GenomeNet

Database: Pfam
Entry: DUF1086
LinkDB: DUF1086
Original site: DUF1086 
#=GF ID   DUF1086
#=GF AC   PF06461.13
#=GF DE   Domain of Unknown Function (DUF1086)
#=GF AU   Yeats C;0000-0003-0080-6242
#=GF SE   ADDA_2403
#=GF GA   28.80 28.80;
#=GF TC   29.70 28.80;
#=GF NC   28.60 28.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR009462;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This family consists of several eukaryotic domains of unknown
#=GF CC   function which are present in chromodomain helicase DNA binding
#=GF CC   proteins. This domain is often found in conjunction with
#=GF CC   Pfam:PF00176, Pfam:PF00271, Pfam:PF06465, Pfam:PF00385 and
#=GF CC   Pfam:PF00628.
#=GF SQ   2135
#=GS A0A2K5PFP5_CEBCA/1356-1497  AC A0A2K5PFP5.1
#=GS A0A4W6CQN2_LATCA/1355-1496  AC A0A4W6CQN2.1
#=GS A0A556V630_BAGYA/1240-1403  AC A0A556V630.1
#=GS A0A2K6SN26_SAIBB/1361-1502  AC A0A2K6SN26.1
#=GS A0A4E0RJA1_FASHE/1398-1531  AC A0A4E0RJA1.1
#=GS A0A3P8RTH8_AMPPE/1306-1447  AC A0A3P8RTH8.1
#=GS A0A2K6SKA6_SAIBB/1414-1545  AC A0A2K6SKA6.1
#=GS A0A1S3U4M9_VIGRR/933-1068   AC A0A1S3U4M9.1
#=GS A0A3P9AY62_9CICH/1289-1430  AC A0A3P9AY62.1
#=GS A0A4U5MQ42_STECR/1320-1458  AC A0A4U5MQ42.1
#=GS A0A2K5WDX8_MACFA/1392-1533  AC A0A2K5WDX8.1
#=GS A0A2I3TPK6_PANTR/1376-1517  AC A0A2I3TPK6.1
#=GS A0A5N5L532_PANHP/1352-1493  AC A0A5N5L532.1
#=GS A0A6I8QY33_XENTR/1230-1371  AC A0A6I8QY33.1
#=GS A0A0V1HWI4_9BILA/1359-1499  AC A0A0V1HWI4.1
#=GS A0A5E4E701_PRUDU/933-1069   AC A0A5E4E701.1
#=GS A0A0V1BDQ2_TRISP/1383-1526  AC A0A0V1BDQ2.1
#=GS A0A2I3HBW2_NOMLE/1387-1528  AC A0A2I3HBW2.1
#=GS A0A1D5RBC8_MACMU/1435-1576  AC A0A1D5RBC8.2
#=GS A0A5N4C6T8_CAMDR/1418-1559  AC A0A5N4C6T8.1
#=GS A0A0C2CR21_9BILA/594-731    AC A0A0C2CR21.1
#=GS F7DE19_XENTR/1323-1464      AC F7DE19.3
#=GS CHD5_HUMAN/1388-1529        AC Q8TDI0.1
#=GS H2NSL6_PONAB/1310-1435      AC H2NSL6.1
#=GS A0A3Q1IBQ1_ANATE/1350-1490  AC A0A3Q1IBQ1.1
#=GS A0A5J4NNX1_9TREM/834-967    AC A0A5J4NNX1.1
#=GS H3CRG9_TETNG/1312-1453      AC H3CRG9.1
#=GS A0A3P6GEV0_9CEST/963-1053   AC A0A3P6GEV0.1
#=GS A0A0D3A2Q9_BRAOL/909-1044   AC A0A0D3A2Q9.1
#=GS A0A0T6B4S0_9SCAR/425-567    AC A0A0T6B4S0.1
#=GS A0A674MGA3_TAKRU/1401-1542  AC A0A674MGA3.1
#=GS F7ENN8_ORNAN/1381-1522      AC F7ENN8.2
#=GS A0A669CU59_ORENI/1219-1360  AC A0A669CU59.1
#=GS A0A665TPT9_ECHNA/1192-1332  AC A0A665TPT9.1
#=GS A0A665WLL9_ECHNA/1116-1257  AC A0A665WLL9.1
#=GS A0A0S3RP76_PHAAN/1-114      AC A0A0S3RP76.1
#=GS A0A2T7PPK4_POMCA/1273-1414  AC A0A2T7PPK4.1
#=GS A0A671WNP1_SPAAU/1375-1516  AC A0A671WNP1.1
#=GS A0A674A5E8_SALTR/1309-1450  AC A0A674A5E8.1
#=GS A0A6I8SWS1_XENTR/1230-1371  AC A0A6I8SWS1.1
#=GS A0A2K6MIX9_RHIBE/1405-1546  AC A0A2K6MIX9.1
#=GS H2QC61_PANTR/1434-1575      AC H2QC61.1
#=GS A0A446Y4P4_TRITD/897-1031   AC A0A446Y4P4.1
#=GS A0A6I8SNL5_XENTR/1369-1510  AC A0A6I8SNL5.1
#=GS A0A1S3M229_SALSA/1403-1544  AC A0A1S3M229.1
#=GS A0A2K5WDV2_MACFA/1371-1512  AC A0A2K5WDV2.1
#=GS A0A4W5KN59_9TELE/1309-1442  AC A0A4W5KN59.1
#=GS A0A5A7VBI4_CUCME/948-1084   AC A0A5A7VBI4.1
#=GS A0A2G5EYX2_AQUCA/933-1072   AC A0A2G5EYX2.1
#=GS A0A3B1JZW7_ASTMX/99-240     AC A0A3B1JZW7.1
#=GS A0A341BPI2_NEOAA/1374-1515  AC A0A341BPI2.1
#=GS A0A484GHR7_SOUCH/1343-1484  AC A0A484GHR7.1
#=GS A0A1D6NTR8_MAIZE/615-750    AC A0A1D6NTR8.1
#=GS A0A2G9R713_LITCT/1089-1163  AC A0A2G9R713.1
#=GS M0SQU0_MUSAM/924-1059       AC M0SQU0.1
#=GS A0A4S2LP38_OPIFE/1424-1554  AC A0A4S2LP38.1
#=GS A0A674DIC9_SALTR/1330-1471  AC A0A674DIC9.1
#=GS A0A2U3ZUI7_ODORO/1373-1514  AC A0A2U3ZUI7.1
#=GS E2R1M3_CANLF/1207-1348      AC E2R1M3.3
#=GS A0A158QCK4_HYMDI/1389-1510  AC A0A158QCK4.1
#=GS A0A2K6SKI5_SAIBB/1376-1517  AC A0A2K6SKI5.1
#=GS A0A2Y9EIZ4_PHYMC/1367-1508  AC A0A2Y9EIZ4.1
#=GS A0A6Q2ZMS6_ESOLU/1356-1497  AC A0A6Q2ZMS6.1
#=GS A0A5E4B491_MARMO/1373-1514  AC A0A5E4B491.1
#=GS A0A210Q7X7_MIZYE/1349-1490  AC A0A210Q7X7.1
#=GS A0A3P9AEZ6_ESOLU/1305-1446  AC A0A3P9AEZ6.2
#=GS A0A2K5QEE1_CEBCA/1355-1496  AC A0A2K5QEE1.1
#=GS A0A2Y9QXR6_TRIMA/1208-1349  AC A0A2Y9QXR6.1
#=GS A0A2H5NW06_CITUN/919-1046   AC A0A2H5NW06.1
#=GS F1SSZ2_PIG/1388-1529        AC F1SSZ2.3
#=GS A0A1S3PYU9_SALSA/1382-1523  AC A0A1S3PYU9.1
#=GS A0A671Y5S0_SPAAU/1349-1490  AC A0A671Y5S0.1
#=GS A0A287CTW0_ICTTR/1342-1483  AC A0A287CTW0.1
#=GS A0A3Q0FG10_VIGRR/68-150     AC A0A3Q0FG10.1
#=GS H9G6J6_ANOCA/1403-1544      AC H9G6J6.2
#=GS A0A226MYT2_CALSU/1373-1514  AC A0A226MYT2.1
#=GS A0A453QYB8_AEGTS/230-364    AC A0A453QYB8.1
#=GS A0A4W6EEB1_LATCA/1267-1410  AC A0A4W6EEB1.1
#=GS A0A212DAI3_CEREH/1208-1349  AC A0A212DAI3.1
#=GS A0A067FJA4_CITSI/934-1016   AC A0A067FJA4.1
#=GS A0A446Y4P0_TRITD/786-920    AC A0A446Y4P0.1
#=GS B4H036_DROPE/1239-1380      AC B4H036.1
#=GS A0A6Q2XGW0_ESOLU/1298-1439  AC A0A6Q2XGW0.1
#=GS A0A4W6CQ54_LATCA/1359-1500  AC A0A4W6CQ54.1
#=GS A0A3Q1BGN4_AMPOC/1243-1384  AC A0A3Q1BGN4.1
#=GS A0A1Q3AW41_CEPFO/931-1067   AC A0A1Q3AW41.1
#=GS A0A5F5PN79_HORSE/1431-1572  AC A0A5F5PN79.1
#=GS A0A6J3S7I5_TURTR/1380-1521  AC A0A6J3S7I5.1
#=GS A0A0R3R4P1_9BILA/438-580    AC A0A0R3R4P1.1
#=GS A0A3Q7W044_URSAR/1373-1514  AC A0A3Q7W044.1
#=GS A0A2A3EEQ6_APICC/1375-1531  AC A0A2A3EEQ6.1
#=GS A0A5J5D429_9PERO/495-636    AC A0A5J5D429.1
#=GS A0A6I8P9R5_ORNAN/1231-1372  AC A0A6I8P9R5.1
#=GS A0A0L7QSS6_9HYME/1304-1445  AC A0A0L7QSS6.1
#=GS A0A6I8QYE2_XENTR/1232-1373  AC A0A6I8QYE2.1
#=GS A0A0D2VEQ1_GOSRA/931-1067   AC A0A0D2VEQ1.1
#=GS A0A3Q3KQT9_9TELE/1401-1542  AC A0A3Q3KQT9.1
#=GS A0A4S4EA66_CAMSI/1036-1167  AC A0A4S4EA66.1
#=GS L8HVA0_9CETA/1408-1549      AC L8HVA0.1
#=GS M3ZFU1_XIPMA/1296-1437      AC M3ZFU1.2
#=GS A0A182GNW3_AEDAL/1399-1540  AC A0A182GNW3.1
#=GS A0A455ASS0_PHYMC/1374-1515  AC A0A455ASS0.1
#=GS A0A5N3X5F1_MUNRE/1433-1574  AC A0A5N3X5F1.1
#=GS A0A0E0L8N5_ORYPU/969-1030   AC A0A0E0L8N5.1
#=GS A0A401Q8T7_SCYTO/42-183     AC A0A401Q8T7.1
#=GS I3JIX2_ORENI/1376-1517      AC I3JIX2.2
#=GS A0A1S3LDL6_SALSA/1385-1526  AC A0A1S3LDL6.1
#=GS G3RCF2_GORGO/1376-1517      AC G3RCF2.2
#=GS A0A3Q7S5I7_VULVU/1373-1514  AC A0A3Q7S5I7.1
#=GS A0A0D9S8T5_CHLSB/1388-1529  AC A0A0D9S8T5.1
#=GS A0A6J3S7J0_TURTR/1367-1508  AC A0A6J3S7J0.1
#=GS H2LPE8_ORYLA/1373-1514      AC H2LPE8.2
#=GS V8NU88_OPHHA/1374-1515      AC V8NU88.1
#=GS A0A670J3A9_PODMU/1277-1418  AC A0A670J3A9.1
#=GS A0A6I8SAW7_XENTR/1147-1288  AC A0A6I8SAW7.1
#=GS A0A3Q0FG68_VIGRR/44-140     AC A0A3Q0FG68.1
#=GS A0A4W6CR21_LATCA/1275-1416  AC A0A4W6CR21.1
#=GS M7ASQ0_CHEMY/1265-1406      AC M7ASQ0.1
#=GS A0A5N5JG72_PANHP/1380-1521  AC A0A5N5JG72.1
#=GS A0A4W5NWN4_9TELE/1319-1460  AC A0A4W5NWN4.1
#=GS A0A5F4CL47_CANLF/1425-1566  AC A0A5F4CL47.1
#=GS A0A2R8Y425_HUMAN/1356-1497  AC A0A2R8Y425.1
#=GS A0A4W5PIQ2_9TELE/1216-1357  AC A0A4W5PIQ2.1
#=GS E2RTI2_CANLF/1353-1494      AC E2RTI2.2
#=GS A0A2K5S0D1_CEBCA/1376-1517  AC A0A2K5S0D1.1
#=GS A0A2P5WH70_GOSBA/966-1102   AC A0A2P5WH70.1
#=GS H3CKU8_TETNG/14-70          AC H3CKU8.1
#=GS A0A668AW64_9TELE/1300-1441  AC A0A668AW64.1
#=GS A0A087RH92_APTFO/1380-1521  AC A0A087RH92.1
#=GS A0A384BUS1_URSMA/1382-1523  AC A0A384BUS1.1
#=GS A0A341AG38_NEOAA/1373-1514  AC A0A341AG38.1
#=GS A0A226EM65_FOLCA/1334-1474  AC A0A226EM65.1
#=GS A0A3Q7S8C3_VULVU/1379-1520  AC A0A3Q7S8C3.1
#=GS A0A4U5QK80_POPAL/967-1103   AC A0A4U5QK80.1
#=GS A0A2I4BGD7_9TELE/1379-1520  AC A0A2I4BGD7.1
#=GS A0A2R6QMP8_ACTCC/932-1068   AC A0A2R6QMP8.1
#=GS A0A4W4DXI6_ELEEL/105-246    AC A0A4W4DXI6.1
#=GS A0A553MTE5_9TELE/1438-1563  AC A0A553MTE5.1
#=GS A0A218U8V8_9PASE/1351-1470  AC A0A218U8V8.1
#=GS A0A1U8HVK9_GOSHI/931-1067   AC A0A1U8HVK9.1
#=GS A0A671X2R0_SPAAU/1283-1424  AC A0A671X2R0.1
#=GS A0A1S3P3I2_SALSA/1377-1518  AC A0A1S3P3I2.1
#=GS A0A1R3J799_9ROSI/220-297    AC A0A1R3J799.1
#=GS A0A4W5RY56_9TELE/1295-1436  AC A0A4W5RY56.1
#=GS A0A4W4DWC9_ELEEL/1219-1360  AC A0A4W4DWC9.1
#=GS A0A674F7F8_SALTR/1219-1360  AC A0A674F7F8.1
#=GS A0A674DIW8_SALTR/1272-1413  AC A0A674DIW8.1
#=GS A0A672J3L3_SALFA/1185-1326  AC A0A672J3L3.1
#=GS A0A2Y9T6M3_PHYMC/1208-1349  AC A0A2Y9T6M3.1
#=GS A0A4W5KM41_9TELE/1278-1419  AC A0A4W5KM41.1
#=GS A0A673ZYC6_SALTR/1340-1480  AC A0A673ZYC6.1
#=GS A0A2K5XUW9_MANLE/1346-1487  AC A0A2K5XUW9.1
#=GS A0A669EYF8_ORENI/1310-1451  AC A0A669EYF8.1
#=GS A0A2K5UJU6_MACFA/1194-1325  AC A0A2K5UJU6.1
#=GS A0A5N3XV18_MUNRE/1362-1500  AC A0A5N3XV18.1
#=GS A0A2K6DCX4_MACNE/1388-1529  AC A0A2K6DCX4.1
#=GS A0A4S4DHN3_CAMSI/202-262    AC A0A4S4DHN3.1
#=GS A0A2K6FW53_PROCO/1429-1570  AC A0A2K6FW53.1
#=GS A0A251TEL3_HELAN/1046-1182  AC A0A251TEL3.1
#=GS A0A6I8RYI3_XENTR/1239-1380  AC A0A6I8RYI3.1
#=GS A0A267FST8_9PLAT/1379-1517  AC A0A267FST8.1
#=GS A0A0H2UHP5_RAT/1386-1527    AC A0A0H2UHP5.1
#=GS A0A3Q3SPR1_9TELE/1371-1512  AC A0A3Q3SPR1.1
#=GS A0A4W2EH06_BOBOX/1388-1529  AC A0A4W2EH06.1
#=GS A0A022PZA4_ERYGU/934-1066   AC A0A022PZA4.1
#=GS A0A2Y9NDW2_DELLE/1373-1514  AC A0A2Y9NDW2.1
#=GS A0A4S2M113_OPIFE/1423-1556  AC A0A4S2M113.1
#=GS A0A078IWX8_BRANA/919-1055   AC A0A078IWX8.1
#=GS A0A445B4X2_ARAHY/33-88      AC A0A445B4X2.1
#=GS A0A674AVQ5_SALTR/1395-1536  AC A0A674AVQ5.1
#=GS A0A671VNA1_SPAAU/1271-1412  AC A0A671VNA1.1
#=GS G5C570_HETGA/1660-1772      AC G5C570.1
#=GS A0A673BKA3_9TELE/1275-1416  AC A0A673BKA3.1
#=GS A0A2G8L6K2_STIJA/626-753    AC A0A2G8L6K2.1
#=GS A0A2K1WUI8_POPTR/937-1073   AC A0A2K1WUI8.1
#=GS A0A0L8HCR4_OCTBM/1196-1338  AC A0A0L8HCR4.1
#=GS A0A6Q2ZPC2_ESOLU/1288-1429  AC A0A6Q2ZPC2.1
#=GS K7GBZ7_PELSI/1381-1522      AC K7GBZ7.1
#=GS A0A2P6VJE1_9CHLO/2160-2295  AC A0A2P6VJE1.1
#=GS R7TBU1_CAPTE/407-551        AC R7TBU1.1
#=GS A0A158R806_TAEAS/1440-1595  AC A0A158R806.1
#=GS A0A674H0D8_TAEGU/98-233     AC A0A674H0D8.1
#=GS A0A3Q0GVG0_ALLSI/1316-1457  AC A0A3Q0GVG0.1
#=GS A0A287DFP2_ICTTR/1361-1502  AC A0A287DFP2.1
#=GS A0A6A5M2U5_LUPAL/930-1066   AC A0A6A5M2U5.1
#=GS A0A2I0MLN9_COLLI/1373-1514  AC A0A2I0MLN9.1
#=GS A0A3S3PV35_9ACAR/1215-1351  AC A0A3S3PV35.1
#=GS A0A1U8CW16_MESAU/95-236     AC A0A1U8CW16.2
#=GS A0A1P6BYH5_BRUMA/1277-1417  AC A0A1P6BYH5.1
#=GS A0A096MRG6_PAPAN/1360-1501  AC A0A096MRG6.2
#=GS I3MTW5_ICTTR/1373-1514      AC I3MTW5.2
#=GS A0A286ZJL1_PIG/1370-1511    AC A0A286ZJL1.2
#=GS A0A6D2IZG9_9BRAS/918-1054   AC A0A6D2IZG9.1
#=GS L5M0D9_MYODS/1374-1515      AC L5M0D9.1
#=GS A0A1U8P355_GOSHI/934-1070   AC A0A1U8P355.1
#=GS A0A4W6CQX1_LATCA/1207-1348  AC A0A4W6CQX1.1
#=GS A0A1S3SDE2_SALSA/1440-1581  AC A0A1S3SDE2.1
#=GS G0MX39_CAEBE/1247-1385      AC G0MX39.1
#=GS A0A212CDI9_CEREH/501-640    AC A0A212CDI9.1
