLFDPGNKENCVGLQSSDGR.EKV......PPSFISCVHLQVSQRCPNTIYYLDKSLNVCIDQPQIKCQKIHRSALSFNINCSLSRLTAD..GVDGIA.NGKPIE...EIFQTKILGENKIPLKSNSSADLTENNVINREKTNGGYLGS....-KYPLQSVFVSELP.AFVDTPR.GPNHVVTAKKDDGKQS......---GSY..H..ATFSLQLPNSSDKA.GTQMLSGSKKNQRTTAWSS.ATDPGSLPDTASRKAVAVASDGALRKRDSSKGTSRSKEIQA..QS.IPKPKISVSRSLCNITA....SSRTFLEENVHREN-.QLLKSDYEFCGSSDKLKEREEEDEREG.ASR.GTLSMAHSPDVA..HGKSNALTRPETSSQAE......................
U3ITX9_ANAPL/15-320                  ..........................IVISQMIDENKSKENWSALLMQS.AIPQPSA..YHLKQSLANHDLVNINSAFM..VLPS.RLEIQASLDDTTSSLDSPTTNEK.QR.QNQWKGFASITITARRVTEGSSDPAWr.sRAVPEPHAASPTLSKv.pVDLHHWPPPGQA-----------------NQNVTPSR.ASERCSKS.GEEL.RERFSNHRNKEKGVGLQSSDGR.EKV......LPLFISSVHIQVSQQCPNTIYYIDKSLNVCLVQPRIKCQKMHRSTLSFSINCSSSRLTAD..GVDGIA.NGEPIE...EMLQTKLLRENKAPLRTNWSAGLTENNVINKQTTNEGHEQL....-FCSLQN-------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------eylaqs................
A0A226PST8_COLVI/1-355               ..........................-----MIDEKKSKENCPALLTQA.VTPQPSA..CHTKQSLANHGSVNINSKFT..VLPS.RLEIQTSLDDTIFPPDCPITDGK.RC.QKQQKGFASITITARRVTTGSTDPTWg.pGAVPEPHAVSPTSSEi.pPVLHQRLSPDQA-----------------NSKVLPSR.VSDCCSKL.GKEL.RKRFFSHRNGENGVGLQSSDGR.EKV......PPSFVSSVHLQVSQQCLNTVYYIDKSLNVCLDRPRIKCQKTYRSALSLNINCSSSRLTAD..GVDGIG.NGESIE...KILQIKLLRENKTPRRTNRSARLTERNVVNKQATIEGYLVT....-KCPLTRVCASELP.ASGHVPK.GPISAASTKQDDDRLS......---GSY..R..TAFSLHLSNSSGEA.ACKAV--------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------lalglds...............
A0A1U7SWX8_TARSY/52-563              ..........................IVVSQMFDENKSKQNGPSLPLSC.VIPQPRA..DHREPSLAHRSGVNIHRAFA..LLPG.RSGIPAPSDEQGPETDLPPKEEN.PR.GDPHKGFSSITITARRVGPPARALVW...GTVGDPLCPKCRTED...TLLHDSPPLVNDTHPHPLHRSFSCTEFSRNGSMVRLK.FPETRARL.SEGR.EYWVTHVDDKETNFSPDTSLS-.GKG......PLVFSSCVHLRVSRQCPNSIYCVDESVSVPTAPPQIANPKMHRSVLSLNLNCSSHRITAD..GVDGIA.NGEPIS...RALKQEFTKGNQNLLGPRWNPDLQATH-LKENPSLGRVHLG...tGTCPWSDSPLLENS.EFADV--.ETNQVTVKKWKEYRST.....pCHASGH..A..NQLSIHIPGWSYTA.VDTKVFPGSIKK-QEGEAR.MTLSVPPVEQKLIKHFLPDGASSPSDACQSSDLSEPTERRH..QS.FSKPRVPFPGFFCPLKD....ACTSLQEDNGTQIEK.EYPKGDYTCCDLVVKIKECQKSEDCAT.SEP.SPPSPSPVP---..PKGPESPGLSEDCSEPQ......................
A0A0D9QWR7_CHLSB/111-622             ..........................LVISQMIDENKPRENRASLPLPC.TIGQARA..YHTKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPETELPPKEES.PC.GGPRGGFASITITARRVGPPASALLW...GTVGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVPLK.VPEAHTGL.CERR.KYWVSHVDDKETSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPNSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLSCSSHRLTAD..GVDGLV.NREPIS...GALKQELVEGDQDLVGQRWNPGLQESH-LKETPSLGQGHLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHAT.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTLSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTEGRH..QS.FLKPRILFPGFLCPLQD....VCASPQEDNGVQIES.KFPKRDYTCCDLVVKIKECKKSEDPTM.PEP.STAAPSPAP---..PETAESPGLSEDCSEPQ......................
