#=GF ID   Cmr7A
#=GF AC   PF19021.4
#=GF DE   CRISPR system CMR subunit Cmr7 1
#=GF PI   DUF5747;
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Schaeffer D
#=GF GA   27.00 27.00;
#=GF TC   35.30 457.20;
#=GF NC   26.60 19.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 -Z 75585367 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   22227115
#=GF RT   Structure and mechanism of the CMR complex for CRISPR-mediated
#=GF RT   antiviral immunity.
#=GF RA   Zhang J, Rouillon C, Kerou M, Reeks J, Brugger K, Graham S,
#=GF RA   Reimann J, Cannone G, Liu H, Albers SV, Naismith JH, Spagnolo L,
#=GF RA   White MF;
#=GF RL   Mol Cell. 2012;45:303-313.
#=GF DR   INTERPRO; IPR043959;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   The CRISPR-Cas system is a prokaryotic defense mechanism against
#=GF CC   foreign genetic elements. The key elements of this defense
#=GF CC   system are the Cas proteins and the CRISPR RNA. In the
#=GF CC   CRISPR-Cas system, RNA is targeted by the CMR complex. In
#=GF CC   Sulfolobus solfataricus this complex is composed of seven CAS
#=GF CC   protein subunits (Cmr1-7) and carries a diverse "payload" of
#=GF CC   targeting crRNA. This entry represent the Cmr7 subunit of the
#=GF CC   CMR complex [1]. 
#=GF SQ   1
#=GS CMR7A_SACS2/1-197  AC Q97WX5.1
CMR7A_SACS2/1-197             MTSGAGWEEQVFLPITNSISSEDNNQIKIGSSVSIEYNQNGQHVSQIDDKGLHNILVLTGYAIDESTGELVPTFDPCDYVKGILISGKILKGNHFKIIGIPSNKLYIIRKKDVHGNITFSLPIKNFNTGTYQVDLRDKVTSFVSLDRDVAKTIVDNVLAKIYAKIYNSLNKEQKDKLYRDVEEIFNYYSIKSLKSNP
#=GC seq_cons                 MTSGAGWEEQVFLPITNSISSEDNNQIKIGSSVSIEYNQNGQHVSQIDDKGLHNILVLTGYAIDESTGELVPTFDPCDYVKGILISGKILKGNHFKIIGIPSNKLYIIRKKDVHGNITFSLPIKNFNTGTYQVDLRDKVTSFVSLDRDVAKTIVDNVLAKIYAKIYNSLNKEQKDKLYRDVEEIFNYYSIKSLKSNP
//