#=GS A0A2I4BV63_9TELE/1405-1546  AC A0A2I4BV63.1
#=GS A0A665TRP1_ECHNA/1183-1323  AC A0A665TRP1.1
#=GS A0A4W6CQX9_LATCA/1198-1339  AC A0A4W6CQX9.1
#=GS A0A2K5J9F5_COLAP/1395-1536  AC A0A2K5J9F5.1
#=GS A0A674F7A8_SALTR/1329-1470  AC A0A674F7A8.1
#=GS A0A3B0JB63_DROGU/1389-1530  AC A0A3B0JB63.1
#=GS H2MAR1_ORYLA/1275-1416      AC H2MAR1.2
#=GS A0A4W5NXK0_9TELE/1401-1542  AC A0A4W5NXK0.1
#=GS A0A0D2RCZ8_GOSRA/931-1067   AC A0A0D2RCZ8.1
#=GS A0A091IJH1_CALAN/1281-1430  AC A0A091IJH1.1
#=GS A0A485MCF4_LYNPA/1360-1501  AC A0A485MCF4.1
#=GS A0A0V1LNN4_9BILA/1474-1614  AC A0A0V1LNN4.1
#=GS A0A1S3LDL9_SALSA/1392-1533  AC A0A1S3LDL9.1
#=GS A0A672J447_SALFA/98-236     AC A0A672J447.1
#=GS A0A2Y9HLT9_NEOSC/1429-1570  AC A0A2Y9HLT9.1
#=GS A0A673Y0K2_SALTR/1246-1387  AC A0A673Y0K2.1
#=GS A0A455AS57_PHYMC/1374-1515  AC A0A455AS57.1
#=GS A0A1D6NTR9_MAIZE/569-704    AC A0A1D6NTR9.1
#=GS A0A2K5JI05_COLAP/1376-1517  AC A0A2K5JI05.1
#=GS G1RFA2_NOMLE/1338-1471      AC G1RFA2.2
#=GS F4JTF7_ARATH/814-958        AC F4JTF7.1
#=GS A0A4Z2DRA6_SCHJA/374-507    AC A0A4Z2DRA6.1
#=GS A0A3Q1GZS0_ANATE/1440-1581  AC A0A3Q1GZS0.1
#=GS A0A3B6SEG0_WHEAT/924-1019   AC A0A3B6SEG0.1
#=GS A0A553MTF8_9TELE/1447-1572  AC A0A553MTF8.1
#=GS A0A452SHR4_URSAM/1259-1400  AC A0A452SHR4.1
#=GS A0A4V6ASL6_COLLU/1359-1500  AC A0A4V6ASL6.1
#=GS A0A6J3S846_TURTR/1380-1521  AC A0A6J3S846.1
#=GS A0A669CUA1_ORENI/1217-1358  AC A0A669CUA1.1
#=GS A0A2K6L7D5_RHIBE/1374-1529  AC A0A2K6L7D5.1
#=GS A0A4P1REP7_LUPAN/898-949    AC A0A4P1REP7.1
#=GS A0A2I3H780_NOMLE/98-232     AC A0A2I3H780.1
#=GS A0A4W5QWZ6_9TELE/1265-1404  AC A0A4W5QWZ6.1
#=GS A0A067FWA3_CITSI/934-1070   AC A0A067FWA3.1
#=GS A0A2Y9H479_NEOSC/1373-1514  AC A0A2Y9H479.1
#=GS V7AWG2_PHAVU/933-1069       AC V7AWG2.1
#=GS A0A0P7UM29_SCLFO/1342-1387  AC A0A0P7UM29.1
#=GS A0A074ZFB1_9TREM/1439-1569  AC A0A074ZFB1.1
#=GS A0A6Q2WVX8_ESOLU/1253-1394  AC A0A6Q2WVX8.1
#=GS A0A669C189_ORENI/1322-1463  AC A0A669C189.1
#=GS A0A663FA34_AQUCH/1156-1297  AC A0A663FA34.1
#=GS A0A669D616_ORENI/1254-1395  AC A0A669D616.1
#=GS A0A4Y7LK37_PAPSO/883-937    AC A0A4Y7LK37.1
#=GS CHD5_RAT/1386-1527          AC D3ZD32.1
#=GS A0A2Y9QA94_DELLE/1388-1529  AC A0A2Y9QA94.1
#=GS A0A3Q4BD34_MOLML/1193-1333  AC A0A3Q4BD34.1
#=GS A0A2K6RAM8_RHIRO/1380-1521  AC A0A2K6RAM8.1
#=GS A0A2Y9NP42_DELLE/1379-1520  AC A0A2Y9NP42.1
#=GS A0A4W5PKD3_9TELE/1311-1451  AC A0A4W5PKD3.1
#=GS A0A0R3WT79_HYDTA/2-154      AC A0A0R3WT79.1
#=GS A0A0D9RFE3_CHLSB/1341-1482  AC A0A0D9RFE3.1
#=GS A0A444G9W0_ENSVE/322-370    AC A0A444G9W0.1
#=GS A0A672Z5E5_9TELE/1308-1449  AC A0A672Z5E5.1
#=GS A0A673B8R8_9TELE/1219-1360  AC A0A673B8R8.1
#=GS A0A667ZJS6_9TELE/1172-1313  AC A0A667ZJS6.1
#=GS A0A0V0YNJ2_TRIPS/1266-1406  AC A0A0V0YNJ2.1
#=GS A0A2K6L7C0_RHIBE/1374-1529  AC A0A2K6L7C0.1
#=GS A0A673BBJ9_9TELE/1280-1420  AC A0A673BBJ9.1
#=GS F7G688_ORNAN/1378-1519      AC F7G688.3
#=GS A0A4W6EI07_LATCA/1286-1427  AC A0A4W6EI07.1
#=GS A0A671X371_SPAAU/1295-1436  AC A0A671X371.1
#=GS B4LBL9_DROVI/1372-1513      AC B4LBL9.2
#=GS A0A154PRM5_DUFNO/725-847    AC A0A154PRM5.1
#=GS A0A5E4BB40_MARMO/1263-1404  AC A0A5E4BB40.1
#=GS A0A6I8S305_XENTR/1232-1373  AC A0A6I8S305.1
#=GS A0A671DRE3_RHIFE/1380-1521  AC A0A671DRE3.1
#=GS A0A665VDH7_ECHNA/1278-1419  AC A0A665VDH7.1
#=GS L5M993_MYODS/1380-1521      AC L5M993.1
#=GS A0A669EQZ9_ORENI/1189-1330  AC A0A669EQZ9.1
#=GS A0A0M3KB69_ANISI/1-58       AC A0A0M3KB69.1
#=GS A0A1L8FDZ1_XENLA/1360-1501  AC A0A1L8FDZ1.1
#=GS A0A673BBT4_9TELE/1244-1385  AC A0A673BBT4.1
#=GS A0A673ZTA4_SALTR/1340-1480  AC A0A673ZTA4.1
#=GS A0A446Y4B4_TRITD/38-172     AC A0A446Y4B4.1
#=GS A0A553MTF0_9TELE/1399-1524  AC A0A553MTF0.1
#=GS A0A5B8MU67_9CHLO/960-1100   AC A0A5B8MU67.1
#=GS T1GDH8_MEGSC/506-573        AC T1GDH8.1
#=GS A0A553MTE6_9TELE/1453-1577  AC A0A553MTE6.1
#=GS A0A287AAA4_PIG/1380-1521    AC A0A287AAA4.1
#=GS A0A087VD60_BALRE/1349-1490  AC A0A087VD60.1
#=GS A0A452FFU1_CAPHI/1365-1506  AC A0A452FFU1.1
#=GS A0A2W1BUF3_HELAM/1380-1521  AC A0A2W1BUF3.1
#=GS A0A1Y3BHG6_EURMA/441-559    AC A0A1Y3BHG6.1
#=GS H2YQ32_CIOSA/1203-1344      AC H2YQ32.1
#=GS K7KIF9_SOYBN/931-1068       AC K7KIF9.1
#=GS A0A3Q2DNX3_CYPVA/1348-1489  AC A0A3Q2DNX3.1
#=GS A0A0C4DGG9_HUMAN/1405-1546  AC A0A0C4DGG9.1
#=GS A0A0D2UK31_GOSRA/931-1067   AC A0A0D2UK31.1
#=GS A0A674EU67_SALTR/1338-1479  AC A0A674EU67.1
#=GS W6VAX0_ECHGR/1330-1459      AC W6VAX0.1
#=GS A0A0K9QQ59_SPIOL/934-1070   AC A0A0K9QQ59.1
#=GS A0A452I1B2_9SAUR/1091-1232  AC A0A452I1B2.1
#=GS A0A2I0BEE9_9ASPA/935-1072   AC A0A2I0BEE9.1
#=GS A0A340WV36_LIPVE/1251-1392  AC A0A340WV36.1
#=GS A0A674H9V2_TAEGU/1305-1446  AC A0A674H9V2.1
#=GS A0A2K6DCZ2_MACNE/1377-1518  AC A0A2K6DCZ2.1
#=GS A0A1S3M315_SALSA/1404-1545  AC A0A1S3M315.1
#=GS A0A0E0L8N5_ORYPU/921-972    AC A0A0E0L8N5.1
#=GS A0A4W5RY07_9TELE/1268-1409  AC A0A4W5RY07.1
#=GS A0A1S3JB55_LINUN/1405-1548  AC A0A1S3JB55.1
#=GS A0A4U5QNH4_POPAL/1861-1997  AC A0A4U5QNH4.1
#=GS A0A672J0F0_SALFA/1226-1367  AC A0A672J0F0.1
#=GS A0A4S4ESG6_CAMSI/130-181    AC A0A4S4ESG6.1
#=GS A0A4D9DHC6_9SAUR/546-687    AC A0A4D9DHC6.1
#=GS A0A452SHQ7_URSAM/1346-1487  AC A0A452SHQ7.1
#=GS A0A2Y9EKX0_PHYMC/1380-1521  AC A0A2Y9EKX0.1
#=GS H0WCQ8_CAVPO/1361-1502      AC H0WCQ8.2
#=GS A0A452GRU9_9SAUR/1235-1376  AC A0A452GRU9.1
#=GS F6Q627_HORSE/1446-1587      AC F6Q627.3
#=GS A0A161YVQ9_DAUCS/928-1063   AC A0A161YVQ9.1
#=GS A0A2J7RCR4_9NEOP/1404-1546  AC A0A2J7RCR4.1
#=GS A0A2K5KML3_CERAT/1380-1521  AC A0A2K5KML3.1
#=GS B0WBW6_CULQU/1400-1541      AC B0WBW6.1
#=GS A0A044VIM1_ONCVO/1284-1424  AC A0A044VIM1.2
#=GS A0A4W4EUI4_ELEEL/1361-1502  AC A0A4W4EUI4.1
#=GS A0A5E4AZP0_MARMO/281-418    AC A0A5E4AZP0.1
#=GS A0A670KFE7_PODMU/1314-1455  AC A0A670KFE7.1
#=GS A0A6J3QQQ8_TURTR/1434-1575  AC A0A6J3QQQ8.1
#=GS A0A176WQC4_MARPO/1204-1340  AC A0A176WQC4.1
#=GS A0A3B6SEG0_WHEAT/1010-1080  AC A0A3B6SEG0.1
#=GS A0A1S3P3D5_SALSA/1326-1467  AC A0A1S3P3D5.1
#=GS F1MFF9_BOVIN/1252-1393      AC F1MFF9.3
#=GS A0A5N5TP30_9CRUS/1308-1446  AC A0A5N5TP30.1
#=GS A0A668AJ24_9TELE/1258-1399  AC A0A668AJ24.1
#=GS A0A398AQU2_BRACM/894-1029   AC A0A398AQU2.1
#=GS A0A6J3QR83_TURTR/1433-1574  AC A0A6J3QR83.1
#=GS H3CFF6_TETNG/1317-1458      AC H3CFF6.1
#=GS A0A446X4S6_TRITD/939-1073   AC A0A446X4S6.1
#=GS A0A3Q4GCY3_NEOBR/1157-1298  AC A0A3Q4GCY3.1
#=GS A0A673BBG7_9TELE/1275-1415  AC A0A673BBG7.1
#=GS A0A4W6CPQ0_LATCA/1189-1330  AC A0A4W6CPQ0.1
#=GS A0A446X4T5_TRITD/924-1058   AC A0A446X4T5.1
#=GS A0A060YRN4_ONCMY/108-221    AC A0A060YRN4.1
#=GS A0A3Q3WS78_MOLML/1257-1390  AC A0A3Q3WS78.1
#=GS G1PQI5_MYOLU/1376-1517      AC G1PQI5.1
#=GS A0A673BEI6_9TELE/1287-1428  AC A0A673BEI6.1
#=GS A0A1E5UTQ3_9POAL/926-1062   AC A0A1E5UTQ3.1
#=GS LE418_CAEEL/1268-1407       AC G5EBZ4.1
#=GS A0A212EKR8_DANPL/1372-1513  AC A0A212EKR8.1
#=GS A0A3B6S962_WHEAT/901-1035   AC A0A3B6S962.1
#=GS A0A670J3K6_PODMU/1171-1312  AC A0A670J3K6.1
#=GS A0A5E4MTB0_9HEMI/1376-1517  AC A0A5E4MTB0.1
#=GS A0A2K5NL31_CERAT/1435-1576  AC A0A2K5NL31.1
#=GS A0A6G1CP46_9ORYZ/925-1059   AC A0A6G1CP46.1
#=GS A0A2P5WA70_GOSBA/728-810    AC A0A2P5WA70.1
#=GS A0A446X4Z2_TRITD/865-999    AC A0A446X4Z2.1
#=GS A0A2K6MIZ0_RHIBE/1360-1501  AC A0A2K6MIZ0.1
#=GS E9Q614_MOUSE/1428-1569      AC E9Q614.1
#=GS A0A4W3I3A9_CALMI/905-1045   AC A0A4W3I3A9.1
#=GS A0A4W5KRZ3_9TELE/1131-1272  AC A0A4W5KRZ3.1
#=GS A0A5J4ZK21_9ASTE/960-1092   AC A0A5J4ZK21.1
#=GS A0A232ESU5_9HYME/1374-1515  AC A0A232ESU5.1
#=GS A0A2Y9NUE3_DELLE/1373-1514  AC A0A2Y9NUE3.1
#=GS A0A2K1J1K7_PHYPA/977-1114   AC A0A2K1J1K7.1
#=GS A0A2R6Q300_ACTCC/932-1068   AC A0A2R6Q300.1
#=GS A0A3Q7T845_VULVU/1380-1521  AC A0A3Q7T845.1
#=GS U3DRL5_CALJA/1388-1529      AC U3DRL5.1
#=GS A0A452CMB4_BALAS/1208-1349  AC A0A452CMB4.1
#=GS A0A3P9AAH1_ESOLU/1406-1547  AC A0A3P9AAH1.2
#=GS A0A383YU61_BALAS/1187-1328  AC A0A383YU61.1
#=GS A0A061GQF3_THECC/935-1071   AC A0A061GQF3.1
#=GS A0A0V1N720_9BILA/1347-1487  AC A0A0V1N720.1
#=GS A0A452GTK8_9SAUR/1246-1386  AC A0A452GTK8.1
#=GS A0A672IZ88_SALFA/1265-1406  AC A0A672IZ88.1
#=GS A0A672J378_SALFA/1211-1352  AC A0A672J378.1
#=GS A0A671Y715_SPAAU/1401-1542  AC A0A671Y715.1
#=GS A0A3Q1LZU4_BOVIN/1430-1571  AC A0A3Q1LZU4.1
#=GS A0A6A3BPN8_HIBSY/632-761    AC A0A6A3BPN8.1
#=GS A0A4S4ESG6_CAMSI/178-213    AC A0A4S4ESG6.1
#=GS A0A4S2LMH6_OPIFE/1240-1370  AC A0A4S2LMH6.1
#=GS L8IRA9_9CETA/1359-1491      AC L8IRA9.1
#=GS A0A2Y9Q101_DELLE/1374-1515  AC A0A2Y9Q101.1
#=GS A0A5A9MWB0_9TELE/1797-1938  AC A0A5A9MWB0.1
#=GS A0A3Q2U0J4_CHICK/99-252     AC A0A3Q2U0J4.1
#=GS A0A3Q1JIN3_ANATE/1279-1420  AC A0A3Q1JIN3.1
#=GS A0A3Q0DKI3_CARSF/1332-1473  AC A0A3Q0DKI3.1
#=GS A0A2K5UJP5_MACFA/1376-1517  AC A0A2K5UJP5.1
#=GS A0A2K5PFM6_CEBCA/1380-1521  AC A0A2K5PFM6.1
#=GS A0A4X2M221_VOMUR/1167-1308  AC A0A4X2M221.1
#=GS A0A2K5NKP2_CERAT/1376-1517  AC A0A2K5NKP2.1
#=GS A0A452CMF8_BALAS/1202-1343  AC A0A452CMF8.1
#=GS A0A1D6NTQ1_MAIZE/921-1003   AC A0A1D6NTQ1.1
#=GS A0A1D6NTS1_MAIZE/317-452    AC A0A1D6NTS1.1
#=GS A0A671Y7B9_SPAAU/1230-1371  AC A0A671Y7B9.1
#=GS A0A669C7M8_ORENI/1270-1411  AC A0A669C7M8.1
#=GS A0A2K6SKJ0_SAIBB/1209-1340  AC A0A2K6SKJ0.1
#=GS A0A0V0WJP6_9BILA/1390-1530  AC A0A0V0WJP6.1
#=GS A0A2K5J999_COLAP/1370-1511  AC A0A2K5J999.1
#=GS A0A6J3QQV4_TURTR/1434-1575  AC A0A6J3QQV4.1
#=GS A0A556U8P7_BAGYA/1365-1503  AC A0A556U8P7.1
#=GS A0A0V0UCU8_9BILA/1341-1481  AC A0A0V0UCU8.1
#=GS F1N544_BOVIN/1340-1481      AC F1N544.3
#=GS G1NMS5_MELGA/1381-1522      AC G1NMS5.2
#=GS A0A6Q2Z3W6_ESOLU/1305-1440  AC A0A6Q2Z3W6.1
#=GS A0A1U8BLP6_MESAU/1406-1547  AC A0A1U8BLP6.1
#=GS H0YWQ4_TAEGU/1335-1476      AC H0YWQ4.2
#=GS A0A2K5ETC5_AOTNA/1405-1546  AC A0A2K5ETC5.1
#=GS A0A2Y9R5L5_TRIMA/1208-1349  AC A0A2Y9R5L5.1
#=GS A0A672IX61_SALFA/1315-1456  AC A0A672IX61.1
#=GS A0A0L8HBI2_OCTBM/1234-1376  AC A0A0L8HBI2.1
#=GS H2YQ35_CIOSA/1165-1306      AC H2YQ35.1
#=GS A0A2P6VJB3_9CHLO/2160-2292  AC A0A2P6VJB3.1
#=GS A0A2R9AXP0_PANPA/1368-1523  AC A0A2R9AXP0.1
#=GS A0A090L5U8_STRRB/2329-2469  AC A0A090L5U8.1
#=GS A0A671WMF3_SPAAU/91-231     AC A0A671WMF3.1
#=GS A0A060WEN1_ONCMY/999-1140   AC A0A060WEN1.1
#=GS A0A4W5NXJ0_9TELE/1287-1427  AC A0A4W5NXJ0.1
#=GS A0A099ZZF7_CHAVO/1379-1520  AC A0A099ZZF7.1
#=GS A0A1S3LDL1_SALSA/1385-1526  AC A0A1S3LDL1.1
#=GS E2RHA0_CANLF/1380-1521      AC E2RHA0.3
#=GS A0A1W4XI14_AGRPL/1379-1521  AC A0A1W4XI14.1
#=GS A0A4W4EQJ6_ELEEL/1400-1541  AC A0A4W4EQJ6.1
#=GS A0A158P7G2_ANGCA/1-93       AC A0A158P7G2.1
#=GS A0A3P9MWV4_POERE/1291-1432  AC A0A3P9MWV4.1