G5BE48_HETGA/45-420                  ..........................IVISQLIDENKSKEDVAVLPLPCgMMAQPPA..CRTKPALALRSGVNIHRAFA..LLPD.RPGIPTASDERRPEIDLPPAGDS.VC.GGPRQGFSSITITARRVGPPAGALVW...GTVGDALCPKCGAES...ALGRGPSAQAGGLHRRPHHEPLACTEFPKKGSVVRLK.APEAQARR.YTGP.EYWVTQVDSKENSFPPDAPPS-.GKG......PLVFSSCVHLRVSRQCPNSIYYLDKSLSVPVGQPKVVSPQMYRSVLSLNLRCSSHGLTAD..GVDGLA.NGEPIS...RALKQELLEGNHNLLGSLWNPALPESH-SKENPSLGPVLLG...tGTCPWSDCPPLENI.EIADV--.GTNQFTVRNGKDHRAT......RPATSH..G..NQLSIHIPGWSYKG.AD-----------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------lhvgsspcrsh...........
V8P2M7_OPHHA/28-529                  ..........................ILISQTIDENKSRENKTAFPMQS.VITQADV..YHMNRSVANHNSVNVNTAFI..FLPR.KLGFQTTSEDN---VNVNSKEEK.PW.HNQKKGFASITITAKRVVPPSNNKIQ...ANTFDRSCLECQENK...-QLITTVPASDATGLRKLSKSLRSQANGQNRSVSERK.ISESCLQS.CKGQ.SDWISSP--PKRVIPSDNTHK-.KQT......PLSFTSSVNLTISQQCPKSIYYVDKSLLVPIDQLQTNTQKMHRSVVSFQINCSSQNTTPD..GVDSLA.NGKLIT...KVLK--FPEDHKTSFKAIWNADLQDIYLDKKQRLEIESLGT....-KDFWKNAPRSETL.STLTSPQ.EVDNLRQIKNNDIPSS......----DN..P..MTLSGYIPHRTYYE.DAHGFSGSNRKQSRRDKYH.ELASASFLEQSSKKELLIDGRISWKDKHLPKSTSESKDRKA..QA.FQNQK--FSNHACHIKI....SSKSLLDENDCNGKV.SCSKGDYKLYESASQSKEHKINVKKEM.VNR.LSTSAAHEPDVP..REKYEAFQHSEVCFEPE......................
L5MEQ4_MYODS/136-315                 ......................sgad-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.---------------PGRPRS-.GQG......PLLFSSCVHLRVSRRCPNATCSPDRSPSVPVEPAQPAGPQTHRAVLSLNLNCSSHRLTPD..GADGPA.TGGPMS...NSLKPQLAEAP------------------ALHPSLGQVHLG...aGTCPWSGPPPTEST.ELADA--.GTRQITARKGKGDHGTpr.htgSHTSAH..T..NQLSIHIPGWSYRA.DN-----------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------lhwtetpp..............
S9Y2G4_CAMFR/573-630                 .........................l-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....-----------GLQ.EFADA--.ETNQVTGRKGQEDQAA.....rCHISGH..A..NQLSIHIPGWSYTA.AA-----------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------ylevperht.............
A0A151P496_ALLMI/74-200              .........................n-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......----------------------------------------------------SSPRLTPD..GVDGIA.NGGPRA...ETLKRKLSEENKTLLRTFWTADLKENTADKKKAANKECLGT....-AYPWKGTPPSELL.SFVDIPK.GTNNVKATKKDDDDDD......KQAGGN..H..IKLSIQVPKLCCET.G------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------swtnqcq...............
F7ID85_CALJA/53-564                  ..........................MVMSQMIDESKSRENRASLPLQC.AMAQSRG..RHTKPSLANRSGVSIHRAFP..FLPG.TLGIPTPSDELGPGTELPPKEES.PC.EGPHRGFASITITARRVGTPASALVW...GTVGDSLCPKCRAED...TLFRAPPALANGPHPGRHRRAFACTEFSRNSSEVRLK.VPEAPTGL.CERR.EAWVTHADDKETNFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPTSIYYVDKSLSIPFEQPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGIV.NGEPIS...TAPKQELEEGDQDLLGQRWNPGLQESH-LKEAPSLGRVHLG...tGTCSWSDSFPLENA.EFADM--.GTNQVTVRKGIKDHEA.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSDKR-QPGEAC.LTLSAPPVEQKPTKHFLPFGDRSPSDDCLSRDLSEPTERRR..QS.FLKPRIPFPGFLCPLQD....VCASPQEDNGIQIES.KFPQGDYTCCDLVVKIKEWKKSEDPAT.PEP.SPAAPSPAH---..PEGAGSPGLSEDCSEPQ......................
