GenomeNet

Database: Pfam
Entry: DMP12
LinkDB: DMP12
Original site: DMP12 
#=GF ID   DMP12
#=GF AC   PF16779.7
#=GF DE   DNA-mimic protein
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   pdb_3w1o
#=GF GA   27.00 27.00;
#=GF TC   27.40 50.60;
#=GF NC   21.10 20.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   23531546
#=GF RT   Neisseria conserved hypothetical protein DMP12 is a DNA mimic
#=GF RT   that binds to histone-like HU protein.
#=GF RA   Wang HC, Wu ML, Ko TP, Wang AH;
#=GF RL   Nucleic Acids Res. 2013;41:5127-5138.
#=GF DR   INTERPRO; IPR031891;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This is a family of DNA-mimic proteins expressed by Neisseria
#=GF CC   species. In its monomeric form DMP12 interacts with the
#=GF CC   Neisseria dimeric form of the bacterial histone-like protein HU.
#=GF CC   HU proteins promote the assembly of higher-order DNA-protein
#=GF CC   structures, The interaction between DMP12 and HU protein may be
#=GF CC   instrumental in controlling the stability of the nucleoid in
#=GF CC   Neisseria as DMP12 prevents Neisseria HU protein from being
#=GF CC   digested by trypsin [1].
#=GF SQ   4
#=GS A0A166WBF4_9GAMM/3-118  AC A0A166WBF4.1
#=GS Q9JXD1_NEIMB/4-118      AC Q9JXD1.1
#=GS Q5F5G1_NEIG1/4-118      AC Q5F5G1.1
#=GS Q9JXC6_NEIMB/4-118      AC Q9JXC6.1
#=GS Q9JXC6_NEIMB/4-118      DR PDB; 3W1O A; 4-118;
#=GS Q9JXC6_NEIMB/4-118      DR PDB; 3W1O B; 4-118;
A0A166WBF4_9GAMM/3-118             dlft----IFVTDDSIdeNIAEHHEVVQWSYQNLEHPNVIPVTSKQIYHLGNIGVLDIISELNGS-MLGEGEDDWIIENEIKKEILDRLERGFNFEDALLIKLKELFKCSIKNERNIYFHF
Q9JXD1_NEIMB/4-118                 ....HNLLIFCLKDNV..SISEYTEMVDWAYENIQSETVVEITENQIIEYQNRGLWGLVSEITDNWLFGPSEGDWLIDKESILAVKEKLQNSDFSTEPLVKNIIHVLEYAIKNEKTVIFHF
Q5F5G1_NEIG1/4-118                 ....HNLLIFCLKDNV..SISEYTEMVDWAYENIQSETVVEITENQIIEYQNRGLWGLVSEITDNWLFGPSEGDWLIDKESILAVKEKLQNSDFSTEPLVKNIIHVLEYAIKNEKTVIFHF
Q9JXC6_NEIMB/4-118                 ....HNLLIFCLKDNV..SISEYTEMIDWAYKNIQSETVVEITENQIIEYQNRGLWRLVSEITDNWLFGPSEGDWLIDKESILAVKEKLQNSDFSTEPLVKNIIHVLEYAIKNEKTVIFHF
#=GR Q9JXC6_NEIMB/4-118      SS    ....--EEEE---TT-..---BHHHHHHHHHHTTTSTTEEEE-HHHHHHHHHHTHHHHHHHHHS--TTS--SEEEEE-HHHHHHHHHHHHTSTTTTSHHHHHHHHHHHHHHHCT--EEEEE
#=GC SS_cons                       ....--EEEE---TT-..---BHHHHHHHHHHTTTSTTEEEE-HHHHHHHHHHTHHHHHHHHHS--TTS--SEEEEE-HHHHHHHHHHHHTSTTTTSHHHHHHHHHHHHHHHCT--EEEEE
#=GC seq_cons                      ....HNLLIFCLKDNV..SISEYTEMVDWAYcNIQSETVVEITENQIIEYQNRGLWsLVSEITDNWLFGPSEGDWLIDKESILAVKEKLQNSDFSTEPLVKNIIHVLEYAIKNEKTVIFHF
//
DBGET integrated database retrieval system