#=GS A0A3P4MZL0_GULGU/1347-1488  AC A0A3P4MZL0.1
#=GS A0A2Y9R5A9_TRIMA/1208-1349  AC A0A2Y9R5A9.1
#=GS A0A667Z319_9TELE/1268-1406  AC A0A667Z319.1
#=GS A0A3Q3L0E4_9TELE/1329-1470  AC A0A3Q3L0E4.1
#=GS A0A4W5QLB5_9TELE/1294-1368  AC A0A4W5QLB5.1
#=GS A0A091T6D2_PHALP/1378-1519  AC A0A091T6D2.1
#=GS A0A504YB46_FASGI/1546-1683  AC A0A504YB46.1
#=GS A0A2Y9Q0Z6_DELLE/1370-1511  AC A0A2Y9Q0Z6.1
#=GS A0A4D9F8E4_9SAUR/854-995    AC A0A4D9F8E4.1
#=GS A0A446X4X3_TRITD/924-1058   AC A0A446X4X3.1
#=GS A0A0E0L8N4_ORYPU/921-972    AC A0A0E0L8N4.1
#=GS A0A6J3QQ50_TURTR/1412-1553  AC A0A6J3QQ50.1
#=GS A0A2Y9DK95_TRIMA/1376-1517  AC A0A2Y9DK95.1
#=GS A0A5F4VY63_CALJA/1388-1529  AC A0A5F4VY63.1
#=GS A0A3P7WDC4_RODNA/1302-1448  AC A0A3P7WDC4.1
#=GS A0A2K6SKI7_SAIBB/98-229     AC A0A2K6SKI7.1
#=GS F1LPP8_RAT/1208-1349        AC F1LPP8.3
#=GS A0A1D6NTS2_MAIZE/98-171     AC A0A1D6NTS2.1
#=GS D6X1V1_TRICA/1372-1514      AC D6X1V1.2
#=GS A0A1S4CTZ5_TOBAC/171-296    AC A0A1S4CTZ5.1
#=GS A0A0V1AEU4_9BILA/1361-1501  AC A0A0V1AEU4.1
#=GS A0A671ENL2_RHIFE/1436-1577  AC A0A671ENL2.1
#=GS F6PUX9_XENTR/1400-1541      AC F6PUX9.3
#=GS A0A4W6EF93_LATCA/1277-1418  AC A0A4W6EF93.1
#=GS A0A3P8S7Y8_AMPPE/1412-1553  AC A0A3P8S7Y8.1
#=GS A0A3Q1BY56_AMPOC/1412-1553  AC A0A3Q1BY56.1
#=GS A0A096N0D3_PAPAN/1380-1521  AC A0A096N0D3.2
#=GS A0A0D8XXQ0_DICVI/1311-1449  AC A0A0D8XXQ0.1
#=GS A0A669EXM6_ORENI/1308-1449  AC A0A669EXM6.1
#=GS A0A484D8R7_PERFV/1439-1580  AC A0A484D8R7.1
#=GS A0A668AW74_9TELE/1285-1426  AC A0A668AW74.1
#=GS A0A1S3HM47_LINUN/1439-1576  AC A0A1S3HM47.1
#=GS H2YQ34_CIOSA/1205-1346      AC H2YQ34.1
#=GS A0A452GJB6_9SAUR/1434-1575  AC A0A452GJB6.1
#=GS A0A1S3M2F1_SALSA/1388-1529  AC A0A1S3M2F1.1
#=GS A0A674A036_SALTR/1340-1481  AC A0A674A036.1
#=GS B9RNX6_RICCO/931-1067       AC B9RNX6.1
#=GS CHDM_DROME/1375-1516        AC O97159.2
#=GS G1LTR2_AILME/1361-1502      AC G1LTR2.1
#=GS A0A2K6RZP7_SAIBB/1119-1260  AC A0A2K6RZP7.1
#=GS A0A4W5RUE1_9TELE/1266-1407  AC A0A4W5RUE1.1
#=GS A0A3P9CPN4_9CICH/1308-1449  AC A0A3P9CPN4.1
#=GS A0A553PA58_TIGCA/1351-1492  AC A0A553PA58.1
#=GS A0A2K3LIN4_TRIPR/1-63       AC A0A2K3LIN4.1
#=GS A0A0V1LNA2_9BILA/1489-1632  AC A0A0V1LNA2.1
#=GS A0A0V0RT52_9BILA/1399-1539  AC A0A0V0RT52.1
#=GS A0A1S3M2E7_SALSA/1404-1545  AC A0A1S3M2E7.1
#=GS A0A671X5Z1_SPAAU/1289-1430  AC A0A671X5Z1.1
#=GS E1JI46_DROME/1375-1516      AC E1JI46.1
#=GS A0A1U8BUY8_MESAU/1410-1551  AC A0A1U8BUY8.1
#=GS A0A091NVX2_HALAL/1342-1483  AC A0A091NVX2.1
#=GS A0A4U5TUQ4_COLLU/1386-1527  AC A0A4U5TUQ4.1
#=GS A0A452QM02_URSAM/1264-1405  AC A0A452QM02.1
#=GS A0A091DNG6_FUKDA/1314-1455  AC A0A091DNG6.1
#=GS A0A2J7RCP9_9NEOP/1404-1546  AC A0A2J7RCP9.1
#=GS A0A4W5KND2_9TELE/1347-1488  AC A0A4W5KND2.1
#=GS G1QWK9_NOMLE/1463-1604      AC G1QWK9.3
#=GS F6ZS61_MACMU/1360-1501      AC F6ZS61.3
#=GS A0A671X3P0_SPAAU/1378-1519  AC A0A671X3P0.1
#=GS A0A2K5ZQK2_MANLE/1386-1527  AC A0A2K5ZQK2.1
#=GS A0A452HYR2_9SAUR/1089-1230  AC A0A452HYR2.1
#=GS A0A1S3EYQ9_DIPOR/1379-1520  AC A0A1S3EYQ9.1
#=GS A0A267FX06_9PLAT/1363-1501  AC A0A267FX06.1
#=GS A0A1P8AZP2_ARATH/936-1072   AC A0A1P8AZP2.1
#=GS A0A3Q1I9W0_ANATE/1440-1581  AC A0A3Q1I9W0.1
#=GS M4D4A7_BRARP/907-1042       AC M4D4A7.1
#=GS A0A2G9TG76_TELCI/1-93       AC A0A2G9TG76.1
#=GS A0A093N9C6_PYGAD/1389-1530  AC A0A093N9C6.1
#=GS A0A3P7M318_STRVU/1-93       AC A0A3P7M318.1
#=GS A0A2Y9DKT8_TRIMA/1376-1517  AC A0A2Y9DKT8.1
#=GS A0A672J000_SALFA/1338-1479  AC A0A672J000.1
#=GS A0A2I4H251_JUGRE/932-1068   AC A0A2I4H251.2
#=GS A0A3Q0D1I3_MESAU/1418-1559  AC A0A3Q0D1I3.1
#=GS A0A553MTG7_9TELE/1438-1562  AC A0A553MTG7.1
#=GS A0A087Y8E8_POEFO/1406-1547  AC A0A087Y8E8.2
#=GS A0A3P8WKB5_CYNSE/1272-1413  AC A0A3P8WKB5.1
#=GS A0A2Y9Q6H1_DELLE/1374-1515  AC A0A2Y9Q6H1.1
#=GS S9X619_CAMFR/1290-1431      AC S9X619.1
#=GS A0A673BB27_9TELE/1283-1423  AC A0A673BB27.1
#=GS A0A2Y9HFK1_NEOSC/1429-1570  AC A0A2Y9HFK1.1
#=GS A0A0V1PNF0_9BILA/1352-1492  AC A0A0V1PNF0.1
#=GS L9L0Y3_TUPCH/1376-1517      AC L9L0Y3.1
#=GS Q1LYP4_DANRE/1356-1497      AC Q1LYP4.1
#=GS A0A0E0PUC5_ORYRU/898-1032   AC A0A0E0PUC5.1
#=GS A0A5F8GBF1_MONDO/1291-1432  AC A0A5F8GBF1.1
#=GS M3W6N4_FELCA/1380-1521      AC M3W6N4.3
#=GS A0A1S4AIJ4_TOBAC/932-1068   AC A0A1S4AIJ4.1
#=GS A0A3B6SEA5_WHEAT/897-1031   AC A0A3B6SEA5.1
#=GS H3AAQ2_LATCH/1340-1481      AC H3AAQ2.2
#=GS V8P2A0_OPHHA/1042-1175      AC V8P2A0.1
#=GS A0A4W5QWS6_9TELE/1217-1358  AC A0A4W5QWS6.1
#=GS A0A158NPU9_ATTCE/1372-1513  AC A0A158NPU9.1
#=GS A0A4W5QWU8_9TELE/1229-1370  AC A0A4W5QWU8.1
#=GS A0A453QYJ1_AEGTS/1-56       AC A0A453QYJ1.1
#=GS A0A1S3U4Q0_VIGRR/934-1069   AC A0A1S3U4Q0.1
#=GS A0A1S3M2L8_SALSA/1404-1545  AC A0A1S3M2L8.1
#=GS A0A2Y9H483_NEOSC/1321-1462  AC A0A2Y9H483.1
#=GS A0A5F4DA12_CANLF/1371-1512  AC A0A5F4DA12.1
#=GS A0A5D2WK97_GOSMU/822-958    AC A0A5D2WK97.1
#=GS A0A2K6KY18_RHIBE/1387-1528  AC A0A2K6KY18.1
#=GS A0A2K5XUV0_MANLE/1361-1502  AC A0A2K5XUV0.1
#=GS A0A1D2M211_ORCCI/792-936    AC A0A1D2M211.1
#=GS U3J7E9_ANAPP/1324-1465      AC U3J7E9.2
#=GS A0A1J7HNH7_LUPAN/1032-1168  AC A0A1J7HNH7.1
#=GS A0A446X4R9_TRITD/911-1049   AC A0A446X4R9.1
#=GS A0A5J4NRE0_9TREM/1248-1297  AC A0A5J4NRE0.1
#=GS CHD4_HUMAN/1380-1521        AC Q14839.2
#=GS A0A1V4KNJ8_PATFA/1361-1502  AC A0A1V4KNJ8.1
#=GS A0A1S3WHZ9_ERIEU/1379-1520  AC A0A1S3WHZ9.1
#=GS A0A671XB40_SPAAU/1251-1392  AC A0A671XB40.1
#=GS A0A2K5YLG5_MANLE/1377-1508  AC A0A2K5YLG5.1
#=GS A0A162AKM5_DAUCS/919-1052   AC A0A162AKM5.1
#=GS A0A2H5NW10_CITUN/992-1119   AC A0A2H5NW10.1
#=GS A0A4S2LUZ4_OPIFE/1424-1554  AC A0A4S2LUZ4.1
#=GS A0A4W4ERW3_ELEEL/1394-1535  AC A0A4W4ERW3.1
#=GS A0A5D2YG97_GOSMU/934-1070   AC A0A5D2YG97.1
#=GS U3JPY8_FICAL/212-354        AC U3JPY8.1
#=GS A0A194Q834_PAPXU/1379-1520  AC A0A194Q834.1
#=GS A0A452GSC5_9SAUR/1285-1426  AC A0A452GSC5.1
#=GS A0A673TQK9_SURSU/1371-1507  AC A0A673TQK9.1
#=GS A0A287D8N5_ICTTR/1464-1605  AC A0A287D8N5.1
#=GS K7IT58_NASVI/1362-1503      AC K7IT58.1
#=GS A0A2R8Y4X2_HUMAN/730-871    AC A0A2R8Y4X2.1
#=GS H9J096_BOMMO/1382-1523      AC H9J096.1
#=GS A0A671WLW7_SPAAU/1258-1399  AC A0A671WLW7.1
#=GS A0A3L8SAN2_CHLGU/1379-1520  AC A0A3L8SAN2.1
#=GS A0A672J382_SALFA/1254-1395  AC A0A672J382.1
#=GS PKL_ARATH/919-1055          AC Q9S775.1
#=GS A0A2K5JI01_COLAP/1376-1517  AC A0A2K5JI01.1
#=GS A0A2H5NW14_CITUN/964-1091   AC A0A2H5NW14.1
#=GS A0A6I8SD55_XENTR/1230-1371  AC A0A6I8SD55.1
#=GS A0A341AI93_NEOAA/1392-1533  AC A0A341AI93.1
#=GS A0A2H5NW09_CITUN/949-1076   AC A0A2H5NW09.1
#=GS X1XTS3_ACYPI/1377-1518      AC X1XTS3.1
#=GS A0A2K5XUI9_MANLE/1391-1532  AC A0A2K5XUI9.1
#=GS A0A0B0MBX0_GOSAR/926-1062   AC A0A0B0MBX0.1
#=GS A0A2K6AMQ5_MACNE/1376-1517  AC A0A2K6AMQ5.1
#=GS A0A667YAB6_9TELE/1251-1392  AC A0A667YAB6.1
#=GS G3Q6H2_GASAC/1303-1444      AC G3Q6H2.1
#=GS A0A4S8KFA9_MUSBA/1007-1100  AC A0A4S8KFA9.1
#=GS A0A667YY47_9TELE/1283-1420  AC A0A667YY47.1
#=GS A0A0N4XW50_NIPBR/1149-1244  AC A0A0N4XW50.2
#=GS A0A0V1AF14_9BILA/1392-1532  AC A0A0V1AF14.1
#=GS R0G107_9BRAS/919-1055       AC R0G107.1
#=GS A0A674M9Q9_TAKRU/1339-1480  AC A0A674M9Q9.1
#=GS A0A2Y9KV77_ENHLU/1380-1521  AC A0A2Y9KV77.1
#=GS A0A671Y5S2_SPAAU/1289-1430  AC A0A671Y5S2.1
#=GS A0A2K5NKH0_CERAT/1414-1558  AC A0A2K5NKH0.1
#=GS A0A452QM27_URSAM/1213-1354  AC A0A452QM27.1
#=GS A0A1U7YNN1_NICSY/932-1068   AC A0A1U7YNN1.1
#=GS A0A5N5MED0_9ROSI/1078-1215  AC A0A5N5MED0.1
#=GS A0A2K1IRI0_PHYPA/978-1113   AC A0A2K1IRI0.1
#=GS A0A6I8QB28_XENTR/1313-1454  AC A0A6I8QB28.1
#=GS A0A067QUX9_ZOONE/1442-1584  AC A0A067QUX9.1
#=GS A0A3P9P4Q4_POERE/1408-1549  AC A0A3P9P4Q4.1
#=GS A0A177B9S0_9BILA/1268-1406  AC A0A177B9S0.1
#=GS G3SLZ2_LOXAF/1333-1474      AC G3SLZ2.1
#=GS A0A553MTD7_9TELE/1421-1546  AC A0A553MTD7.1
#=GS A0A4W6CQT9_LATCA/1226-1367  AC A0A4W6CQT9.1
#=GS A0A672Z7U3_9TELE/1288-1428  AC A0A672Z7U3.1
#=GS A0A096MSK7_PAPAN/1380-1521  AC A0A096MSK7.2
#=GS A0A446Y4I2_TRITD/48-182     AC A0A446Y4I2.1
#=GS A0A444X676_ARAHY/930-1066   AC A0A444X676.1
#=GS A0A671YDS5_SPAAU/1216-1357  AC A0A671YDS5.1
#=GS A0A674AJL0_SALTR/1344-1485  AC A0A674AJL0.1
#=GS F7FEN0_CALJA/1376-1517      AC F7FEN0.2
#=GS A0A670KIA4_PODMU/1270-1411  AC A0A670KIA4.1
#=GS A0A5C6N0R3_9TELE/1370-1511  AC A0A5C6N0R3.1
#=GS A0A2Y9KW06_ENHLU/1380-1521  AC A0A2Y9KW06.1
#=GS A0A453QY55_AEGTS/330-464    AC A0A453QY55.1
#=GS A0A251VT42_HELAN/1015-1150  AC A0A251VT42.1
#=GS A0A2Y9HFF7_NEOSC/1429-1570  AC A0A2Y9HFF7.1
#=GS A0A452SHT5_URSAM/1346-1487  AC A0A452SHT5.1
#=GS A0A674F8T4_SALTR/1305-1444  AC A0A674F8T4.1
#=GS B1AR17_MOUSE/1428-1569      AC B1AR17.1
#=GS A0A1S3SDE3_SALSA/1449-1590  AC A0A1S3SDE3.1
#=GS A0A3Q0FR51_ALLSI/1109-1250  AC A0A3Q0FR51.1
#=GS A0A3Q7RZS4_VULVU/1367-1508  AC A0A3Q7RZS4.1
#=GS A0A2R8YFK9_HUMAN/1367-1508  AC A0A2R8YFK9.1
#=GS CHD4_MOUSE/1373-1514        AC Q6PDQ2.1
#=GS A0A2Y9RQJ1_TRIMA/1408-1549  AC A0A2Y9RQJ1.1
#=GS L5KI24_PTEAL/1322-1463      AC L5KI24.1
#=GS A0A669B4N2_ORENI/1266-1407  AC A0A669B4N2.1
#=GS E9FRV7_DAPPU/1469-1612      AC E9FRV7.1
#=GS A0A671WQE7_SPAAU/1184-1324  AC A0A671WQE7.1
#=GS A0A3Q1GYF9_9TELE/1285-1426  AC A0A3Q1GYF9.1
#=GS A0A3Q7Y4Q3_URSAR/1392-1533  AC A0A3Q7Y4Q3.1
#=GS A0A2K5J9S6_COLAP/1405-1546  AC A0A2K5J9S6.1
#=GS A0A5F8G391_MONDO/1200-1341  AC A0A5F8G391.1
#=GS A0A5E4BCY9_MARMO/1263-1404  AC A0A5E4BCY9.1
#=GS G3WQQ3_SARHA/1384-1525      AC G3WQQ3.1
#=GS A0A2K5UJV6_MACFA/1361-1492  AC A0A2K5UJV6.1
#=GS F6Z898_MACMU/1372-1513      AC F6Z898.3
#=GS A0A498MQR2_LABRO/1325-1466  AC A0A498MQR2.1
#=GS A0A4W6CPH6_LATCA/1178-1319  AC A0A4W6CPH6.1
#=GS A0A663FFL9_AQUCH/1330-1471  AC A0A663FFL9.1
#=GS A0A183KEJ5_9TREM/1440-1485  AC A0A183KEJ5.1
#=GS A0A2I2ZSH9_GORGO/1193-1348  AC A0A2I2ZSH9.1
#=GS I1H0C9_BRADI/926-1060       AC I1H0C9.1
#=GS A0A452I0D4_9SAUR/1089-1230  AC A0A452I0D4.1
#=GS A0A446X4S7_TRITD/924-1058   AC A0A446X4S7.1
#=GS A0A1D6NTN8_MAIZE/921-980    AC A0A1D6NTN8.1
#=GS A0A667YVP6_9TELE/1328-1469  AC A0A667YVP6.1
#=GS A0A2I4BVA3_9TELE/1404-1545  AC A0A2I4BVA3.1
#=GS A0A484BPM4_DRONA/1365-1506  AC A0A484BPM4.1
#=GS A0A674A3W0_SALTR/1359-1500  AC A0A674A3W0.1
#=GS A0A6G0UZQ6_9BILA/1308-1449  AC A0A6G0UZQ6.1
#=GS A0A4W5KM67_9TELE/1278-1419  AC A0A4W5KM67.1
#=GS A0A6G1CPF6_9ORYZ/925-1059   AC A0A6G1CPF6.1
#=GS A0A3Q0E473_CARSF/1376-1517  AC A0A3Q0E473.1
#=GS A0A401P5X9_SCYTO/1-58       AC A0A401P5X9.1
#=GS A0A2K6AMQ4_MACNE/98-230     AC A0A2K6AMQ4.1
#=GS A0A1S3P397_SALSA/1384-1525  AC A0A1S3P397.1
#=GS A0A3B6SCM7_WHEAT/939-1073   AC A0A3B6SCM7.1