A0A093LBP2_FULGA/15-516              ..........................IVISQMIDENKSKENWPALPMQS.IIPQPSA..YHTKQSLANHGSVNIKRVNIksQLPS.RLEIQVSLDDTTSPSNSPITEGK.QC.QNQQKGFASITITARRVAAGSSDPARg.aGAVQEPNAVSPTSTKv.pEALCRWPLPGHA-----------------NQNVSPLK.ISESCSQL.SEEP.RKWIFDPGNKENSVGLQSSDAR.ETV......LPSFISCVHLQVSQQCPNTIYYLDKSLNVRIDQPRIKCQKIHTSALSFNINCSSSRLTAD..GVDGIA.NGEPIE...EIFKTKLLGENKTPLRSNWSADLTENNVINRETTNEGYLGS....-KYPLQSVFVSELP.AFVDIPR.GPNNVVTTKKDDDKQS......---GSY..H..TTFSLQLPNSSDEA.GTQMLSGSKTKQCTTGRSS.TTASGSLPDTASRKAIAAATDGSSKKREPSKGTSKSKEIQE..QG.ILKPKKSVSNSMCNIKA....SSRILSEENVHRQN-.QLLKSDYEFCGSSDKIKERKEEEEQEQ.ASK.VTLSAARSPDVT..REKNEALAQPETSSQPE......................
A0A1V4KI17_PATFA/1-474               ..........................-----------------------.MIPQPKV..YHAKRSLAAHGSVNINRAFT..ALPS.RLEIQATLDDTTSPLDSPIAEEK.QS.QNLRKGFASITITAKRVDAGSSDSARg.aGAVQEPNAVSPTSSKv.pVALRHHPPPGYA-----------------SQNVSPSK.IPESCSRF.SEEQpRERIFDRGNKENGVGLQSSDGR.EKI......PPSFISCVHLQVSQQCPNTIYYLDKSLNVCIDRPRIKCQKIHRSTLSFNINCSSSRLTAD..GVDGIA.NGEPIE...TMLKTKLLGENKTPLRSNWSADLAENNVTNRETTNEGYLGS....-KYPLQSIFVSELP.AFADIPG.GPNNVVTTKKDDHKQS......---GSY..H..AAFSLQLPNSSDEA.GTQMLSGSKKHQYGTGRSR.TRASGSPPSTASRNTTAAGTDGSSKKRDPSKDTSQPKEIQA..QG.LLKPKMSISSSACNRKS....SSKILSEENVHRQN-.QLLKSDYEFCGSSDKTEAAK----RER.AGR.VTLCTAGPPDVT..REKNNALAQPETGSRPE......................
G3QKX7_GORGO/44-555                  ..........................IVISQMIDENKSRENRASLPLPC.AIAQSRA..HHAKQSLANRSGVNIHRAFA..LFPG.RLGIPAPSDERGPETELPPKEER.PC.GGPRRGFASITITARRVGPPARTLVW...GTAGDSLCPKCRAED...TLFQAPPALANGDHPGRHQRSFACTEFSRNSSVVRLK.VPEAHTGL.CERR.KCWVNHADDKETSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPNSIYYVDKSLSVPIEPPQIASPKMHRSVLSLNLNCSSHRLTAD..GVDGLV.NREPIS...EALKQELLEGDQDLVGQRWNPGLQESH-LKETPSLGRVHLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKDHTT.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRH..QS.FLKPRILFPGFLCPLQD....VCASPQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.SLAAPSPAP---..RDGAGSPGLSEDCSESQ......................
A0A093J3C1_EURHL/15-512              .........................g-VISQMIDENKSNENWSALPMQS.MTPQPSA..CHTKQSSANCRSVNINRAFT..VLPS.KLEIQTSLDDTMSPLDSPITEEK.ER.QKQQKGFASITITARRVAVCSRDPARg.aGAVQEPNAVSPASSKv.pAALRRRLPPGHT-----------------NQNASPLK.TSESCSQL.CEEA.QKWLFDLGNKENGAGLQGGDGR.ERV......PPSFISCVHLQVSQQCPNTIYYLDKSLNVCLDQPRIKCQKILRSVLSFNINCSSSRLTAD..GVDGIA.NGESIE...EIFQTKLLGENKTPLRLNLSADLTENHVINRKKTSKGCFGS....-KYPWQSVFVSELP.AFVDIPR.GPTNMVTTRKDDDKQS......---GSY..H..TTVSLQLHNSSDEA.GTQMLSGSQKKQCTMGSS-.-TASDSLPDTASRKVVAAATNVSSKKREPSKSASESKEIQA..QG.ILKPKMSVSDSMCNITA....SSRILSEENVHRQN-.QLLKSDYEFCGSSDKIKEHKEEDEWER.ASR.VTLSTARSPDVP..HEKNDTLSQPETTSEPE......................
