GenomeNet

Database: Pfam
Entry: Curto_V2
LinkDB: Curto_V2
Original site: Curto_V2 
#=GF ID   Curto_V2
#=GF AC   PF07325.11
#=GF DE   Curtovirus V2 protein
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_19350 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   167.50 167.40;
#=GF NC   23.10 19.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9123819
#=GF RT   Genetic analysis of the monopartite tomato yellow leaf curl
#=GF RT   geminivirus: roles of V1, V2, and C2 ORFs in viral pathogenesis. 
#=GF RA   Wartig L, Kheyr-Pour A, Noris E, De Kouchkovsky F, Jouanneau F,
#=GF RA   Gronenborn B, Jupin I; 
#=GF RL   Virology 1997;228:132-140.
#=GF DR   INTERPRO; IPR009931;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of several Curtovirus V2 proteins. The
#=GF CC   exact function of V2 is unclear but it is known that the protein
#=GF CC   is required for a successful host infection process [1].
#=GF SQ   6
#=GS B1P3E0_BCTIV/1-121  AC B1P3E0.1
#=GS Q65414_9GEMI/1-126  AC Q65414.1
#=GS A8W737_9GEMI/1-126  AC A8W737.1
#=GS Q65435_9GEMI/1-126  AC Q65435.1
#=GS V2_BCTVC/1-102      AC Q77HP2.1
#=GS Q68540_9GEMI/1-125  AC Q68540.1
B1P3E0_BCTIV/1-121             MVPFRVSEFPRSYPALLAVSTSCFLRYNKWCLLGIESQVrEPLTLEEGEDFLQFQKEVKKLLKLKVSFKRKCCLYEDIYKKYGGSESKEKVYSSGQLDeEEEDDRWEdsLEEIPMEETGA----------k
Q65414_9GEMI/1-126             MGPFRVDQFPDNYPAFLAVSTSCFLRYNRWCILGIHQEI.EALTLEEGEVFLQFQKEVKKLLRCKVNFHRKCSLYEEIYKKYVYNVPEKKGESSKCLA.EEEEDYYD..FEEIPMEETCDKKQDSEVKDV.
A8W737_9GEMI/1-126             MGPFRVDQFPDNYPAFLAVSTSCFLRYNKWCILGIHQEI.EPLTLEEGEVFLQFQKELKKLLRLKVNFHRKCSLYEEIYKKYVHNVAEKKGESSKCVA.KKEENYYD..CEEIPMEEACVKKQDFEVEDV.
Q65435_9GEMI/1-126             MGPFRVDQFPDNYPAFLAVSTSCFLRYNKWCILGIHQEI.EALTLEEGAVFLQFQKEVKKLLRRKVNFHRKCSLYEEIYKKYVYNVPEKKGESSKCVA.EEEEDYYD..FEEIPMEETCDKKQDSEVKDV.
V2_BCTVC/1-102                 MGPFRVDQFPDNYPAFLAVSTSCFLRYNRWCILGIHQEI.GSLTLEEGEVFRQFQKEVKKLLRCKVNFHRKCSLYEEIYKKYVYNVPEKKGESSKCVA.EEEED---..---------------------.
Q68540_9GEMI/1-125             MGPFTVGQFPRNYPALLAVSTSCFFRYNKWCILGIRHEV.ESLTLEEGEAFLGFQKEVKKLLKRKCTFSRKCELYEEIYKKYLSDGPEEKGSLPTVMV.EEEED-WA..HEKIPMEEACSQDEGPEIEDV.
#=GC seq_cons                  MGPFRVDQFPDNYPAFLAVSTSCFLRYNKWCILGIHQEI.EuLTLEEGEVFLQFQKEVKKLLRpKVNFHRKCSLYEEIYKKYVaNVPEKKGESSKClA.EEEEDha-..hEEIPMEEsCspcps.ElcDV.
//
DBGET integrated database retrieval system