#=GS Q7ZWN3_XENLA/1371-1512      AC Q7ZWN3.1
#=GS A0A3P8DVY1_9TREM/107-240    AC A0A3P8DVY1.1
#=GS A0A182E800_ONCOC/1278-1418  AC A0A182E800.1
#=GS A0A0D9WMM4_9ORYZ/867-1000   AC A0A0D9WMM4.1
#=GS A0A0V1D6T8_TRIBR/1341-1481  AC A0A0V1D6T8.1
#=GS A0A565C5M4_9BRAS/919-1055   AC A0A565C5M4.1
#=GS A0A2K6P1M5_RHIRO/98-253     AC A0A2K6P1M5.1
#=GS A0A452I1S5_9SAUR/1100-1241  AC A0A452I1S5.1
#=GS A0A183XA42_TRIRE/1-73       AC A0A183XA42.1
#=GS A0A3Q2WSK3_HAPBU/1264-1405  AC A0A3Q2WSK3.1
#=GS A0A2R9AVK1_PANPA/1190-1344  AC A0A2R9AVK1.1
#=GS A0A1D6NTS0_MAIZE/416-551    AC A0A1D6NTS0.1
#=GS A0A2K6E9M5_MACNE/1360-1482  AC A0A2K6E9M5.1
#=GS A0A2K5J9N4_COLAP/1350-1491  AC A0A2K5J9N4.1
#=GS A0A1S3PYT4_SALSA/1385-1526  AC A0A1S3PYT4.1
#=GS A0A3P8S9H2_AMPPE/1290-1430  AC A0A3P8S9H2.1
#=GS A0A059B9T7_EUCGR/928-1064   AC A0A059B9T7.1
#=GS A0A2Y9KXU9_ENHLU/1379-1520  AC A0A2Y9KXU9.1
#=GS A0A341AE03_NEOAA/1373-1514  AC A0A341AE03.1
#=GS A0A0E0A5X8_9ORYZ/898-1032   AC A0A0E0A5X8.1
#=GS A0A3Q2VQR6_HAPBU/1307-1448  AC A0A3Q2VQR6.1
#=GS A0A315VLI9_GAMAF/1-58       AC A0A315VLI9.1
#=GS A0A0S3RC81_PHAAN/934-1070   AC A0A0S3RC81.1
#=GS A0A2U3Y2G8_LEPWE/1380-1521  AC A0A2U3Y2G8.1
#=GS A0A3Q0FF38_VIGRR/68-169     AC A0A3Q0FF38.1
#=GS A0A1S3PZ18_SALSA/1398-1539  AC A0A1S3PZ18.1
#=GS A0A4W6EJR9_LATCA/1266-1409  AC A0A4W6EJR9.1
#=GS A0A493T4M3_ANAPP/1-58       AC A0A493T4M3.1
#=GS A0A3P8X2L3_CYNSE/1294-1435  AC A0A3P8X2L3.1
#=GS A0A0V0UE67_9BILA/1435-1557  AC A0A0V0UE67.1
#=GS A0A669C7C1_ORENI/1240-1381  AC A0A669C7C1.1
#=GS A0A328E828_9ASTE/927-1063   AC A0A328E828.1
#=GS A0A2I3LYT0_PAPAN/1376-1517  AC A0A2I3LYT0.1
#=GS A0A1S3SDD5_SALSA/1456-1597  AC A0A1S3SDD5.1
#=GS A0A0K0FA57_STRVS/1244-1382  AC A0A0K0FA57.1
#=GS U3D6C1_CALJA/1380-1521      AC U3D6C1.1
#=GS A0A2G5EYU3_AQUCA/933-1072   AC A0A2G5EYU3.1
#=GS A0A446Y4M8_TRITD/939-1073   AC A0A446Y4M8.1
#=GS A0A4W6CQS4_LATCA/1187-1327  AC A0A4W6CQS4.1
#=GS A0A2Y9G0M9_TRIMA/1373-1514  AC A0A2Y9G0M9.1
#=GS A0A4W6CQ10_LATCA/1399-1540  AC A0A4W6CQ10.1
#=GS S7PV56_MYOBR/1380-1521      AC S7PV56.1
#=GS A0A4W4FUC2_ELEEL/1286-1427  AC A0A4W4FUC2.1
#=GS A0A251L5I2_MANES/932-1068   AC A0A251L5I2.1
#=GS A0A2A2LGJ7_9BILA/1361-1500  AC A0A2A2LGJ7.1
#=GS A0A3P9MWP5_POERE/1376-1517  AC A0A3P9MWP5.1
#=GS A0A663DVM3_AQUCH/1418-1559  AC A0A663DVM3.1
#=GS A0A383Z4Y6_BALAS/1380-1521  AC A0A383Z4Y6.1
#=GS A0A2U1MB79_ARTAN/613-749    AC A0A2U1MB79.1
#=GS A0A2B4SC18_STYPI/1340-1482  AC A0A2B4SC18.1
#=GS A0A2Y9L8Z9_ENHLU/1373-1514  AC A0A2Y9L8Z9.1
#=GS CHR7_ARATH/855-999          AC F4JTF6.1
#=GS D7LK56_ARALL/934-1070       AC D7LK56.1
#=GS G3P6X0_GASAC/858-999        AC G3P6X0.1
#=GS A0A5J5N435_MUNRE/1416-1557  AC A0A5J5N435.1
#=GS A0A3B6REH0_WHEAT/803-937    AC A0A3B6REH0.1
#=GS A0A3B6TEW7_WHEAT/897-1031   AC A0A3B6TEW7.1
#=GS A0A670KJ11_PODMU/1314-1455  AC A0A670KJ11.1
#=GS A0A3B3HAH2_ORYLA/1400-1541  AC A0A3B3HAH2.1
#=GS A0A4U5MQW9_STECR/230-369    AC A0A4U5MQW9.1
#=GS A0A3Q0CL12_MESAU/1403-1544  AC A0A3Q0CL12.1
#=GS A0A1S3SDF5_SALSA/1456-1597  AC A0A1S3SDF5.1
#=GS A0A2K6KY24_RHIBE/1280-1421  AC A0A2K6KY24.1
#=GS A0A1S3U4P7_VIGRR/978-1102   AC A0A1S3U4P7.1
#=GS A0A452I203_9SAUR/1124-1258  AC A0A452I203.1
#=GS A0A2I3LYY7_PAPAN/1405-1546  AC A0A2I3LYY7.1
#=GS A0A2K6FW42_PROCO/1370-1511  AC A0A2K6FW42.1
#=GS A0A1V4JAN5_PATFA/1345-1486  AC A0A1V4JAN5.1
#=GS A0A5D2S4I7_GOSMU/619-755    AC A0A5D2S4I7.1
#=GS A0A674AY52_SALTR/1395-1536  AC A0A674AY52.1
#=GS A0A0P7XDL3_SCLFO/1300-1441  AC A0A0P7XDL3.1
#=GS A0A3L8S385_CHLGU/1284-1425  AC A0A3L8S385.1
#=GS A0A087W0W9_ECHMU/1475-1630  AC A0A087W0W9.1
#=GS A0A4W5PFQ3_9TELE/1288-1429  AC A0A4W5PFQ3.1
#=GS H2N9B8_PONAB/1361-1502      AC H2N9B8.1
#=GS F1NH78_CHICK/1385-1526      AC F1NH78.4
#=GS A0A3Q1H9G7_9TELE/1251-1392  AC A0A3Q1H9G7.1
#=GS A0A3Q1M5B6_BOVIN/1251-1392  AC A0A3Q1M5B6.1
#=GS A0A4W5KQ24_9TELE/1271-1412  AC A0A4W5KQ24.1
#=GS A0A2U3WPL5_ODORO/1388-1529  AC A0A2U3WPL5.1
#=GS A0A2I0IGH7_PUNGR/37-173     AC A0A2I0IGH7.1
#=GS A0A6I8RW42_XENTR/1265-1406  AC A0A6I8RW42.1
#=GS A0A1S3LEW9_SALSA/1392-1533  AC A0A1S3LEW9.1
#=GS F6H3J1_VITVI/934-1070       AC F6H3J1.1
#=GS A0A674PEZ3_TAKRU/1274-1415  AC A0A674PEZ3.1
#=GS A0A091R1X4_MERNU/1380-1521  AC A0A091R1X4.1
#=GS A0A3Q0FG19_VIGRR/21-120     AC A0A3Q0FG19.1
#=GS A0A4W6FKL3_LATCA/1358-1499  AC A0A4W6FKL3.1
#=GS A0A0N4TMU4_BRUPA/1267-1407  AC A0A0N4TMU4.1
#=GS A0A1D6NTR2_MAIZE/921-1054   AC A0A1D6NTR2.1
#=GS A0A0V1HVZ3_9BILA/1348-1488  AC A0A0V1HVZ3.1
#=GS F7GDA8_MACMU/1385-1526      AC F7GDA8.3
#=GS A0A2K6RAQ3_RHIRO/1380-1521  AC A0A2K6RAQ3.1
#=GS A0A267FX29_9PLAT/1365-1503  AC A0A267FX29.1
#=GS A0A4D9A0Q7_SALSN/957-1084   AC A0A4D9A0Q7.1
#=GS Q7PZN7_ANOGA/1423-1564      AC Q7PZN7.4
#=GS A0A445K5Q0_GLYSO/931-1067   AC A0A445K5Q0.1
#=GS G5CAQ0_HETGA/1380-1521      AC G5CAQ0.1
#=GS A0A383Z562_BALAS/1379-1520  AC A0A383Z562.1
#=GS A0A1D6NTP4_MAIZE/921-998    AC A0A1D6NTP4.1
#=GS A0A2I4BGB9_9TELE/1379-1520  AC A0A2I4BGB9.1
#=GS J3MBV3_ORYBR/910-1043       AC J3MBV3.1
#=GS A0A6Q2X934_ESOLU/1233-1372  AC A0A6Q2X934.1
#=GS A0A452I1Q2_9SAUR/1095-1236  AC A0A452I1Q2.1
#=GS A0A445B4X1_ARAHY/930-1066   AC A0A445B4X1.1
#=GS A0A1D6NTN9_MAIZE/451-586    AC A0A1D6NTN9.1
#=GS A0A5N4C6W5_CAMDR/1397-1538  AC A0A5N4C6W5.1
#=GS A0A340YDI0_LIPVE/1380-1521  AC A0A340YDI0.1
#=GS A0A446Y4P9_TRITD/897-1031   AC A0A446Y4P9.1
#=GS A0A402EXN2_9SAUR/1127-1268  AC A0A402EXN2.1
#=GS A0A2Y9NDV6_DELLE/1408-1549  AC A0A2Y9NDV6.1
#=GS A0A673B577_9TELE/1341-1482  AC A0A673B577.1
#=GS A0A674PNF4_TAKRU/1365-1506  AC A0A674PNF4.1
#=GS A0A2K3LHR5_TRIPR/1-63       AC A0A2K3LHR5.1
#=GS A0A671VLM8_SPAAU/1260-1396  AC A0A671VLM8.1
#=GS A0A673BBN7_9TELE/1270-1411  AC A0A673BBN7.1
#=GS A0A0D2SYE7_GOSRA/737-873    AC A0A0D2SYE7.1
#=GS A0A556TUP2_BAGYA/727-832    AC A0A556TUP2.1
#=GS A0A2K6R2Q7_RHIRO/1388-1529  AC A0A2K6R2Q7.1
#=GS A0A074ZFV1_9TREM/1434-1567  AC A0A074ZFV1.1
#=GS A0A151N473_ALLMI/1307-1448  AC A0A151N473.1
#=GS A0A2K3DHS8_CHLRE/1451-1581  AC A0A2K3DHS8.1
#=GS A0A2K5QE90_CEBCA/1376-1517  AC A0A2K5QE90.1
#=GS A0A663FFZ8_AQUCH/1173-1314  AC A0A663FFZ8.1
#=GS A0A2K5BUP0_AOTNA/1395-1536  AC A0A2K5BUP0.1
#=GS A0A3Q0DIN9_CARSF/1355-1496  AC A0A3Q0DIN9.1
#=GS A0A4W6CQ13_LATCA/1343-1484  AC A0A4W6CQ13.1
#=GS G3X2W6_SARHA/1333-1428      AC G3X2W6.1
#=GS V3ZCR7_LOTGI/90-230         AC V3ZCR7.1
#=GS A0A195DSZ7_9HYME/1370-1517  AC A0A195DSZ7.1
#=GS A0A6Q2XZJ2_ESOLU/1290-1431  AC A0A6Q2XZJ2.1
#=GS A0A2R8QAE3_DANRE/1268-1409  AC A0A2R8QAE3.1
#=GS B4IIS0_DROSE/1314-1455      AC B4IIS0.1
#=GS A0A2R8YDW2_HUMAN/666-807    AC A0A2R8YDW2.1
#=GS A0A445K5R6_GLYSO/931-1067   AC A0A445K5R6.1
#=GS A0A452EPT7_CAPHI/1389-1530  AC A0A452EPT7.1
#=GS B9HAU9_POPTR/935-1071       AC B9HAU9.2
#=GS A0A267GNS5_9PLAT/1385-1523  AC A0A267GNS5.1
#=GS A0A0N5CYV6_THECL/1328-1467  AC A0A0N5CYV6.2
#=GS A0A674GIC0_TAEGU/1305-1446  AC A0A674GIC0.1
#=GS M4E5C0_BRARP/392-443        AC M4E5C0.1
#=GS A0A667YYH2_9TELE/1263-1404  AC A0A667YYH2.1
#=GS A0A3Q2GAE9_CYPVA/1225-1366  AC A0A3Q2GAE9.1
#=GS A0A1S3M318_SALSA/1400-1541  AC A0A1S3M318.1
#=GS A0A096NH31_PAPAN/1388-1529  AC A0A096NH31.2
#=GS G1MR33_MELGA/1390-1531      AC G1MR33.2
#=GS T1I428_RHOPR/1203-1345      AC T1I428.1
#=GS A0A672GYT3_SALFA/1307-1448  AC A0A672GYT3.1
#=GS A0A452CMC2_BALAS/1208-1349  AC A0A452CMC2.1
#=GS A0A3Q0FG58_VIGRR/48-149     AC A0A3Q0FG58.1
#=GS Q59E34_DROME/1376-1517      AC Q59E34.1
#=GS A0A2Y9K9E9_ENHLU/1388-1529  AC A0A2Y9K9E9.1
#=GS A0A452SBM2_URSAM/1355-1496  AC A0A452SBM2.1
#=GS A0A6I8PUL7_XENTR/1210-1347  AC A0A6I8PUL7.1
#=GS A0A093P2K7_PYGAD/1270-1411  AC A0A093P2K7.1
#=GS A0A672HK41_SALFA/1230-1371  AC A0A672HK41.1
#=GS L8INA7_9CETA/1343-1484      AC L8INA7.1
#=GS A0A218U8V8_9PASE/1298-1356  AC A0A218U8V8.1
#=GS A0A452GSK1_9SAUR/1242-1383  AC A0A452GSK1.1
#=GS U3JQC8_FICAL/1373-1514      AC U3JQC8.1
#=GS A0A2A2LJ70_9BILA/1253-1392  AC A0A2A2LJ70.1
#=GS A0A5F8GMB2_MONDO/1249-1389  AC A0A5F8GMB2.1
#=GS F7C307_MACMU/1388-1529      AC F7C307.3
#=GS A0A5F8GX17_MONDO/1279-1420  AC A0A5F8GX17.1
#=GS A0A6I8QIQ0_XENTR/1228-1369  AC A0A6I8QIQ0.1
#=GS H2YQ31_CIOSA/1111-1252      AC H2YQ31.1
#=GS A0A392SBP0_9FABA/1-26       AC A0A392SBP0.1
#=GS A0A383Z4Z4_BALAS/1367-1508  AC A0A383Z4Z4.1
#=GS F7E9J1_CALJA/1432-1573      AC F7E9J1.2
#=GS A0A4W5NBC1_9TELE/1197-1300  AC A0A4W5NBC1.1
#=GS A0A452EP92_CAPHI/1389-1530  AC A0A452EP92.1
#=GS A0A2K5EJZ4_AOTNA/1267-1408  AC A0A2K5EJZ4.1
#=GS A0A668AR85_9TELE/1349-1490  AC A0A668AR85.1
#=GS A0A1S3PZ08_SALSA/1395-1536  AC A0A1S3PZ08.1
#=GS A0A2I3MAB0_PAPAN/1434-1566  AC A0A2I3MAB0.1
#=GS E1ZCW7_CHLVA/1145-1276      AC E1ZCW7.1
#=GS A0A673BLI8_9TELE/1235-1376  AC A0A673BLI8.1
#=GS A0A2Y9Q6P5_DELLE/1374-1515  AC A0A2Y9Q6P5.1
#=GS A0A2G3C7W9_CAPCH/927-1063   AC A0A2G3C7W9.1
#=GS A0A2I2USQ8_FELCA/1435-1576  AC A0A2I2USQ8.2
#=GS E9PU01_RAT/1373-1514        AC E9PU01.3
#=GS A0A1V4KNJ7_PATFA/1324-1465  AC A0A1V4KNJ7.1
#=GS A0A3Q1CAU4_AMPOC/1389-1530  AC A0A3Q1CAU4.1
#=GS A0A553MTF5_9TELE/1387-1512  AC A0A553MTF5.1
#=GS A0A2K6L7F5_RHIBE/1202-1357  AC A0A2K6L7F5.1
#=GS A0A663FDX3_AQUCH/1194-1335  AC A0A663FDX3.1
#=GS A0A4W5RZH5_9TELE/1169-1310  AC A0A4W5RZH5.1
#=GS A0A670KE01_PODMU/1292-1428  AC A0A670KE01.1
#=GS L5LPT8_MYODS/1-58           AC L5LPT8.1
#=GS F6Z8B5_MACMU/1357-1483      AC F6Z8B5.3
#=GS A0A183NDC4_9TREM/1425-1470  AC A0A183NDC4.1
#=GS A0A6J3QR94_TURTR/1434-1575  AC A0A6J3QR94.1
#=GS G3SAS1_GORGO/1376-1517      AC G3SAS1.2
#=GS A0A0Q3M673_AMAAE/1380-1520  AC A0A0Q3M673.1
#=GS A0A668AIJ7_9TELE/1273-1414  AC A0A668AIJ7.1
#=GS A0A4W5PD16_9TELE/1303-1444  AC A0A4W5PD16.1
#=GS H3CEN6_TETNG/1303-1417      AC H3CEN6.1
#=GS A0A0D2LUC9_GOSRA/934-1070   AC A0A0D2LUC9.1
#=GS A0A665T7F3_ECHNA/1375-1516  AC A0A665T7F3.1
#=GS A0A5N6R831_9ROSI/935-1071   AC A0A5N6R831.1
#=GS A0A067FJF2_CITSI/934-1070   AC A0A067FJF2.1
#=GS A0A5F8ATJ0_MACMU/1208-1349  AC A0A5F8ATJ0.1
#=GS A0A2R6XKK9_MARPO/967-1103   AC A0A2R6XKK9.1
#=GS F7AE12_XENTR/1328-1469      AC F7AE12.3
#=GS A0A3B5QWN8_XIPMA/1367-1508  AC A0A3B5QWN8.1
#=GS A0A218VD67_9PASE/1373-1514  AC A0A218VD67.1
#=GS A0A3B6TAS8_WHEAT/924-1058   AC A0A3B6TAS8.1
#=GS A0A665XDR4_ECHNA/1349-1490  AC A0A665XDR4.1
#=GS G3Q4D3_GASAC/1400-1541      AC G3Q4D3.1
#=GS A0A485ME29_LYNPA/1359-1500  AC A0A485ME29.1
#=GS H3D637_TETNG/1333-1476      AC H3D637.1
#=GS A0A670J335_PODMU/1243-1384  AC A0A670J335.1
#=GS A0A670KFB6_PODMU/1302-1443  AC A0A670KFB6.1
#=GS A0A453QY94_AEGTS/231-365    AC A0A453QY94.1
#=GS A0A673BAP2_9TELE/1248-1385  AC A0A673BAP2.1