L5KMM1_PTEAL/61-564                  ..........................IVISQLIDEHKSEADGAASPAPS.TVAQPHT..CPTRPPLANPGGVSVNSAFA..FLPG.RLEIQTPAEARGPETELPPKEK-.PC.SGPPKGFASITITARRLGPPARTVVW...GAARASLYTKCQAQD...TLLEEPSALATGAGPCRHEGPFTCTELSRNSSVMRLE.FPEARARL.CEGP.ECWVTKLDGRGHRFAPGAAQP-.GKG......RLVFSSCVHLRVSQQCPNSIYYLDRSLSVPIEPPQLAGPKVHRSVLSLNLSCSSHGLTAG..GAAGTAmGGGPGS...RDLQQELPRESQSLLGRRRKPAVRGPF-LKQHPSLAQVHLG...tGTCPWGGSPLLENP.EFVDV--.GTHQATVRNGKEGHGV......HPSSLH..A..SQLSIHIPGWSYAA.VETKVFSGSSEK--QREAR.MTVSAPPMEWKLLGDSLAAGLSSP-----SNDLAEPAEPRR..QS.FLEPGIPLPGFLCPLQD....ARARPQEDSGVRIGG.ASPGGDHTCCDLVVKIKECEQSEDSAM.PEP.EPVLPEPAP---..-EDPETPAPPEACSEG-r.....................
A0A1U8D649_ALLSI/16-527              ..........................IVISQMIDENKSKENRSALPLQS.VITQPNT..YHTKQSLANHGSVNINRAFT..LHPS.RLEIQASLDDSVRRTDSHTREEK.QC.HNQENGFASITITARRVVPPSNNTVQ...EAATDSPCLKCRGGN...LLMNAATTASNNAGSAQHCRPLYNQGSCTNQNATRLK.VPETYSQS.CEGH.QGWIFNSESKENRIFPPGSNRR.KKA......PVSFTSCIHLRISQQCPNRIYYVDKSLSVCIDRPQIKSQKIHRSILSFNINCSSPRLTPD..GVDGIA.NGGPRA...ETLKRKLSEENKTLLRTFWTADLKENTADKKKAANKECLGT....-AYPWKGTPPSELL.SFVDIPK.GTNNVKATKKDDDDDK......-QAGGN..H..IKLSIQVPKLCCET.GTQTCSGSNRKQCNRDMFS.ATAPASLLERAPMKEFTADASGSLKVRAPSRATSKSKEIQA..QW.FLKPKIPVFNCVSDIKA....LPKPVLEENDLHRKN.QFSKGDYKFCGSDDKIKESKKREKQGG.---.-AISAAYSPVAA..HEKQEAFTQPEICSEPE......................
A0A093F651_TYTAL/15-504              ..........................IVISQMTDENKSKENWAALPMQP.TILQPRA..YHTKQSLAKHGSVSINRAFM..ILPS.RLEIQESLDDITSPSDSPTAAEK.QC.QNQQKGFASITVTARRVAVGSSDPARg.pGAVQEPNAVSSTLSKv.pAAFCRWPPPGHT-----------------NQHASPLK.ISESCSQL.GEEP.QKRLFDPGNKENSMGLQSSDGR.KKV......PPSFISCVHFQVSQQCPNTIYYLDKSLNLCIDQPQIKCQKIHRSTLSFNINCSLSRLTVD..GVDGIA.NGKPIE...EIFQTKLLGENKTPLRSNLSADLTENNVINKEKTNEDYLGS....-KYPSKNVFVSELP.AFVDIPR.GPNNIVTTKKGDDKQS......---GRY..H..TTFPLQLPNSSDKA.GKRXXXXPREG------RR.APASGSLPDTASRKTITAATDGSLKKRGPSR----SKEIEA..QG.ILKPKLSLSSSMCNIKA....SSRILLEENVHRQN-.QLLKSDYEFCGSSDKIKERKEEDERER.ATR.ITLSTARSPDVT..REKNDAFTRPETSSQPK......................
H0VIF8_CAVPO/55-564                  ..........................IVISQLIDENRSKENATALPLPC.AMAQPRA..CPTKPASAHLSRVNIHRAFA..LLPD.RLGIPTQSDGGGPQIDLLPSGQS.AC.GHPRQGFASITITARRVGPSAGALVW...GTMGDSLCPKCGAED...AASRSPSAWTGGPQSHPHCGPLTCTEFSRKGSEVRVK.TPEAHVRR.CAGH.EYWVTHVDSKDSNFSPDTPPS-.GKD......PLVFTSCVRLRVSRQCPNSFYYLNKSLSVPGEQPQVVSPQMHRSVLSLNLSCSSHGLTAD..GVDGIA.NGEPIS...RALKQELIQGSQHLLGSPWNPALPESH-SKENPSLGPGRLG...tGTCPWSDCPLLENT.EIADV--.ETNQVPVRKGKDHHAT......CPASGH..D..NQLSIHIPGWSYRA.ETKVFSGSNKKQ--QGEAP.VTLSAPPVKQKPIKWFLPDEDSSQNDGCPSSDLSKLTERRP..PS.LLRPRVALPGFLCPFKD....SCTFTQEDSGAQIE-.TELPKDYTCCDLVVKIKECKKSENSTTpPEV.SPASPSPTL---..LKGPEAPGLSEDSPHPQ......................
G3U8X3_LOXAF/1-118                   ..........................-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.--------------DFLPHGDSPPKGDCQSSNLSAPTESQH..QS.FPGPRALLAGFLCPLED....VCTPPQDDRGAQIKReELPKGDYTCCDLVVKIKECKKSEDVTV.LQP.SPAPPEKAS---..PKDPDTPGLSEDCSQPQ......................
U3JEB0_FICAL/1-84                    ..........................-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----MSVSSSVCNTKA....SSRILREENVHGQE-.QLLKSDCGFPGWRDRRKELEAQEERER.GRR.VALSRVALSRVT..-----------------lprgtlprgtlprpcs......
L5MEQ4_MYODS/5-145                   ..........................LVISQLLDENKPTEKGAAVPALC.ADAQPPT..WPGKCALASRSGVTINRAFA..FLPG.QLGPQPPAGVPGPKPALTPKEEK.QPgGSPQKGFASITITARRVGPPARALVW...GTGGDPLCSRCRAQD...PQLRGPPALASGADPGRP-------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------rs....................
G1U3C4_RABIT/3-141                   ........................pi-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-ETKVFSGRSEE--QQEAR.VTLSAPPVEQQL------EGDGSL-----SHDLSEPTARRH..QP.FLNSTIPLPRFLCPFHD....VCTSLQEDNGVQIER.EFPTGDYTCCDLVLKIKGCKKSDNATA.PEP.SLP-PPPSP-PP..PEGPDAPDLSESYL---raq...................
H7C3F8_HUMAN/1-55                    .........................x-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....----WSGSFPLENT.ELANV--.GANQVTVRKGEKDHTT.....hCHASDH..A..NQLSIHIPGWSYRA.G------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------......................
A0A151P4C3_ALLMI/74-341              .........................n-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......----------------------------------------------------SSPRLTPD..GVDGIA.NGGPRA...ETLKRKLSEENKTLLRTFWTADLKENTADKKKAANKECLGT....-AYPWKGTPPSELL.SFVDIPK.GTNNVKATKKDDDDDD......KQAGGN..H..IKLSIQVPKLCCET.GTQTFSGSNRKQCNRDTFS.ATAPASLLERAPMKEFTADASGSLKVRAPSKATSKSKEIQA..QW.FLKPKIPVFNCVYDIKA....LPKPVLEENDLHRKN.QFSKGDYKFCGSDDKIKECKKREKQGG.---.-ALSAAYSPVAA..HEKQAAFTQPEICSEPE......................
CJ090_MOUSE/5-510                    ..........................VVISRLIDEKKSMENGAILPQ--.AIAQPQL..CPTKPALARRDGVSMHRRFA..LSPD.RLGILTPSDDQGLETEPLSTGDN.LG.KGSHSGFSSITITARRVGPPASSLVW...DTFRDPLCPKCKAKD...ALFQEPPVLAGDAHLCQHNRPFTCTESPSNGSVEGMK.VFQAHSRL.SARQ.DYWVTHTNDNEDSFSSDNSPS-.RKV......PLVFSSCVHFRVSQQCPNAIYYLDKSLSVPLERPQIASPKMHRSVLSLSLRCSSHQLTAD..GVDSSA.NGEPIS...TALSQELSEGKQDLLGPQWGQPQGGHW--KESPALVPVHLG...sGTCPRTGSPPLENV.KFADV--.GRNQVPVRKEKEDHAT......CTSSSH..T..NQLSIHIPGWSYRA.ETKVLSGSKKQQ---QEAQ.RTLPAFPVGQKTIKHFPPEGDSSPSSDGQPSILSESNERQH..PY.FMIPRVPLPGFYCPLQT....GCASLQEDGAVQIE-.THFPKDYTCCDLVVKLKECEKNEDPTVtPEP.SPATPSPST---..PEGAQSSDPSEDSYEP-l.....................