#=GS A0A654H8Y8_9CEST/1614-1736  AC A0A654H8Y8.1
#=GS A0A2K5S0B7_CEBCA/1435-1576  AC A0A2K5S0B7.1
#=GS A0A084W4H4_ANOSI/1453-1594  AC A0A084W4H4.1
#=GS A0A1S3E5S4_CICAR/929-1066   AC A0A1S3E5S4.1
#=GS A0A3Q0E7Q2_CARSF/1376-1517  AC A0A3Q0E7Q2.1
#=GS A0A671YAJ9_SPAAU/1230-1371  AC A0A671YAJ9.1
#=GS A0A671VL87_SPAAU/1164-1305  AC A0A671VL87.1
#=GS A0A2K6P1L5_RHIRO/1338-1493  AC A0A2K6P1L5.1
#=GS A0A673BBP2_9TELE/1270-1408  AC A0A673BBP2.1
#=GS A0A674HKR6_TAEGU/1311-1452  AC A0A674HKR6.1
#=GS A0A674DLG3_SALTR/1180-1321  AC A0A674DLG3.1
#=GS A0A674DHW1_SALTR/1330-1471  AC A0A674DHW1.1
#=GS A0A665T8L8_ECHNA/1268-1409  AC A0A665T8L8.1
#=GS A0A671X5U6_SPAAU/1282-1423  AC A0A671X5U6.1
#=GS A0A3P9AUL2_9CICH/1250-1391  AC A0A3P9AUL2.1
#=GS A0A4W4EMC9_ELEEL/1344-1485  AC A0A4W4EMC9.1
#=GS A0A4W6CQN7_LATCA/1304-1445  AC A0A4W6CQN7.1
#=GS A0A2Y9Q6P0_DELLE/1374-1515  AC A0A2Y9Q6P0.1
#=GS A0A674PPM4_TAKRU/1369-1510  AC A0A674PPM4.1
#=GS A0A383YTR4_BALAS/1047-1188  AC A0A383YTR4.1
#=GS A0A5E4MP38_9HEMI/1381-1522  AC A0A5E4MP38.1
#=GS H2SZ78_TAKRU/1401-1542      AC H2SZ78.3
#=GS A0A2V0NYX9_9CHLO/1306-1452  AC A0A2V0NYX9.1
#=GS A0A2G5EYW9_AQUCA/933-1072   AC A0A2G5EYW9.1
#=GS A0A2I3M2M5_PAPAN/1411-1542  AC A0A2I3M2M5.1
#=GS A0A452EPR9_CAPHI/1388-1529  AC A0A452EPR9.1
#=GS A0A5N4D2A6_CAMDR/1355-1496  AC A0A5N4D2A6.1
#=GS K1RRH1_CRAGI/1327-1468      AC K1RRH1.1
#=GS A0A6I8QK83_XENTR/1197-1338  AC A0A6I8QK83.1
#=GS A0A1S3JBC8_LINUN/1405-1547  AC A0A1S3JBC8.1
#=GS A0A1S3U4M3_VIGRR/977-1101   AC A0A1S3U4M3.1
#=GS A0A0V0RT37_9BILA/1399-1539  AC A0A0V0RT37.1
#=GS A0A1D6NTP5_MAIZE/924-1059   AC A0A1D6NTP5.1
#=GS A0A5F8G5C1_MONDO/1341-1482  AC A0A5F8G5C1.1
#=GS A0A091G5S6_9AVES/1294-1435  AC A0A091G5S6.1
#=GS A0A315VLI6_GAMAF/1463-1555  AC A0A315VLI6.1
#=GS A0A430QHZ4_SCHBO/1449-1582  AC A0A430QHZ4.1
#=GS A0A2K6FJ22_PROCO/1367-1508  AC A0A2K6FJ22.1
#=GS A0A674AY76_SALTR/1321-1462  AC A0A674AY76.1
#=GS A0A3Q1H2B6_ANATE/1167-1308  AC A0A3Q1H2B6.1
#=GS A0A2K6KY55_RHIBE/1280-1421  AC A0A2K6KY55.1
#=GS A0A493TQL1_ANAPP/429-476    AC A0A493TQL1.1
#=GS A0A674AZ12_SALTR/1295-1436  AC A0A674AZ12.1
#=GS A0A139WC28_TRICA/1375-1517  AC A0A139WC28.1
#=GS A0A0A0L332_CUCSA/932-1068   AC A0A0A0L332.1
#=GS A0A674F8M3_SALTR/1289-1430  AC A0A674F8M3.1
#=GS A0A1S3PYT6_SALSA/1386-1527  AC A0A1S3PYT6.1
#=GS A0A1R3J7B5_9ROSI/1-50       AC A0A1R3J7B5.1
#=GS A0A0K9NTM9_ZOSMR/938-1074   AC A0A0K9NTM9.1
#=GS A0A1S3PYS6_SALSA/1394-1535  AC A0A1S3PYS6.1
#=GS A0A3L6S0I0_PANMI/895-1031   AC A0A3L6S0I0.1
#=GS A0A6Q2XGF3_ESOLU/1207-1344  AC A0A6Q2XGF3.1
#=GS W5LL44_ASTMX/1306-1447      AC W5LL44.2
#=GS A0A674DL88_SALTR/1299-1440  AC A0A674DL88.1
#=GS A0A2I4BUT3_9TELE/1368-1509  AC A0A2I4BUT3.1
#=GS A0A1S3WBR6_ERIEU/1214-1355  AC A0A1S3WBR6.1
#=GS A0A5B7FN30_PORTR/15-102     AC A0A5B7FN30.1
#=GS A0A485MDU5_LYNPA/1136-1277  AC A0A485MDU5.1
#=GS A0A2R8Q004_DANRE/98-245     AC A0A2R8Q004.1
#=GS B4IXP0_DROGR/1373-1514      AC B4IXP0.1
#=GS A0A2I0U4B3_LIMLA/1227-1367  AC A0A2I0U4B3.1
#=GS A0A0B0P6N8_GOSAR/896-979    AC A0A0B0P6N8.1
#=GS A0A2R6XKD5_MARPO/967-1103   AC A0A2R6XKD5.1
#=GS A0A2I4CIX3_9TELE/1406-1547  AC A0A2I4CIX3.1
#=GS A0A3Q2DNZ2_CYPVA/1348-1489  AC A0A3Q2DNZ2.1
#=GS A0A4W6FN43_LATCA/1229-1370  AC A0A4W6FN43.1
#=GS A0A4W4EM30_ELEEL/1339-1480  AC A0A4W4EM30.1
#=GS F6Z8A7_MACMU/1371-1512      AC F6Z8A7.3
#=GS A0A1U8BU95_MESAU/1402-1543  AC A0A1U8BU95.1
#=GS A0A0N4UAR8_DRAME/1095-1235  AC A0A0N4UAR8.1
#=GS A0A665WLM7_ECHNA/1201-1342  AC A0A665WLM7.1
#=GS A0A674NWE1_TAKRU/1339-1480  AC A0A674NWE1.1
#=GS T1K2L0_TETUR/1158-1299      AC T1K2L0.1
#=GS A0A671V9W4_SPAAU/1219-1360  AC A0A671V9W4.1
#=GS A0A3L6PHK5_PANMI/856-992    AC A0A3L6PHK5.1
#=GS A0A2R8Y5M9_HUMAN/225-366    AC A0A2R8Y5M9.1
#=GS A0A1S3M2K6_SALSA/1404-1545  AC A0A1S3M2K6.1
#=GS A0A1A6GGU2_NEOLE/1332-1473  AC A0A1A6GGU2.1
#=GS A0A3P8TRH4_AMPPE/1265-1406  AC A0A3P8TRH4.1
#=GS A0A4P1REP7_LUPAN/947-1014   AC A0A4P1REP7.1
#=GS A0A667YQ95_9TELE/1355-1496  AC A0A667YQ95.1
#=GS A0A1S3U4S4_VIGRR/934-1070   AC A0A1S3U4S4.1
#=GS M3YBT4_MUSPF/1082-1223      AC M3YBT4.1
#=GS A0A3P9AXA2_9CICH/1376-1517  AC A0A3P9AXA2.1
#=GS M3YZJ4_MUSPF/1380-1521      AC M3YZJ4.1
#=GS A0A452SAY2_URSAM/1370-1511  AC A0A452SAY2.1
#=GS A0A446Y4D9_TRITD/865-999    AC A0A446Y4D9.1
#=GS A0A673UG63_SURSU/1380-1521  AC A0A673UG63.1
#=GS A0A1S3ACD9_ERIEU/1388-1529  AC A0A1S3ACD9.1
#=GS A0A4W5PJY3_9TELE/1314-1455  AC A0A4W5PJY3.1
#=GS A0A446Y4A6_TRITD/901-1035   AC A0A446Y4A6.1
#=GS A0A286ZJ13_PIG/1414-1555    AC A0A286ZJ13.1
#=GS J9NW81_CANLF/1350-1491      AC J9NW81.2
#=GS A0A6Q2XVB4_ESOLU/1176-1316  AC A0A6Q2XVB4.1
#=GS A0A4W5NYP1_9TELE/1401-1542  AC A0A4W5NYP1.1
#=GS A0A452SBK9_URSAM/1287-1428  AC A0A452SBK9.1
#=GS A0A5F8ASA7_MACMU/1344-1485  AC A0A5F8ASA7.1
#=GS J9NRN3_CANLF/1371-1512      AC J9NRN3.2
#=GS A0A674P0A6_TAKRU/1356-1497  AC A0A674P0A6.1
#=GS A0A665WHB2_ECHNA/1223-1364  AC A0A665WHB2.1
#=GS A0A2R2MRS4_LINUN/996-1138   AC A0A2R2MRS4.1
#=GS M3W5P4_FELCA/1386-1527      AC M3W5P4.3
#=GS A0A2G2WKS5_CAPBA/179-315    AC A0A2G2WKS5.1
#=GS A0A667Y4Y1_9TELE/1181-1322  AC A0A667Y4Y1.1
#=GS A0A5F8H404_MONDO/1281-1422  AC A0A5F8H404.1
#=GS A0A674F838_SALTR/1288-1426  AC A0A674F838.1
#=GS A0A369RVZ2_9METZ/1180-1320  AC A0A369RVZ2.1
#=GS A0A067FMV6_CITSI/934-1070   AC A0A067FMV6.1
#=GS M4AA75_XIPMA/1266-1407      AC M4AA75.2
#=GS T1JDG0_STRMM/1346-1490      AC T1JDG0.1
#=GS A0A654GYQ6_9CEST/1504-1640  AC A0A654GYQ6.1
#=GS A0A3N7G5U0_POPTR/828-964    AC A0A3N7G5U0.1
#=GS A0A1S3N801_SALSA/1443-1584  AC A0A1S3N801.1
#=GS A0A3Q1C616_AMPOC/1276-1417  AC A0A3Q1C616.1
#=GS A0A445KWD6_GLYSO/1044-1180  AC A0A445KWD6.1
#=GS A0A5F5Y6P1_FELCA/1349-1490  AC A0A5F5Y6P1.1
#=GS A0A2G9UW43_TELCI/741-878    AC A0A2G9UW43.1
#=GS A0A182GTX9_AEDAL/3048-3189  AC A0A182GTX9.1
#=GS A0A093G9I8_DRYPU/1278-1413  AC A0A093G9I8.1
#=GS A0A670KIP2_PODMU/1259-1399  AC A0A670KIP2.1
#=GS A0A0D9RDH2_CHLSB/1380-1521  AC A0A0D9RDH2.1
#=GS A0A5F8G7P5_MONDO/1194-1335  AC A0A5F8G7P5.1
#=GS A0A059BA43_EUCGR/932-1068   AC A0A059BA43.1
#=GS A0A3S2MU28_ORYJA/1372-1513  AC A0A3S2MU28.1
#=GS A0A0V0RT45_9BILA/1505-1586  AC A0A0V0RT45.1
#=GS A0A183TE50_SCHSO/178-315    AC A0A183TE50.1
#=GS A0A446X4V2_TRITD/924-1058   AC A0A446X4V2.1
#=GS A0A446Y488_TRITD/820-954    AC A0A446Y488.1
#=GS A0A3Q7XPF0_URSAR/1435-1576  AC A0A3Q7XPF0.1
#=GS A0A674N2G8_TAKRU/1389-1530  AC A0A674N2G8.1
#=GS I3JS39_ORENI/1232-1373      AC I3JS39.2
#=GS A0A091I8R0_CALAN/1380-1521  AC A0A091I8R0.1
#=GS K7HE50_CAEJA/447-587        AC K7HE50.1
#=GS A0A674DK65_SALTR/1299-1440  AC A0A674DK65.1
#=GS A0A670JXP3_PODMU/1343-1484  AC A0A670JXP3.1
#=GS A0A2K6MIY2_RHIBE/1380-1521  AC A0A2K6MIY2.1
#=GS A0A540MHA8_MALBA/953-1044   AC A0A540MHA8.1
#=GS A0A3B6REL2_WHEAT/924-1019   AC A0A3B6REL2.1
#=GS A0A2U3Y2E4_LEPWE/1373-1514  AC A0A2U3Y2E4.1
#=GS A0A669DV73_ORENI/1319-1460  AC A0A669DV73.1
#=GS A0A2K5EK28_AOTNA/1187-1328  AC A0A2K5EK28.1
#=GS A0A6A2Z7C0_HIBSY/117-192    AC A0A6A2Z7C0.1
#=GS A0A3Q0GQV0_ALLSI/1316-1457  AC A0A3Q0GQV0.1
#=GS D7MAU0_ARALL/861-1004       AC D7MAU0.1
#=GS A0A4W3I3V7_CALMI/909-1049   AC A0A4W3I3V7.1
#=GS A0A1S3N1D8_SALSA/1395-1536  AC A0A1S3N1D8.1
#=GS A0A2A2LGY6_9BILA/1155-1294  AC A0A2A2LGY6.1
#=GS A0A3Q0FF12_VIGRR/68-169     AC A0A3Q0FF12.1
#=GS E2AEH3_CAMFO/1372-1513      AC E2AEH3.1
#=GS A0A668AHZ6_9TELE/1310-1451  AC A0A668AHZ6.1
#=GS F6ZS77_MACMU/1380-1521      AC F6ZS77.3
#=GS A0A4W6EIC3_LATCA/1293-1434  AC A0A4W6EIC3.1
#=GS A0A2I0MLP4_COLLI/1373-1514  AC A0A2I0MLP4.1
#=GS A0A2G5EYW7_AQUCA/841-980    AC A0A2G5EYW7.1
#=GS A0A4U5MQH9_STECR/985-1124   AC A0A4U5MQH9.1
#=GS A0A2K6RZM2_SAIBB/1347-1488  AC A0A2K6RZM2.1
#=GS A0A3P8ZUB4_ESOLU/1289-1413  AC A0A3P8ZUB4.2
#=GS A0A4W4EHT7_ELEEL/1361-1502  AC A0A4W4EHT7.1
#=GS A0A673ZW82_SALTR/1337-1478  AC A0A673ZW82.1
#=GS A0A2R8Y5J0_HUMAN/1360-1501  AC A0A2R8Y5J0.1
#=GS A0A1S3A1J3_ERIEU/1380-1521  AC A0A1S3A1J3.1
#=GS A0A3Q0CLH2_MESAU/1410-1551  AC A0A3Q0CLH2.1
#=GS A0A6A2XCY9_HIBSY/929-1065   AC A0A6A2XCY9.1
#=GS A0A2Y9RYS6_TRIMA/1367-1508  AC A0A2Y9RYS6.1
#=GS A0A2K5EJZ6_AOTNA/98-239     AC A0A2K5EJZ6.1
#=GS A0A455AQL8_PHYMC/1374-1515  AC A0A455AQL8.1
#=GS A0A3P8S9Q9_AMPPE/1388-1529  AC A0A3P8S9Q9.1
#=GS A0A2U3WWY2_ODORO/1380-1521  AC A0A2U3WWY2.1
#=GS A0A1S3N3V0_SALSA/495-636    AC A0A1S3N3V0.1
#=GS A0A3Q3GS44_KRYMA/1315-1368  AC A0A3Q3GS44.1
#=GS A0A1D6NTR1_MAIZE/921-1056   AC A0A1D6NTR1.1
#=GS A0A2U3TZM0_HUMAN/1367-1508  AC A0A2U3TZM0.1
#=GS E9QAS4_MOUSE/1360-1501      AC E9QAS4.1
#=GS F7C528_MOUSE/1335-1476      AC F7C528.1
#=GS A0A452HW37_9SAUR/1118-1252  AC A0A452HW37.1
#=GS A0A0V0WJD5_9BILA/1412-1552  AC A0A0V0WJD5.1
#=GS A0A195ATC9_9HYME/1362-1509  AC A0A195ATC9.1
#=GS A0A671WDD3_SPAAU/1383-1524  AC A0A671WDD3.1
#=GS A0A452SBM7_URSAM/1380-1521  AC A0A452SBM7.1
#=GS A0A662YRW5_ACIRT/1469-1562  AC A0A662YRW5.1
#=GS F7C337_MACMU/1388-1529      AC F7C337.3
#=GS F7ABK0_MONDO/1320-1461      AC F7ABK0.3
#=GS A0A4W4ELC4_ELEEL/1165-1301  AC A0A4W4ELC4.1
#=GS A0A1U7YBE1_NICSY/937-1073   AC A0A1U7YBE1.1
#=GS A0A3Q7TIQ1_VULVU/1375-1516  AC A0A3Q7TIQ1.1
#=GS A0A446Y4P1_TRITD/924-1019   AC A0A446Y4P1.1
#=GS A0A484CPB5_PERFV/1383-1524  AC A0A484CPB5.1
#=GS A0A553MTF1_9TELE/1462-1586  AC A0A553MTF1.1
#=GS A0A2K6RAS1_RHIRO/1360-1501  AC A0A2K6RAS1.1
#=GS A0A2K3P0Y7_TRIPR/485-560    AC A0A2K3P0Y7.1
#=GS A0A2K6SKG0_SAIBB/1376-1517  AC A0A2K6SKG0.1
#=GS A0A2K5EJW2_AOTNA/1339-1480  AC A0A2K5EJW2.1
#=GS A0A2K3LUE4_TRIPR/1-63       AC A0A2K3LUE4.1
#=GS A0A3P9PHA6_POERE/1302-1443  AC A0A3P9PHA6.1
#=GS A0A3Q0FG83_VIGRR/20-121     AC A0A3Q0FG83.1
#=GS A0A3Q1GZQ0_ANATE/1410-1551  AC A0A3Q1GZQ0.1
#=GS A0A0V0UCF0_9BILA/1370-1510  AC A0A0V0UCF0.1
#=GS A0A087XUZ1_POEFO/1375-1516  AC A0A087XUZ1.2
#=GS A0A2I3HV10_NOMLE/1372-1513  AC A0A2I3HV10.1
#=GS L8Y5W7_TUPCH/1341-1482      AC L8Y5W7.1
#=GS A0A6A5BN55_NAEFO/940-1066   AC A0A6A5BN55.1
#=GS A0A668AJT6_9TELE/1154-1295  AC A0A668AJT6.1
#=GS I3K598_ORENI/1184-1325      AC I3K598.2
#=GS A0A2Y9SUZ3_PHYMC/1388-1529  AC A0A2Y9SUZ3.1
#=GS A0A4W3HKP4_CALMI/905-1045   AC A0A4W3HKP4.1
#=GS G1PPV0_MYOLU/1383-1524      AC G1PPV0.1
#=GS A0A3P8S7T9_AMPPE/1249-1390  AC A0A3P8S7T9.1
#=GS D8T4M1_SELML/912-1047       AC D8T4M1.1
#=GS A0A2P5ANE0_PARAD/963-1099   AC A0A2P5ANE0.1
#=GS A0A2G9HDW0_9LAMI/924-1046   AC A0A2G9HDW0.1
#=GS A0A2Y9Q106_DELLE/1368-1509  AC A0A2Y9Q106.1
#=GS D8S9B2_SELML/906-1043       AC D8S9B2.1
#=GS A0A151N497_ALLMI/1313-1454  AC A0A151N497.1