A0A226PST8_COLVI/365-455             ...............qlcfpgsslrs-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..-----------LLK.GKLMLSGSQKKQSTISRRS.TMASPSFLDTTLRKATTAANDGSPKKSDPSKGTSTSREIQT..QG.IPKPKMSISNCDCQ---....---------------.---------------------------.---.------------..-----------------s.....................
L9L4K1_TUPCH/45-380                  ..........................IVISQLIDENKSRENRAVLQVPC.ALAQSSA..YHTKQSLANHSRVDLHRAFA..LLPG.RLGLATPSHEPGLDSELLPQESS.-C.GGPRKGFASITITARRVGRPASALVW...GTVRDALCTKCKAED...SLFGNA-ALSGGADLRQHHRPFSCTEFSRNGSVVRLK.VPESHASL.CEEH.AYWVSQVDDKRNSFSPNTPPS-.GKG......PVVFSSCVHLRVSRQCPNSVCDLDKSLSVPIEQPQIAGPKMHRSVLSLNLNCSSHRLTAD..GVDGIA.NREPIS...RALKQELTDGSQNPLHPGWSPGLQESH-LKENPSLGHVPLG...tVTCPWSSSSLLENT.EFADA--.GADQVTVMNGK-----......------..-..--------------.-------------------.-----------------------------------------..--.-----------------....---------------.---------------------------.---.------------..-----------------ve....................
G3WKR9_SARHA/9-522                   ..........................LLISQLMDERRLQKAAPALPGQG.LMLQPAV..GAPGQPLAPG-----DQAFS..LLPG.RMGIRTSSGEAGLGARLFVQEGS.RD.LPPRRGFSSITITARQVVPGAAPLRW...GSAVDPPCSKCGAKD..rRVDKAAPAKGRDPPPKLPNAP----EGSANSPAAPFR.APEPRGPS.GQGS.PCWVLNPENKENAMIPPALPSHgEKV......PLVFSSCVHLRVSQPGANTVRYLDRSLSVPLGPPPVPGSRVHRSVLSLSLGCSSHRLTAD..GADRMAnAGQEAEa.aGPLSPRPAKPGQARAPAAWEPNCKGSR-LRESPPGPRVPAG...sHPCPWGGTPTPGNP.ALLPDSGkGTDPSAVGKGRGDGTA.....lYHTVSH..P..NKLSIHNQHFSYLL.VETKAFSGSSTM-QQGEQR.VALSVSPVGPSPLNEFAPDVPGSLQGDYQSSKSLESRESQP..QS.FLKARAPLHEYLCPLKA....LPPSAREEMEVPIES.HFSQGDYQCCDLVWNRRYCRSPSKERG.MAP.ASPPAPPEP-MP..PEKPDPPPEQDTRLDPE......................
F1SDM2_PIG/5-512                     ..........................VVISHLIDENKSKENGAALPVPC.------A..YSTKPSFANRSGVTINRAFE..ILPG.GLGMQTSAGQQGPVTQQPPQEEK.PC.GGSQKGFASITITARRVGPPASTLVW...EAVGDPLWIRCRAQD...ALFRDPSMLASGTHPCPHQAPFGCTEFSRNCSVMGLK.VPEAHAGL.CEGQ.DCWMTNEGNGGDSFSPGTPRSRvEKS......PLVFSSCVHLRVSQPCPNSIYYLDRSLSVPIEPPRLAGPKTHRSVLSLNLNCSSHRRTPD..GAGGTV.NREPIS...AALTPKPTEGKQLLLGPCWNLGLQESF-LEENPSLGRVPVG...tGACPWRGSSPLENT.AFAAS--.GTNQIPGRKEKEDPTA.....hCHTDSHgpA..NQLSIHIPGWSYAA.VEAKAFSGSSEK-QQGGAR.VTVSAPPVEQKPAKDLLADGSSAPSSRCQSSGLSEPAESHQ..RG.FLQPRIPLAGFLCPFQD....LCTAPQKDPGVQIER.EFPAGDYTCCDLVVKIKECEETEDPTT.--Q.EPTAPEPAP---..PGRPETCHLSEECSEYQ......................
L9L4K1_TUPCH/376-527                 .......................ngk-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.VETKVFSGNSKK-LQGEAR.VTLSASSVEQKPIKRFLPDGDSSPRDDYQSSNFSEPTERRH..QS.FLKPRVPLSGFLCPLQD....VCTPPQEDNGVQIER.EFPKGDYTCCDLVVKIKECKKSEDPIT.PEP.SPASPSPAP---..CEEPETPDLSEDCSEPQ......................
A0A091NBA7_APAVI/15-509              ..........................VVISQMIDENKSTENWLASSMQS.MIPQPHA..HHTKQSLARRGSVDINRAFK..APPS.RLEIQSSLGDTTSPLDSSVSEEN.--.QHQKKGFAFITVTARRVAAGSGDPAHg.pGAVQEADVASPASSKv.pTALCHWPPPDHA-----------------NQHLSPLKsYSESFSPL.GQEP.PKRLFDPGNKESSVGLGKSDGR.EKV......PPSFTSRVHLQVSQQCPHTIYYLDKSLSVCLDQPQIKRQKIHRSALSFKINCSSSRLTAD..GVDGIA.NGEPIE...EIFQTKLLGKNKTPLTSNLSADVTENNIINKWKTYEGYLGS....-KYPLQSVFVSELP.ASVGIPR.GPNNVATTKKDKEKQS......---GGY..H..MTFSLQLPNSSDEA.GTQMLLGSKRKQCTTGRSS.TMASGSLPDTASGKAIAAATDGSLIRRDPSKCTPKSKEIQA..QG.TLKPNTSVSSTMCNRKA....LSRILSEENIHRQK-.QLLKSDFEFCGSSDKKKEGEEEDTWAR.ASR.IRP---FLPDAS..RENDDTRAWPEK-----ippa..................
A0A1U8D631_ALLSI/90-601              ..........................IVISQMIDENKSKENRSALPLQS.VITQPNT..YHTKQSLANHGSVNINRAFT..LHPS.RLEIQASLDDSVRRTDSHTREEK.QC.HNQENGFASITITARRVVPPSNNTVQ...EAATDSPCLKCRGGN...LLMNAATTASNNAGSAQHCRPLYNQGSCTNQNATRLK.VPETYSQS.CEGH.QGWIFNSESKENRIFPPGSNRR.KKA......PVSFTSCIHLRISQQCPNRIYYVDKSLSVCIDRPQIKSQKIHRSILSFNINCSSPRLTPD..GVDGIA.NGGPRA...ETLKRKLSEENKTLLRTFWTADLKENTADKKKAANKECLGT....-AYPWKGTPPSELL.SFVDIPK.GTNNVKATKKDDDDDK......-QAGGN..H..IKLSIQVPKLCCET.GTQTCSGSNRKQCNRDMFS.ATAPASLLERAPMKEFTADASGSLKVRAPSRATSKSKEIQA..QW.FLKPKIPVFNCVSDIKA....LPKPVLEENDLHRKN.QFSKGDYKFCGSDDKIKESKKREKQGG.---.-AISAAYSPVAA..HEKQEAFTQPEICSEPE......................
F6YJ13_MACMU/149-659                 ..........................LVISQMIDENKLRENRASLPLPC.TMGQARA..HHTKQSLANRSGVNIHRAFA..LLPG.RLGIPAPSDERGPETELPPKES-.HC.GGPRRGFASITITARRVGPPASALLW...GTVGDSLCPKCRAED...TLFQAPPALANGAHPGRHQRSFACTEFSGNSSVVRLK.VPEAHTGL.CERR.KYWVTHVDDKGTSFSPDTPLS-.GKS......PLVFSSCVHLRVSQQCPNSIYYVDKSLSVPIEPPQIAGPKMHRSVLSLNLSCSSHRLTAD..GVDGLV.NREPIS...RALKQELVEGDQDLVGQRWNPGLQESH-LKETPSLGRVHLG...tGACPWSGSFPLENT.ELANV--.GANQVTVRKGEKHHAT.....hCHASGH..A..NQLSIHIPGWSYRA.VHTKVFSGSSKR-QQGEVC.MTLSAPPVEQQPTRHFLPIGDSSPSDDCLSRDLSEPTEGRH..QS.FLKPRIPFPGFLCPLQD....VCASQQEDNGVQIES.KFPKGDYTCCDLVVKIKECKKSEDPTT.PEP.ATAAPSPAP---..PETAGSPGLSEDCSEPQ......................