#=GS A0A553R279_9TELE/1329-1470  AC A0A553R279.1
#=GS A0A3Q3KRF2_9TELE/1239-1380  AC A0A3Q3KRF2.1
#=GS A0A3M6TWK6_9CNID/1304-1446  AC A0A3M6TWK6.1
#=GS A0A446Y4T0_TRITD/924-1058   AC A0A446Y4T0.1
#=GS A0A5K1UUG4_CALJA/1388-1529  AC A0A5K1UUG4.1
#=GS A0A2K6G6D1_PROCO/1343-1484  AC A0A2K6G6D1.1
#=GS W5JRF8_ANODA/1464-1605      AC W5JRF8.1
#=GS A0A3S4RLC0_9ACAR/1282-1422  AC A0A3S4RLC0.1
#=GS A0A1S3PYS4_SALSA/1397-1538  AC A0A1S3PYS4.1
#=GS A0A5A7PRP3_STRAF/949-1064   AC A0A5A7PRP3.1
#=GS A0A1A6GMS6_NEOLE/1167-1308  AC A0A1A6GMS6.1
#=GS A0A671VBN3_SPAAU/1292-1433  AC A0A671VBN3.1
#=GS A0A4W3HKP8_CALMI/923-1063   AC A0A4W3HKP8.1
#=GS I3K597_ORENI/1402-1543      AC I3K597.2
#=GS A0A446Y4V6_TRITD/924-1058   AC A0A446Y4V6.1
#=GS A0A1D2M9Q1_ORCCI/1248-1351  AC A0A1D2M9Q1.1
#=GS A0A3M0K2V2_HIRRU/1373-1514  AC A0A3M0K2V2.1
#=GS A0A2J6LJA7_LACSA/927-1063   AC A0A2J6LJA7.1
#=GS A0A2F0B1G8_ESCRO/1111-1252  AC A0A2F0B1G8.1
#=GS A0A6Q2Y678_ESOLU/1292-1433  AC A0A6Q2Y678.1
#=GS A0A2K6RZN2_SAIBB/1119-1260  AC A0A2K6RZN2.1
#=GS A0A2K6L7B8_RHIBE/98-253     AC A0A2K6L7B8.1
#=GS A0A669DFU8_ORENI/1303-1444  AC A0A669DFU8.1
#=GS F1RIM3_PIG/1414-1555        AC F1RIM3.4
#=GS A0A2K6E9K0_MACNE/1405-1527  AC A0A2K6E9K0.1
#=GS A0A553MTF2_9TELE/1442-1567  AC A0A553MTF2.1
#=GS F7EA07_CALJA/1376-1517      AC F7EA07.2
#=GS A0A2K5IMK0_COLAP/1398-1539  AC A0A2K5IMK0.1
#=GS A0A5F8A879_MACMU/1246-1387  AC A0A5F8A879.1
#=GS A0A091V734_OPIHO/1372-1513  AC A0A091V734.1
#=GS A0A4W6EJQ8_LATCA/1281-1422  AC A0A4W6EJQ8.1
#=GS A0A3P7YD55_9TREM/624-745    AC A0A3P7YD55.1
#=GS A0A2K6AMM4_MACNE/1414-1546  AC A0A2K6AMM4.1
#=GS A0A6J3S946_TURTR/1408-1549  AC A0A6J3S946.1
#=GS A0A3Q3B9Y4_KRYMA/1317-1458  AC A0A3Q3B9Y4.1
#=GS A0A3Q1M3Y2_BOVIN/1430-1571  AC A0A3Q1M3Y2.1
#=GS A0A0V1BE52_TRISP/1483-1564  AC A0A0V1BE52.1
#=GS K7FGR4_PELSI/1317-1458      AC K7FGR4.1
#=GS A0A315WB83_GAMAF/1301-1442  AC A0A315WB83.1
#=GS A0A446X4T9_TRITD/201-335    AC A0A446X4T9.1
#=GS A0A674F8T0_SALTR/1190-1331  AC A0A674F8T0.1
#=GS A0A670J280_PODMU/1233-1374  AC A0A670J280.1
#=GS S7Q3J5_MYOBR/1359-1500      AC S7Q3J5.1
#=GS A0A1S3M238_SALSA/1401-1542  AC A0A1S3M238.1
#=GS A0A1I7VLI1_LOALO/1287-1427  AC A0A1I7VLI1.1
#=GS A0A1D6NTP1_MAIZE/921-1056   AC A0A1D6NTP1.1
#=GS S9XJP7_CAMFR/1267-1408      AC S9XJP7.1
#=GS A0A0K0FKC5_STRVS/1234-1374  AC A0A0K0FKC5.1
#=GS A0A674EW60_SALTR/1260-1401  AC A0A674EW60.1
#=GS A0A4Z2DRH0_SCHJA/374-507    AC A0A4Z2DRH0.1
#=GS A0A2I4CIX8_9TELE/1406-1547  AC A0A2I4CIX8.1
#=GS A0A455AS62_PHYMC/1208-1349  AC A0A455AS62.1
#=GS A0A067FJE6_CITSI/934-1070   AC A0A067FJE6.1
#=GS A0A4W2E4D7_BOBOX/1434-1575  AC A0A4W2E4D7.1
#=GS A0A2K6E9P5_MACNE/1380-1502  AC A0A2K6E9P5.1
#=GS A0A2Y9PW81_DELLE/1374-1515  AC A0A2Y9PW81.1
#=GS A0A383YTT8_BALAS/1251-1392  AC A0A383YTT8.1
#=GS A0A6I8U977_AEDAE/1373-1514  AC A0A6I8U977.1
#=GS A0A0E0DXZ4_9ORYZ/860-994    AC A0A0E0DXZ4.1
#=GS A0A4U6UTT9_SETVI/918-1054   AC A0A4U6UTT9.1
#=GS A0A0D3GDJ7_9ORYZ/929-1063   AC A0A0D3GDJ7.1
#=GS A0A453QY66_AEGTS/662-796    AC A0A453QY66.1
#=GS A0A446X4X0_TRITD/939-1073   AC A0A446X4X0.1
#=GS A0A5F5XRZ3_FELCA/1386-1527  AC A0A5F5XRZ3.1
#=GS A0A672HFW7_SALFA/1257-1398  AC A0A672HFW7.1
#=GS A0A1S3LDZ2_SALSA/1363-1504  AC A0A1S3LDZ2.1
#=GS A0A3Q2EB83_CYPVA/1270-1411  AC A0A3Q2EB83.1
#=GS A0A6I8RFD2_XENTR/1346-1487  AC A0A6I8RFD2.1
#=GS A0A446Y4S6_TRITD/924-1058   AC A0A446Y4S6.1
#=GS A0A2G5TJP6_9PELO/1271-1411  AC A0A2G5TJP6.1
#=GS A0A672Z5V8_9TELE/1309-1450  AC A0A672Z5V8.1
#=GS A0A5F8HIE5_MONDO/1249-1379  AC A0A5F8HIE5.1
#=GS A0A093IQI4_EURHL/1343-1478  AC A0A093IQI4.1
#=GS A0A455AQV6_PHYMC/1208-1349  AC A0A455AQV6.1
#=GS G5B5E4_HETGA/1177-1318      AC G5B5E4.1
#=GS D3ZR50_RAT/1369-1510        AC D3ZR50.2
#=GS A0A6J3QQU3_TURTR/1430-1571  AC A0A6J3QQU3.1
#=GS A0A674MHJ0_TAKRU/1313-1454  AC A0A674MHJ0.1
#=GS A0A455AQV1_PHYMC/1374-1515  AC A0A455AQV1.1
#=GS B9IL39_POPTR/945-1081       AC B9IL39.3
#=GS A0A287BG95_PIG/1370-1511    AC A0A287BG95.2
#=GS A0A446Y4F8_TRITD/296-430    AC A0A446Y4F8.1
#=GS A0A3P8UYW4_CYNSE/1246-1387  AC A0A3P8UYW4.1
#=GS A0A0E0HLU3_ORYNI/929-1063   AC A0A0E0HLU3.1
#=GS A0A2Y9Q6N5_DELLE/1374-1515  AC A0A2Y9Q6N5.1
#=GS CHD3_HUMAN/1376-1517        AC Q12873.3
#=GS G3QEK0_GORGO/1361-1502      AC G3QEK0.2
#=GS A0A6J3QQ03_TURTR/1374-1515  AC A0A6J3QQ03.1
#=GS A0A484GVG3_SOUCH/1365-1506  AC A0A484GVG3.1
#=GS A0A673B639_9TELE/1353-1490  AC A0A673B639.1
#=GS A0A485MDE2_LYNPA/1380-1521  AC A0A485MDE2.1
#=GS A0A2K6SN05_SAIBB/1356-1497  AC A0A2K6SN05.1
#=GS A0A493T8G1_ANAPP/1162-1303  AC A0A493T8G1.1
#=GS A0A669B657_ORENI/1225-1356  AC A0A669B657.1
#=GS A0A3Q0F5Q5_VIGRR/1010-1145  AC A0A3Q0F5Q5.1
#=GS A0A6I8V0X0_DROPS/1390-1531  AC A0A6I8V0X0.1
#=GS A0A556TZ34_BAGYA/1479-1620  AC A0A556TZ34.1
#=GS A0A2R8Q555_DANRE/1129-1270  AC A0A2R8Q555.1
#=GS A0A3Q3CXU5_HAPBU/1411-1552  AC A0A3Q3CXU5.1
#=GS A0A6J3QQ08_TURTR/1434-1575  AC A0A6J3QQ08.1
#=GS A0A226MWH2_CALSU/1384-1525  AC A0A226MWH2.1
#=GS A0A673VB92_SURSU/1342-1483  AC A0A673VB92.1
#=GS A0A4W6FMU8_LATCA/1376-1517  AC A0A4W6FMU8.1
#=GS A0A087Y3P7_POEFO/1413-1554  AC A0A087Y3P7.2
#=GS A0A4W5NC09_9TELE/1210-1291  AC A0A4W5NC09.1
#=GS A0A392R9L6_9FABA/17-64      AC A0A392R9L6.1
#=GS A0A453QY62_AEGTS/622-675    AC A0A453QY62.1
#=GS W6UI63_ECHGR/1988-2143      AC W6UI63.1
#=GS A0A665WKU7_ECHNA/1189-1330  AC A0A665WKU7.1
#=GS A0A2R8Q3B4_DANRE/1269-1410  AC A0A2R8Q3B4.1
#=GS T1K2K7_TETUR/1158-1299      AC T1K2K7.1
#=GS F7CN25_HORSE/1376-1517      AC F7CN25.3
#=GS A0A0N7KLN2_ORYSJ/16-149     AC A0A0N7KLN2.1
#=GS A0A6Q2XWZ0_ESOLU/1289-1430  AC A0A6Q2XWZ0.1
#=GS A0A2K5EJN1_AOTNA/1396-1537  AC A0A2K5EJN1.1
#=GS A0A4W5KNF4_9TELE/1318-1459  AC A0A4W5KNF4.1
#=GS A0A3Q1BMQ4_AMPOC/1368-1509  AC A0A3Q1BMQ4.1
#=GS A0A669E3W9_ORENI/1232-1373  AC A0A669E3W9.1
#=GS A0A669CI53_ORENI/1367-1508  AC A0A669CI53.1
#=GS A0A0R3W3H5_TAEAS/1342-1483  AC A0A0R3W3H5.1
#=GS H2YQ36_CIOSA/1285-1426      AC H2YQ36.1
#=GS A0A667YBV2_9TELE/1197-1338  AC A0A667YBV2.1
#=GS A0A2Y9H9L0_NEOSC/1379-1520  AC A0A2Y9H9L0.1
#=GS G0MXJ8_CAEBE/1274-1414      AC G0MXJ8.1
#=GS A0A6J3S955_TURTR/1373-1514  AC A0A6J3S955.1
#=GS A0A4W4DYV5_ELEEL/1163-1304  AC A0A4W4DYV5.1
#=GS A0A1S3M265_SALSA/1401-1542  AC A0A1S3M265.1
#=GS A0A6A6L793_HEVBR/97-190     AC A0A6A6L793.1
#=GS F7ECA7_XENTR/1228-1369      AC F7ECA7.3
#=GS A0A669B1P2_ORENI/1237-1378  AC A0A669B1P2.1
#=GS A0A1S3M2L1_SALSA/1399-1540  AC A0A1S3M2L1.1
#=GS W5MC98_LEPOC/1349-1490      AC W5MC98.1
#=GS W5MC76_LEPOC/1343-1484      AC W5MC76.1
#=GS M4D4A6_BRARP/475-526        AC M4D4A6.1
#=GS L5KJ82_PTEAL/1282-1423      AC L5KJ82.1
#=GS A0A667YBQ4_9TELE/1117-1258  AC A0A667YBQ4.1
#=GS F1RBT2_DANRE/1392-1533      AC F1RBT2.1
#=GS A0A484DIL2_PERFV/1368-1509  AC A0A484DIL2.1
#=GS A0A2K6RZL6_SAIBB/1343-1484  AC A0A2K6RZL6.1
#=GS A0A446X4S0_TRITD/19-149     AC A0A446X4S0.1
#=GS A0A6I8VLD0_DROPS/1393-1534  AC A0A6I8VLD0.1
#=GS A0A482XD93_LAOST/1122-1261  AC A0A482XD93.1
#=GS A0A2P6R723_ROSCH/935-1071   AC A0A2P6R723.1
#=GS A0A3B6TM49_WHEAT/996-1130   AC A0A3B6TM49.1
#=GS A0A553QW80_9TELE/1383-1524  AC A0A553QW80.1
#=GS A0A498NJC5_LABRO/1295-1436  AC A0A498NJC5.1
#=GS A0A1P8AZP6_ARATH/945-1081   AC A0A1P8AZP6.1
#=GS A0A446X525_TRITD/924-1058   AC A0A446X525.1
#=GS A0A3Q3X3X3_MOLML/1257-1398  AC A0A3Q3X3X3.1
#=GS V4P3L5_EUTSA/897-1044       AC V4P3L5.1
#=GS A0A2Y9HAX2_NEOSC/1380-1521  AC A0A2Y9HAX2.1
#=GS A0A5F5Y6C7_FELCA/1326-1467  AC A0A5F5Y6C7.1
#=GS A0A5F8GL37_MONDO/1255-1395  AC A0A5F8GL37.1
#=GS A0A2Y9QU10_TRIMA/976-1117   AC A0A2Y9QU10.1
#=GS A0A3Q0FFY6_VIGRR/68-175     AC A0A3Q0FFY6.1
#=GS A0A4Z2DRI3_SCHJA/1444-1577  AC A0A4Z2DRI3.1
#=GS A0A1S3FSS6_DIPOR/1361-1502  AC A0A1S3FSS6.1
#=GS H2QZP6_PANTR/1360-1501      AC H2QZP6.2
#=GS A0A2K5EJT1_AOTNA/1267-1408  AC A0A2K5EJT1.1
#=GS A0A087ZSL5_APIME/1374-1515  AC A0A087ZSL5.1
#=GS A0A151N3K5_ALLMI/1262-1403  AC A0A151N3K5.1
#=GS A0A2R8YD40_HUMAN/952-1093   AC A0A2R8YD40.1
#=GS A0A2K5WE03_MACFA/1251-1392  AC A0A2K5WE03.1
#=GS A0A665T8L4_ECHNA/1235-1376  AC A0A665T8L4.1
#=GS A0A2I3GMQ6_NOMLE/1368-1509  AC A0A2I3GMQ6.1
#=GS A0A3Q3A414_KRYMA/1409-1550  AC A0A3Q3A414.1
#=GS A0A4W5NAR0_9TELE/1215-1269  AC A0A4W5NAR0.1
#=GS A0A3Q3KUZ2_9TELE/1185-1326  AC A0A3Q3KUZ2.1
#=GS A0A446X4V7_TRITD/924-1019   AC A0A446X4V7.1
#=GS A0A2Y9R5B4_TRIMA/1208-1349  AC A0A2Y9R5B4.1
#=GS A0A1V4JB80_PATFA/1346-1487  AC A0A1V4JB80.1
#=GS A0A1J7G7L8_LUPAN/942-1078   AC A0A1J7G7L8.1
#=GS A0A2I3SKD2_PANTR/1194-1348  AC A0A2I3SKD2.1
#=GS A0A2Y9EKA1_PHYMC/1379-1520  AC A0A2Y9EKA1.1
#=GS A0A6A4V8X1_AMPAM/1345-1484  AC A0A6A4V8X1.1
#=GS A0A6I8RL94_XENTR/1241-1382  AC A0A6I8RL94.1
#=GS A0A183MLS3_9TREM/1398-1519  AC A0A183MLS3.1
#=GS A0A5C6PJD3_9TELE/1397-1550  AC A0A5C6PJD3.1
#=GS A0A669E468_ORENI/1242-1383  AC A0A669E468.1
#=GS A0A091J953_EGRGA/1379-1520  AC A0A091J953.1
#=GS S8CHM5_9LAMI/1-43           AC S8CHM5.1
#=GS A0A5D2YJL4_GOSMU/934-987    AC A0A5D2YJL4.1
#=GS A0A1W0WSJ7_HYPDU/1461-1600  AC A0A1W0WSJ7.1
#=GS A0A4W6CQI6_LATCA/1309-1450  AC A0A4W6CQI6.1
#=GS A0A3Q7RWT7_VULVU/1373-1514  AC A0A3Q7RWT7.1
#=GS A0A452SAQ8_URSAM/1405-1546  AC A0A452SAQ8.1
#=GS A0A0R0JI09_SOYBN/931-1067   AC A0A0R0JI09.1
#=GS A0A341ADZ6_NEOAA/1404-1545  AC A0A341ADZ6.1
#=GS E9PYL1_MOUSE/1390-1531      AC E9PYL1.1
#=GS A0A643CGN7_BALPH/1297-1438  AC A0A643CGN7.1
#=GS A0A2I3TD11_PANTR/1414-1568  AC A0A2I3TD11.1
#=GS A0A453QYH6_AEGTS/924-1036   AC A0A453QYH6.1
#=GS E0W1M0_PEDHC/1354-1496      AC E0W1M0.1
#=GS A0A6A4JNE1_APOLU/1371-1512  AC A0A6A4JNE1.1
#=GS A0A5N5Q3H9_PANHP/1387-1528  AC A0A5N5Q3H9.1
#=GS A0A2K5ETE2_AOTNA/1361-1502  AC A0A2K5ETE2.1
#=GS A0A445K5H6_GLYSO/903-1039   AC A0A445K5H6.1
#=GS A0A2G5EYS2_AQUCA/933-1069   AC A0A2G5EYS2.1
#=GS G3Q4E4_GASAC/1256-1397      AC G3Q4E4.1
#=GS A0A094LDR4_PODCR/1026-1167  AC A0A094LDR4.1
#=GS A0A2Y9KW14_ENHLU/1367-1508  AC A0A2Y9KW14.1
#=GS A0A1S3N8L8_SALSA/1434-1575  AC A0A1S3N8L8.1
#=GS A0A2R8QGR4_DANRE/967-1108   AC A0A2R8QGR4.1
#=GS A0A5E4PXT3_9NEOP/1380-1521  AC A0A5E4PXT3.1
#=GS A0A1S4ARJ7_TOBAC/106-242    AC A0A1S4ARJ7.1
#=GS A0A341AGZ4_NEOAA/1380-1521  AC A0A341AGZ4.1
#=GS A0A286ZUW6_PIG/1203-1344    AC A0A286ZUW6.2
#=GS F1N3F6_BOVIN/1380-1521      AC F1N3F6.3
#=GS A0A3P8WS67_CYNSE/1268-1409  AC A0A3P8WS67.1
#=GS A0A1D6NTP9_MAIZE/744-879    AC A0A1D6NTP9.1
#=GS A0A673Y5N5_SALTR/1232-1373  AC A0A673Y5N5.1
#=GS A0A096M4P9_POEFO/1334-1475  AC A0A096M4P9.1
#=GS A0A1J1IA10_9DIPT/1337-1478  AC A0A1J1IA10.1
#=GS A0A6A6KGH1_HEVBR/867-1003   AC A0A6A6KGH1.1
#=GS A0A3B6REL7_WHEAT/901-1035   AC A0A3B6REL7.1
#=GS A0A2K5YLH4_MANLE/1376-1517  AC A0A2K5YLH4.1
#=GS A0A4U5V432_COLLU/1431-1572  AC A0A4U5V432.1
#=GS B3M8T6_DROAN/1367-1508      AC B3M8T6.2
#=GS A0A5N6P2F4_9ASTR/924-1060   AC A0A5N6P2F4.1
#=GS A0A1S3Q070_SALSA/1398-1539  AC A0A1S3Q070.1
#=GS A0A665WJ77_ECHNA/1161-1302  AC A0A665WJ77.1
#=GS A0A183EHB6_9BILA/1-90       AC A0A183EHB6.1
#=GS M4AJS6_XIPMA/1305-1446      AC M4AJS6.2
#=GS A0A5D2YJL4_GOSMU/981-1045   AC A0A5D2YJL4.1
#=GS A0A397Y2S8_BRACM/618-754    AC A0A397Y2S8.1
#=GS A0A1S3M325_SALSA/1391-1532  AC A0A1S3M325.1
#=GS A0A672HGK5_SALFA/1335-1476  AC A0A672HGK5.1
#=GS A0A096P2S7_PAPAN/1194-1325  AC A0A096P2S7.2
#=GS A0A6A3AFH6_HIBSY/897-1033   AC A0A6A3AFH6.1
#=GS CHD3_CAEEL/1279-1419        AC Q22516.2
#=GS A0A663FFK3_AQUCH/1353-1494  AC A0A663FFK3.1
#=GS A0A0V0WJU3_9BILA/1427-1567  AC A0A0V0WJU3.1
#=GS A0A6A5LC16_LUPAL/1008-1144  AC A0A6A5LC16.1
#=GS A0A4C1XSD1_EUMVA/1191-1332  AC A0A4C1XSD1.1
#=GS W5Q8X2_SHEEP/1336-1477      AC W5Q8X2.1
#=GS A0A671XAC7_SPAAU/1318-1459  AC A0A671XAC7.1
#=GS A0A667YD83_9TELE/1128-1269  AC A0A667YD83.1
#=GS A0A0D2UIB0_GOSRA/822-958    AC A0A0D2UIB0.1
#=GS A0A5N6MAN6_9ASTR/946-1081   AC A0A5N6MAN6.1
#=GS A0A452GSF4_9SAUR/1270-1411  AC A0A452GSF4.1
#=GS A8X9E2_CAEBR/1276-1416      AC A8X9E2.2
#=GS A0A5F4CH71_CANLF/1408-1549  AC A0A5F4CH71.1
#=GS F7B896_HORSE/1380-1521      AC F7B896.1
#=GS A0A671WLT6_SPAAU/1267-1407  AC A0A671WLT6.1
#=GS A0A060W4R3_ONCMY/109-250    AC A0A060W4R3.1
#=GS A0A2Y9RUG7_TRIMA/1380-1521  AC A0A2Y9RUG7.1
#=GS A0A6J3QCG7_TURTR/1446-1587  AC A0A6J3QCG7.1
#=GS A0A4W6CQN6_LATCA/1256-1397  AC A0A4W6CQN6.1
#=GS A0A446Y4V0_TRITD/924-1058   AC A0A446Y4V0.1
#=GS A0A1U7WBS2_NICSY/930-1066   AC A0A1U7WBS2.1
#=GS A0A485MFY0_LYNPA/1367-1508  AC A0A485MFY0.1
#=GS A0A669FA21_ORENI/1250-1385  AC A0A669FA21.1
#=GS A0A1D6NTQ3_MAIZE/923-1059   AC A0A1D6NTQ3.1
#=GS A0A2R6QMP8_ACTCC/797-886    AC A0A2R6QMP8.1
#=GS A0A4Y7L5G1_PAPSO/944-1082   AC A0A4Y7L5G1.1
#=GS A0A6J3S7V4_TURTR/1373-1514  AC A0A6J3S7V4.1
#=GS K7HE51_CAEJA/474-614        AC K7HE51.1
#=GS A0A6G0HTX9_LARCR/1379-1520  AC A0A6G0HTX9.1
#=GS A0A1S3GID8_DIPOR/1348-1489  AC A0A1S3GID8.1
#=GS A0A2T7E233_9POAL/915-1051   AC A0A2T7E233.1
#=GS A0A674F835_SALTR/1313-1452  AC A0A674F835.1
#=GS A0A446X4Y0_TRITD/786-920    AC A0A446X4Y0.1
#=GS A0A2K5NKG5_CERAT/1376-1517  AC A0A2K5NKG5.1
#=GS A0A251RA87_PRUPE/933-1069   AC A0A251RA87.1
#=GS A0A2Y9QXQ9_TRIMA/1204-1345  AC A0A2Y9QXQ9.1
#=GS A0A668ADF6_9TELE/1185-1326  AC A0A668ADF6.1
#=GS M7BFC6_CHEMY/1319-1460      AC M7BFC6.1
#=GS A0A1S2ZP45_ERIEU/1208-1349  AC A0A1S2ZP45.1
#=GS A0A1V4L0I2_PATFA/1-93       AC A0A1V4L0I2.1
#=GS A0A6A5DY14_PERFL/1415-1556  AC A0A6A5DY14.1
#=GS A0A3Q0H7X5_ALLSI/1373-1514  AC A0A3Q0H7X5.1
#=GS A0A672TWM2_STRHB/1373-1514  AC A0A672TWM2.1
#=GS A0A674F7H3_SALTR/1324-1465  AC A0A674F7H3.1
#=GS A0A0L7LG87_9NEOP/1296-1437  AC A0A0L7LG87.1
#=GS A0A091T9J5_PHALP/1290-1431  AC A0A091T9J5.1
#=GS A0A2K5S0D5_CEBCA/1435-1576  AC A0A2K5S0D5.1
#=GS A0A0V1PN99_9BILA/1433-1541  AC A0A0V1PN99.1
#=GS A0A3Q3GY62_9LABR/1313-1453  AC A0A3Q3GY62.1
#=GS A0A2P5VND8_GOSBA/720-856    AC A0A2P5VND8.1
#=GS A0A0R3X7V2_HYDTA/602-726    AC A0A0R3X7V2.1
#=GS A0A060WIN9_ONCMY/1320-1461  AC A0A060WIN9.1
#=GS A0A668ARY6_9TELE/1199-1340  AC A0A668ARY6.1
#=GS A0A498J6V8_MALDO/908-1055   AC A0A498J6V8.1
#=GS I3JS40_ORENI/1232-1373      AC I3JS40.2
#=GS A0A5A9NDD3_9TELE/1280-1421  AC A0A5A9NDD3.1
#=GS A0A3M7T7T2_BRAPC/136-280    AC A0A3M7T7T2.1
#=GS A0A452SB72_URSAM/1328-1469  AC A0A452SB72.1
#=GS A0A2K5NU12_CERAT/1368-1509  AC A0A2K5NU12.1
#=GS A0A3P9D1R1_9CICH/1411-1552  AC A0A3P9D1R1.1
#=GS A0A665XBV3_ECHNA/1273-1414  AC A0A665XBV3.1
#=GS A0A1U8AIG1_NELNU/934-1070   AC A0A1U8AIG1.1
#=GS A0A118JZU8_CYNCS/1050-1185  AC A0A118JZU8.1
#=GS H2T2L5_TAKRU/1339-1480      AC H2T2L5.3
#=GS A0A199UP16_ANACO/934-1067   AC A0A199UP16.1
#=GS A0A4W4DX74_ELEEL/1155-1296  AC A0A4W4DX74.1
#=GS A0A674C0S0_SALTR/1154-1295  AC A0A674C0S0.1
#=GS H3BZS0_TETNG/1308-1422      AC H3BZS0.1
#=GS A0A6A5NQ35_LUPAL/924-1060   AC A0A6A5NQ35.1
#=GS A0A2Y9NGE4_DELLE/1367-1508  AC A0A2Y9NGE4.1
#=GS A0A2I0TFR8_LIMLA/891-976    AC A0A2I0TFR8.1
#=GS A0A673TNU9_SURSU/1371-1512  AC A0A673TNU9.1
#=GS A0A3Q0FJ20_VIGRR/43-141     AC A0A3Q0FJ20.1
#=GS A0A3P4M9W2_GULGU/314-455    AC A0A3P4M9W2.1
#=GS H9G906_ANOCA/1427-1568      AC H9G906.2
#=GS A0A452CME2_BALAS/1208-1349  AC A0A452CME2.1
#=GS A0A4W6FME5_LATCA/1214-1355  AC A0A4W6FME5.1
#=GS A0A446X505_TRITD/924-1058   AC A0A446X505.1
#=GS M8A2Q7_TRIUA/910-1050       AC M8A2Q7.1
#=GS A0A446Y4H4_TRITD/939-1073   AC A0A446Y4H4.1
#=GS A0A4W3HK67_CALMI/934-1074   AC A0A4W3HK67.1
#=GS G0PHA3_CAEBE/1290-1430      AC G0PHA3.1
#=GS A0A3Q7YF37_CICAR/756-893    AC A0A3Q7YF37.1
#=GS D2VX38_NAEGR/790-928        AC D2VX38.1
#=GS A0A1S3FRU2_DIPOR/1354-1495  AC A0A1S3FRU2.1
#=GS A0A3Q7IH67_SOLLC/934-1069   AC A0A3Q7IH67.1
#=GS A0A2Y9QA97_DELLE/1388-1529  AC A0A2Y9QA97.1
#=GS A0A2Y9HAX9_NEOSC/1380-1521  AC A0A2Y9HAX9.1
#=GS A0A0M3J2A5_ANISI/1-58       AC A0A0M3J2A5.1
#=GS A0A087QS52_APTFO/1286-1427  AC A0A087QS52.1
#=GS A0A5C6N9H5_9TELE/1410-1551  AC A0A5C6N9H5.1
#=GS F4W7E5_ACREC/1257-1404      AC F4W7E5.1
#=GS A0A4Z2FKI9_9TELE/1-93       AC A0A4Z2FKI9.1
#=GS A0A3Q0JKG3_DIACI/7-94       AC A0A3Q0JKG3.1
#=GS A0A0R3UC02_9CEST/30-170     AC A0A0R3UC02.1
#=GS A0A553QW79_9TELE/1383-1524  AC A0A553QW79.1
#=GS A0A2K5XUQ2_MANLE/1366-1507  AC A0A2K5XUQ2.1
#=GS A0A2K5YLF9_MANLE/1376-1517  AC A0A2K5YLF9.1
#=GS A0A2K5EJS5_AOTNA/1394-1535  AC A0A2K5EJS5.1
#=GS A0A068XYH7_ECHMU/1319-1448  AC A0A068XYH7.1
#=GS A0A0L8HBI6_OCTBM/1235-1377  AC A0A0L8HBI6.1
#=GS M4ANR0_XIPMA/1177-1318      AC M4ANR0.2
#=GS A0A3Q1K1U8_ANATE/1374-1443  AC A0A3Q1K1U8.1
#=GS A0A3B6SA08_WHEAT/924-1058   AC A0A3B6SA08.1
#=GS A0A3M0IT33_HIRRU/1378-1519  AC A0A3M0IT33.1
#=GS A0A3Q0FKE9_VIGRR/33-124     AC A0A3Q0FKE9.1
#=GS A0A4W5P039_9TELE/1393-1534  AC A0A4W5P039.1
#=GS A0A3Q1BVY5_AMPOC/1189-1330  AC A0A3Q1BVY5.1
#=GS A0A5F5PNH1_HORSE/1376-1517  AC A0A5F5PNH1.1
#=GS A0A093GC00_DRYPU/1380-1521  AC A0A093GC00.1
#=GS A0A401T2T8_CHIPU/1268-1359  AC A0A401T2T8.1
#=GS H0WMB8_OTOGA/1345-1486      AC H0WMB8.1
#=GS K7B9Z5_PANTR/1380-1521      AC K7B9Z5.1
#=GS A0A2R8Y212_HUMAN/1380-1521  AC A0A2R8Y212.1
#=GS D8SK03_SELML/912-1047       AC D8SK03.1
#=GS A0A5F4WIJ8_CALJA/1373-1513  AC A0A5F4WIJ8.1
#=GS A0A2I3SB75_PANTR/1389-1530  AC A0A2I3SB75.1
#=GS A0A2K6G6D9_PROCO/1388-1529  AC A0A2K6G6D9.1
#=GS A0A4W6FMJ1_LATCA/1376-1517  AC A0A4W6FMJ1.1
#=GS A0A383Z5R8_BALAS/1408-1549  AC A0A383Z5R8.1
#=GS A0A2K6P1M2_RHIRO/1209-1364  AC A0A2K6P1M2.1
#=GS A0A1U8BHZ4_MESAU/1406-1547  AC A0A1U8BHZ4.1
#=GS A0A5J9TN31_9POAL/918-1053   AC A0A5J9TN31.1
#=GS W5PC02_SHEEP/1349-1490      AC W5PC02.1
#=GS A0A6Q2Y4I6_ESOLU/1258-1398  AC A0A6Q2Y4I6.1
#=GS A0A667ZJA6_9TELE/1257-1398  AC A0A667ZJA6.1
#=GS A0A672V4K5_STRHB/1408-1549  AC A0A672V4K5.1
#=GS A0A6Q2X3Y5_ESOLU/1243-1384  AC A0A6Q2X3Y5.1
#=GS A0A498HNI5_MALDO/907-1042   AC A0A498HNI5.1
#=GS A0A663FDZ7_AQUCH/1189-1330  AC A0A663FDZ7.1
#=GS A0A2Y9NGD8_DELLE/1380-1521  AC A0A2Y9NGD8.1
#=GS A0A402FAG6_9SAUR/1383-1522  AC A0A402FAG6.1
#=GS A0A3P7DBX0_WUCBA/791-931    AC A0A3P7DBX0.1
#=GS A0A5N5PJA5_PANHP/1423-1564  AC A0A5N5PJA5.1
#=GS A0A0V1BDZ8_TRISP/1507-1588  AC A0A0V1BDZ8.1
#=GS A0A6J3QPZ8_TURTR/1428-1569  AC A0A6J3QPZ8.1
#=GS A0A3B6S959_WHEAT/803-937    AC A0A3B6S959.1
#=GS A0A453QYJ6_AEGTS/649-783    AC A0A453QYJ6.1
#=GS A0A4D9DVR1_9SAUR/1318-1459  AC A0A4D9DVR1.1
#=GS A0A1S3PYT8_SALSA/1394-1535  AC A0A1S3PYT8.1
#=GS A0A2R8YE38_HUMAN/131-272    AC A0A2R8YE38.1
#=GS A0A5N4C8B8_CAMDR/1421-1578  AC A0A5N4C8B8.1
#=GS A0A453QYA0_AEGTS/924-1022   AC A0A453QYA0.1
#=GS A0A6J3QQP8_TURTR/1434-1575  AC A0A6J3QQP8.1
#=GS A0A287A0J5_PIG/1369-1510    AC A0A287A0J5.2
#=GS A0A1S3Q076_SALSA/1393-1534  AC A0A1S3Q076.1
#=GS A0A2P5FN57_TREOI/949-1021   AC A0A2P5FN57.1
#=GS A0A2Y9EL30_PHYMC/1373-1514  AC A0A2Y9EL30.1
#=GS A0A6I8RXQ4_XENTR/1346-1487  AC A0A6I8RXQ4.1
#=GS G1QWK1_NOMLE/1435-1576      AC G1QWK1.3
#=GS A0A2Y9E125_TRIMA/1251-1392  AC A0A2Y9E125.1
#=GS A0A446Y4P1_TRITD/1010-1080  AC A0A446Y4P1.1
#=GS L9KQZ1_TUPCH/1171-1312      AC L9KQZ1.1
#=GS A0A093ET06_GAVST/1341-1482  AC A0A093ET06.1
#=GS H0WSN5_OTOGA/1387-1528      AC H0WSN5.1
#=GS A0A674C0V6_SALTR/1249-1390  AC A0A674C0V6.1
#=GS A0A453QY61_AEGTS/164-298    AC A0A453QY61.1
#=GS H2YQ30_CIOSA/1312-1453      AC H2YQ30.1
#=GS A0A667YTS7_9TELE/1328-1469  AC A0A667YTS7.1
#=GS A0A553R267_9TELE/1347-1488  AC A0A553R267.1
#=GS A0A665VEQ2_ECHNA/1302-1443  AC A0A665VEQ2.1
#=GS A0A663FDH6_AQUCH/1353-1494  AC A0A663FDH6.1
#=GS A0A1S3SDD7_SALSA/1433-1574  AC A0A1S3SDD7.1
#=GS A0A2Y9EIY9_PHYMC/1380-1521  AC A0A2Y9EIY9.1
#=GS A0A671VP57_SPAAU/1185-1326  AC A0A671VP57.1
#=GS A0A672HE88_SALFA/1370-1511  AC A0A672HE88.1
#=GS A0A2R9B2T3_PANPA/1362-1503  AC A0A2R9B2T3.1
#=GS A0A2Y9SYN4_PHYMC/1208-1349  AC A0A2Y9SYN4.1
#=GS A0A453QYV7_AEGTS/637-771    AC A0A453QYV7.1
#=GS A0A2P5FN57_TREOI/864-947    AC A0A2P5FN57.1
#=GS I3MA51_ICTTR/1380-1521      AC I3MA51.2
#=GS G3S4I2_GORGO/1387-1528      AC G3S4I2.2
#=GS F7E3M0_XENTR/1246-1387      AC F7E3M0.2
#=GS A0A452SHR0_URSAM/1309-1450  AC A0A452SHR0.1
#=GS A0A2H3YJE7_PHODC/940-1075   AC A0A2H3YJE7.1
#=GS A0A0V1PNF3_9BILA/1380-1520  AC A0A0V1PNF3.1
#=GS H3AHH7_LATCH/1418-1556      AC H3AHH7.1
#=GS A0A446Y4L3_TRITD/924-1058   AC A0A446Y4L3.1
#=GS A0A2P4T1Y9_BAMTH/956-1096   AC A0A2P4T1Y9.1
#=GS A0A2K5ZQK8_MANLE/1388-1529  AC A0A2K5ZQK8.1
#=GS A0A2Y9RRS8_TRIMA/1379-1520  AC A0A2Y9RRS8.1
#=GS A0A3Q0KLA5_SCHMA/1437-1558  AC A0A3Q0KLA5.1
#=GS A0A673Y9N0_SALTR/1130-1271  AC A0A673Y9N0.1
#=GS A0A6J3QCK3_TURTR/1446-1587  AC A0A6J3QCK3.1
#=GS A0A341ADT5_NEOAA/1398-1539  AC A0A341ADT5.1
#=GS A0A669CQK8_ORENI/1232-1373  AC A0A669CQK8.1
#=GS G7J9W2_MEDTR/932-1069       AC G7J9W2.2
#=GS A0A673U4V6_SURSU/1380-1521  AC A0A673U4V6.1
#=GS G3TQH4_LOXAF/1363-1504      AC G3TQH4.1
#=GS A0A2K6MJ23_RHIBE/1380-1521  AC A0A2K6MJ23.1
#=GS A0A059BBD2_EUCGR/932-1068   AC A0A059BBD2.1
#=GS A0A674F7A2_SALTR/1305-1446  AC A0A674F7A2.1
#=GS A0A4W6EIQ8_LATCA/1283-1424  AC A0A4W6EIQ8.1
#=GS A0A0V1N729_9BILA/1360-1500  AC A0A0V1N729.1
#=GS H2UMY3_TAKRU/1410-1551      AC H2UMY3.3
#=GS A0A060VNP1_ONCMY/1388-1529  AC A0A060VNP1.1
#=GS A0A0R3SUW1_HYMDI/1430-1576  AC A0A0R3SUW1.2
#=GS A0A3Q2WYX4_HAPBU/1278-1419  AC A0A3Q2WYX4.1
#=GS A0A4W4EKE9_ELEEL/1291-1432  AC A0A4W4EKE9.1
#=GS A0A183K443_9TREM/1-78       AC A0A183K443.1