E1B835_BOVIN/54-563                  ..........................IVISQLIDENKSKENGAALPVPC.------A..YPMKPSLANRSRVTINRAFE..FLPG.GLGVQTPVGEPGLKTKPPPKEEK.PC.SGSQKGFASITITARRVGPPASTLVW...EAVGDPLCVKCRARD...ALLGDPSALADGADPTQHHGPFTCTEFSRNSCVMGLK.VPEAHAQL.CEGH.GYWITNVDHREDQFSPGTSRSRaGKS......PLVFSSCVHLRVSQSCPNPIYYLDRSLSVPVEPPQLAGPKMHRSVLSLNLSCSSHRLTPD..GVDDTE.NREPGS...GALKPELQEGDQDLLGPRWNLGLQGSF-LKENPSLGQMGFRnleaGRCPWRGFPPSENA.EA-----.GTNQITMRKRKEDQATr...cpTRGHNQ..A..NQLSIHIPGWSYTA.VEPNVFSGSSEKQQEGARD.IV-SAPPVEWKLVRDPLPDGSSSPSNSSQSSDLSEPAESQQ..QR.LPKPKVPLPGFLCPFQD....LCASPQEEHGVQIER.EAPEGDYTCCDLVVKIKECKESEHPTN.PES.KPAPAEPAP---..PEDPETHVLPEDCSESQ......................
K7FEJ8_PELSI/63-568                  ..........................IVISQLIDENKSKENGSALPMQS.VITQPNA..YHTKQSLLNHSSVNINRAFT..LLPS.RLGIQASFDDNISRTDS------.--.--HKKGFASITVTARRVVPPFNNPVQ...VAVTDTLCLKCRGDD...-VLMNTTATSNKAIRAQHCTPLHNQESYINRYATRLK.GYDSHSQL.CQGH.GDGIFNTENKENRMFPPGNNHR.KKA......PVSCTSSVHFRVSQQCANTIYYFNKSLSVCIDQPQIKSQKIHRSILSFNINCSSPTLTPD..GADSIA.NGESID...EILKTKLPEEIKTPLRTNSNAYLNENNVDKKETAEKEYLST....-ACPWKSTSPSQCS.AFVDTPK.GTNNVIVAKQKEDNSD......EQCTSN..D..IKLSIHMSKWSYEA.GMQTFSGSYWKQYAKDKYN.ATAPASFVEQAPKKEFSANGGGSLKERDPSIGTSNSKGIRV..QC.FRKPKISMSDCVCDIKA....LSKPALEENDVHRKS.QFPKGDYKFCGSVGKIKDCKKSDKQET.ASR.VTTSAVYSPDVT..HEKQEAFTQTEIYSEPE......................
A0A151P496_ALLMI/227-383             ...................dgwpalh-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..-------------P.GTQTFSGSNRKQCNRDTFS.ATAPASLLERAPMKEFTADASGSLKVRAPSKATSKSKEIQA..QW.FLKPKIPVFNCVYDIKA....LPKPVLEENDLHRKN.QFSKGDYKFCGSDDKIKECKKREKQGG.---.-ALSAAYSPVAA..HEKQAAFTQPEICSEPE......................
A0A1A6GEE0_NEOLE/1-93                .......................rrl-----------------------.-------..--------------------..----.-----------------------.--.--------------------------...---------------...-------------------------------------.--------.----.----------------------.---......------------------------------------------------------------..------.------...-----------------------------------------....--------------.-------.----------------......------..-..--------------.-------------------.-----------------------------------------..SY.FRTPRVPLSGFLCPLRA....ACACLQEDGTVPIE-.KEFPKDYTCCDLVVKVKESKRHEDHVAtPEP.SPATPSPTT---..AEGPQSFDPLEHSSEP-r.....................
#=GC seq_cons                        ..........................lVISQhIDEsKScEshssLPh.s.hhsQsps..h.hK.ulupcuuVslpRsFh..hLPu.+LtI.ss.--ts...-...tttp..s.ts.p+GFASITITARRVussuss.sh...ssst-s.sspspspc...shhpt.ss.sps.................Ntsss.hK.hsEspstl.spt..phhlhpsss+csshu.tss.u..tKs......P.sF.SCVHLpVSQpCPNoIYYlDKSLsVsl-.Pplts.KhHRSsLShslsCSSppLTsD..GVDGhs.NtEPhp...phhppcL.ttsps.lt.phssslpts...pcp.s.tthhhs.....thPhpss...E.s.thssh...GssphsspKtcccpts.........uuh..t..sphSlplPs.S.ps.spphh.uupppp...tt.p.hhhsss..ttt.hcth.s.ssus.ptpt.spshucspE.pt..p..h.pP+h.hss.hCshps.....st...E-sshp.p..ph.tuDYphCs.ssKlKEtccp-c.t...t...shsst..s......ptsts.s.sE.t.p........................
//
DBGET integrated database retrieval system