#=GS A0A2Y9Q060_DELLE/1374-1515  AC A0A2Y9Q060.1
#=GS A0A665VGI5_ECHNA/1201-1342  AC A0A665VGI5.1
#=GS A0A397YDC2_BRACM/900-1036   AC A0A397YDC2.1
#=GS A0A383Z599_BALAS/1373-1514  AC A0A383Z599.1
#=GS H2YQ33_CIOSA/1279-1420      AC H2YQ33.1
#=GS W4Z592_STRPU/1432-1572      AC W4Z592.1
#=GS A0A2P5WA70_GOSBA/805-881    AC A0A2P5WA70.1
#=GS A0A3Q0JJ82_DIACI/1-93       AC A0A3Q0JJ82.1
#=GS A0A2Y9H478_NEOSC/1408-1549  AC A0A2Y9H478.1
#=GS A0A2K5KMM4_CERAT/1360-1501  AC A0A2K5KMM4.1
#=GS F6Q5E6_HORSE/1388-1529      AC F6Q5E6.3
#=GS W9QJP0_9ROSA/1984-2120      AC W9QJP0.1
#=GS A0A2K5UJW0_MACFA/83-214     AC A0A2K5UJW0.1
#=GS A0A341AG30_NEOAA/1405-1546  AC A0A341AG30.1
#=GS A0A671EPI7_RHIFE/1386-1527  AC A0A671EPI7.1
#=GS A0A067KBL4_JATCU/933-1069   AC A0A067KBL4.1
#=GS A0A3Q0FFZ2_VIGRR/47-148     AC A0A3Q0FFZ2.1
#=GS G1TM73_RABIT/1343-1484      AC G1TM73.2
#=GS A0A183NE85_9TREM/1-78       AC A0A183NE85.1
#=GS A0A2G5EYX5_AQUCA/933-1070   AC A0A2G5EYX5.1
#=GS A0A2Y9R054_TRIMA/1208-1349  AC A0A2Y9R054.1
#=GS A0A6J3QQQ3_TURTR/1434-1575  AC A0A6J3QQQ3.1
#=GS A0A674MQU9_TAKRU/1389-1530  AC A0A674MQU9.1
#=GS A0A4X2MDW2_VOMUR/1353-1494  AC A0A4X2MDW2.1
#=GS A0A4W3I3I4_CALMI/905-1039   AC A0A4W3I3I4.1
#=GS A0A2K5WDX2_MACFA/1377-1518  AC A0A2K5WDX2.1
#=GS A0A670J3Q4_PODMU/1292-1433  AC A0A670J3Q4.1
#=GS A0A132A2D7_SARSC/384-528    AC A0A132A2D7.1
#=GS G3GUN0_CRIGR/1382-1523      AC G3GUN0.1
#=GS A0A672Z3N5_9TELE/1309-1450  AC A0A672Z3N5.1
#=GS A0A673Y8E0_SALTR/1186-1327  AC A0A673Y8E0.1
#=GS A0A4S2L899_9HYME/1374-1515  AC A0A4S2L899.1
#=GS G3SY08_LOXAF/1362-1503      AC G3SY08.1
#=GS A0A226PF01_COLVI/1384-1525  AC A0A226PF01.1
#=GS A0A1D6NTR5_MAIZE/139-274    AC A0A1D6NTR5.1
#=GS A0A2I4BV99_9TELE/1412-1553  AC A0A2I4BV99.1
#=GS A0A653CKA6_CALMS/1366-1508  AC A0A653CKA6.1
#=GS A0A5N4C6S1_CAMDR/1397-1561  AC A0A5N4C6S1.1
#=GS A0A183T3J7_SCHSO/1394-1515  AC A0A183T3J7.1
#=GS A0A384BGQ1_URSMA/1364-1505  AC A0A384BGQ1.1
#=GS M4D4A6_BRARP/519-586        AC M4D4A6.1
#=GS A0A446X4T4_TRITD/38-172     AC A0A446X4T4.1
#=GS A0A1D6NTQ8_MAIZE/921-985    AC A0A1D6NTQ8.1
#=GS V4LVQ6_EUTSA/919-1055       AC V4LVQ6.1
#=GS A0A446X4W9_TRITD/897-1031   AC A0A446X4W9.1
#=GS A0A0R4IJ89_DANRE/1361-1502  AC A0A0R4IJ89.1
#=GS A0A5D2U685_GOSMU/934-1070   AC A0A5D2U685.1
#=GS A0A2Y9T071_PHYMC/1208-1349  AC A0A2Y9T071.1
#=GS A0A672TX66_STRHB/1306-1447  AC A0A672TX66.1
#=GS A0A6J3QCL0_TURTR/1388-1529  AC A0A6J3QCL0.1
#=GS A0A2R9B0U4_PANPA/1354-1495  AC A0A2R9B0U4.1
#=GS A0A026X2N4_OOCBI/1370-1511  AC A0A026X2N4.1
#=GS B8B3I5_ORYSI/884-1017       AC B8B3I5.1
#=GS A0A3Q0GVG2_ALLSI/1262-1403  AC A0A3Q0GVG2.1
#=GS L7N2M1_XENTR/1147-1288      AC L7N2M1.3
#=GS A0A1X7U6C2_AMPQE/842-982    AC A0A1X7U6C2.1
#=GS A0A6Q2YUL2_ESOLU/1292-1435  AC A0A6Q2YUL2.1
#=GS A0A665VEU5_ECHNA/1278-1419  AC A0A665VEU5.1
#=GS A0A4S2M0Q1_OPIFE/1423-1556  AC A0A4S2M0Q1.1
#=GS A0A6H5GLE0_9HEMI/1273-1408  AC A0A6H5GLE0.1
#=GS U4UMR7_DENPD/1031-1173      AC U4UMR7.1
#=GS B4L0W7_DROMO/1374-1515      AC B4L0W7.2
#=GS A0A6D2JNX4_9BRAS/855-1000   AC A0A6D2JNX4.1
#=GS A0A0D2KBA6_9CHLO/121-232    AC A0A0D2KBA6.1
#=GS A0A3P8ZUW0_ESOLU/1311-1435  AC A0A3P8ZUW0.2
#=GS A0A1S4BDI8_TOBAC/169-305    AC A0A1S4BDI8.1
#=GS A0A553MTF3_9TELE/1462-1587  AC A0A553MTF3.1
#=GS A0A2K5ETD1_AOTNA/1360-1501  AC A0A2K5ETD1.1
#=GS A0A1S3JCM3_LINUN/1395-1538  AC A0A1S3JCM3.1
#=GS A0A6J3QQU9_TURTR/1434-1575  AC A0A6J3QQU9.1
#=GS A0A3Q3B9R1_KRYMA/1257-1397  AC A0A3Q3B9R1.1
#=GS A0A061GHM8_THECC/935-1071   AC A0A061GHM8.1
#=GS H2MRY1_ORYLA/1302-1443      AC H2MRY1.2
#=GS A0A665VAZ9_ECHNA/1243-1384  AC A0A665VAZ9.1
#=GS A0A4U5V3T5_COLLU/1431-1572  AC A0A4U5V3T5.1
#=GS A0A1R3GU15_COCAP/944-1080   AC A0A1R3GU15.1
#=GS A0A1D5P5W8_CHICK/98-239     AC A0A1D5P5W8.2
#=GS A0A4S4ESG6_CAMSI/386-442    AC A0A4S4ESG6.1
#=GS A0A3Q2DMN4_CYPVA/1280-1421  AC A0A3Q2DMN4.1
#=GS A0A392NGB5_9FABA/69-192     AC A0A392NGB5.1
#=GS A0A087YGI5_POEFO/1366-1507  AC A0A087YGI5.2
#=GS A0A1V4KNF0_PATFA/1323-1464  AC A0A1V4KNF0.1
#=GS A0A6G0TSE0_APHGL/1376-1517  AC A0A6G0TSE0.1
#=GS A0A0Q3LZ70_AMAAE/340-481    AC A0A0Q3LZ70.1
#=GS A0A3Q0FH97_VIGRR/62-135     AC A0A3Q0FH97.1
#=GS A0A091KK42_9GRUI/1331-1472  AC A0A091KK42.1
#=GS A0A4U1FNR1_MONMO/1419-1560  AC A0A4U1FNR1.1
#=GS A0A674C229_SALTR/1162-1303  AC A0A674C229.1
#=GS A0A4X2JV30_VOMUR/1407-1548  AC A0A4X2JV30.1
#=GS A0A072VDM6_MEDTR/912-1048   AC A0A072VDM6.1
#=GS A0A093LUU3_FULGA/1396-1537  AC A0A093LUU3.1
#=GS A0A3Q4A8K7_MOLML/1241-1382  AC A0A3Q4A8K7.1
#=GS A0A446X4X9_TRITD/803-937    AC A0A446X4X9.1
#=GS A0A423SH70_PENVA/384-489    AC A0A423SH70.1
#=GS A0A445KX43_GLYSO/931-1068   AC A0A445KX43.1
#=GS A0A4X2JYN2_VOMUR/1427-1568  AC A0A4X2JYN2.1
#=GS A0A151I735_9HYME/1344-1495  AC A0A151I735.1
#=GS A0A2U3ZDU7_ODORO/1375-1516  AC A0A2U3ZDU7.1
#=GS A0A2I4CIX5_9TELE/1406-1547  AC A0A2I4CIX5.1
#=GS F5GWX5_HUMAN/1373-1514      AC F5GWX5.1
#=GS A0A6A1Q6E0_BALPH/1424-1565  AC A0A6A1Q6E0.1
#=GS A0A667Z340_9TELE/1172-1313  AC A0A667Z340.1
#=GS A0A674C120_SALTR/1248-1389  AC A0A674C120.1
#=GS A0A453QYW3_AEGTS/924-1058   AC A0A453QYW3.1
#=GS M3Y6W4_MUSPF/1371-1512      AC M3Y6W4.1
#=GS A0A3P8S7N0_AMPPE/1412-1553  AC A0A3P8S7N0.1
#=GS A0A1D1V5T4_RAMVA/1439-1578  AC A0A1D1V5T4.1
#=GS A0A1S3PYS1_SALSA/1398-1539  AC A0A1S3PYS1.1
#=GS A0A1S3P3D0_SALSA/1380-1521  AC A0A1S3P3D0.1
#=GS A0A430QK29_SCHBO/1396-1517  AC A0A430QK29.1
#=GS T1ED10_HELRO/995-1136       AC T1ED10.1
#=GS A0A0N4V906_ENTVE/1213-1352  AC A0A0N4V906.1
#=GS A0A3S2M9X8_CHISP/1381-1522  AC A0A3S2M9X8.1
#=GS A0A5A9N269_9TELE/1276-1417  AC A0A5A9N269.1
#=GS A0A670J1S6_PODMU/1262-1344  AC A0A670J1S6.1
#=GS E3LUG3_CAERE/1268-1408      AC E3LUG3.1
#=GS A0A669C703_ORENI/1297-1438  AC A0A669C703.1
#=GS A0A2Y9QU03_TRIMA/1208-1349  AC A0A2Y9QU03.1
#=GS A0A3B6REL0_WHEAT/897-1031   AC A0A3B6REL0.1
#=GS A0A674GAE3_TAEGU/1263-1404  AC A0A674GAE3.1
#=GS A0A446Y4N5_TRITD/803-937    AC A0A446Y4N5.1
#=GS G3U9I3_LOXAF/1350-1491      AC G3U9I3.1
#=GS A0A2R8YFD8_HUMAN/1372-1513  AC A0A2R8YFD8.1
#=GS A0A452GSA9_9SAUR/1270-1411  AC A0A452GSA9.1
#=GS A0A3R7DC78_CLOSI/1423-1556  AC A0A3R7DC78.1
#=GS A0A2Y9Q050_DELLE/1373-1514  AC A0A2Y9Q050.1
#=GS A0A3P8RTJ5_AMPPE/1305-1446  AC A0A3P8RTJ5.1
#=GS A0A200QDZ7_9MAGN/939-1075   AC A0A200QDZ7.1
#=GS A0A4W3HKS7_CALMI/939-1079   AC A0A4W3HKS7.1
#=GS A0A1S3M275_SALSA/1392-1533  AC A0A1S3M275.1
#=GS A0A267F0V9_9PLAT/1379-1517  AC A0A267F0V9.1
#=GS E9QAS5_MOUSE/1380-1521      AC E9QAS5.1
#=GS A0A671Y8N3_SPAAU/1176-1317  AC A0A671Y8N3.1
#=GS X1WBL0_DANRE/1272-1413      AC X1WBL0.2
#=GS A0A6Q2WSR7_ESOLU/1199-1340  AC A0A6Q2WSR7.1
#=GS A0A444V4R4_ACIRT/4-114      AC A0A444V4R4.1
#=GS M9PIA6_DROME/1366-1507      AC M9PIA6.1
#=GS A0A6J3QR89_TURTR/1434-1575  AC A0A6J3QR89.1
#=GS A0A2K5JI17_COLAP/1194-1348  AC A0A2K5JI17.1
#=GS A0A2K6P1K6_RHIRO/1376-1517  AC A0A2K6P1K6.1
#=GS A0A4C1YP13_EUMVA/47-110     AC A0A4C1YP13.1
#=GS A0A091MTL5_9PASS/1350-1491  AC A0A091MTL5.1
#=GS A0A2K6P1K4_RHIRO/1376-1531  AC A0A2K6P1K4.1
#=GS A0A1U8I6V8_GOSHI/756-892    AC A0A1U8I6V8.1
#=GS A0A1S3WBR1_ERIEU/1214-1355  AC A0A1S3WBR1.1
#=GS A0A060XAS3_ONCMY/333-474    AC A0A060XAS3.1
#=GS A0A0D2PU84_GOSRA/934-1070   AC A0A0D2PU84.1
#=GS A0A672HF85_SALFA/1290-1431  AC A0A672HF85.1
#=GS H2NG88_PONAB/1379-1521      AC H2NG88.1
#=GS A0A1S3PYS9_SALSA/1391-1532  AC A0A1S3PYS9.1
#=GS A0A151TT78_CAJCA/931-1067   AC A0A151TT78.1
#=GS G7K1B2_MEDTR/9-58           AC G7K1B2.1
#=GS A0A3Q1GCX9_9TELE/1250-1391  AC A0A3Q1GCX9.1
#=GS A0A672J0R0_SALFA/1236-1377  AC A0A672J0R0.1
#=GS W5ML03_LEPOC/1340-1481      AC W5ML03.1
#=GS A0A4W2EH10_BOBOX/1221-1362  AC A0A4W2EH10.1
#=GS A0A5N4DAA7_CAMDR/1399-1540  AC A0A5N4DAA7.1
#=GS A0A672J2W9_SALFA/1277-1418  AC A0A672J2W9.1
#=GS A0A2K6R2W6_RHIRO/1373-1514  AC A0A2K6R2W6.1
#=GS A0A2Y9NJM5_DELLE/1380-1521  AC A0A2Y9NJM5.1
#=GS A0A178UZA8_ARATH/855-991    AC A0A178UZA8.1
#=GS A0A2K5ET78_AOTNA/1373-1514  AC A0A2K5ET78.1
#=GS A0A1V4KNI5_PATFA/1325-1466  AC A0A1V4KNI5.1
#=GS A0A446X4V7_TRITD/1010-1080  AC A0A446X4V7.1
#=GS A0A4W4EIH4_ELEEL/1380-1521  AC A0A4W4EIH4.1
#=GS A0A6A5ME68_LUPAL/982-1117   AC A0A6A5ME68.1
#=GS A0A5F4CQZ0_CANLF/1313-1454  AC A0A5F4CQZ0.1
#=GS A0A4W5NR79_9TELE/1309-1450  AC A0A4W5NR79.1
#=GS A0A674HUL9_TAEGU/1378-1519  AC A0A674HUL9.1
#=GS A0A1S3WHF4_ERIEU/1373-1514  AC A0A1S3WHF4.1
#=GS A0A1S3Q081_SALSA/1386-1527  AC A0A1S3Q081.1
#=GS A0A3Q3GS44_KRYMA/1366-1434  AC A0A3Q3GS44.1
#=GS W5KTJ0_ASTMX/1279-1420      AC W5KTJ0.2
#=GS A0A4W4DYK4_ELEEL/1193-1334  AC A0A4W4DYK4.1
#=GS A0A673BAQ0_9TELE/1270-1411  AC A0A673BAQ0.1
#=GS A0A4W6FLD0_LATCA/1347-1488  AC A0A4W6FLD0.1
#=GS A0A485MEF6_LYNPA/1149-1290  AC A0A485MEF6.1
#=GS A0A453QYI1_AEGTS/330-462    AC A0A453QYI1.1
#=GS A0A4W3HKC3_CALMI/853-993    AC A0A4W3HKC3.1
#=GS A0A553MTF4_9TELE/1462-1587  AC A0A553MTF4.1
#=GS A0A2U1MB60_ARTAN/923-1059   AC A0A2U1MB60.1
#=GS A0A3Q0FJ43_VIGRR/14-116     AC A0A3Q0FJ43.1
#=GS A0A1S3JBS1_LINUN/1389-1532  AC A0A1S3JBS1.1
#=GS A0A672JA51_SALFA/1274-1415  AC A0A672JA51.1
#=GS A0A2G5EZ42_AQUCA/933-1072   AC A0A2G5EZ42.1
#=GS A0A158QGR5_RODNA/1360-1497  AC A0A158QGR5.1
#=GS A0A2Y9L1Y3_ENHLU/1433-1574  AC A0A2Y9L1Y3.1
#=GS A0A6H5J217_9HYME/331-472    AC A0A6H5J217.1
#=GS A0A151N4R8_ALLMI/1312-1453  AC A0A151N4R8.1
#=GS A0A443SU29_9ACAR/1377-1488  AC A0A443SU29.1
#=GS G3TYY5_LOXAF/1287-1428      AC G3TYY5.1
#=GS A0A6A5E1K7_PERFL/1383-1524  AC A0A6A5E1K7.1
#=GS A0A2H2IC60_CAEJA/1280-1420  AC A0A2H2IC60.1
#=GS A0A067FW99_CITSI/934-1070   AC A0A067FW99.1
#=GS A0A0L8HB98_OCTBM/1234-1376  AC A0A0L8HB98.1
#=GS A0A671VM24_SPAAU/1249-1390  AC A0A671VM24.1
#=GS A0A674MPZ5_TAKRU/1356-1497  AC A0A674MPZ5.1
#=GS A0A674GW68_TAEGU/1390-1531  AC A0A674GW68.1
#=GS A0A2G2ZAQ4_CAPAN/927-1063   AC A0A2G2ZAQ4.1
#=GS A0A2R8Y7I0_HUMAN/72-213     AC A0A2R8Y7I0.1
#=GS A0A0L8HBU5_OCTBM/1195-1337  AC A0A0L8HBU5.1
#=GS A0A3P8ZVF5_ESOLU/1282-1423  AC A0A3P8ZVF5.2
#=GS A0A067FVL3_CITSI/934-1070   AC A0A067FVL3.1
#=GS A0A368G031_ANCCA/1235-1373  AC A0A368G031.1
#=GS A0A452EWV8_CAPHI/1354-1495  AC A0A452EWV8.1
#=GS A0A670J4F8_PODMU/1255-1396  AC A0A670J4F8.1
#=GS A0A4W5RZD8_9TELE/1257-1363  AC A0A4W5RZD8.1
#=GS A0A446X4W0_TRITD/901-1035   AC A0A446X4W0.1
#=GS A0A673ZYN5_SALTR/1355-1496  AC A0A673ZYN5.1
#=GS A0A3Q1H3J8_9TELE/1182-1323  AC A0A3Q1H3J8.1
#=GS A0A452SHR3_URSAM/1346-1487  AC A0A452SHR3.1
#=GS A0A674PB68_TAKRU/1294-1435  AC A0A674PB68.1
#=GS A0A4W2DY02_BOBOX/1373-1514  AC A0A4W2DY02.1
#=GS A0A553QQ05_9TELE/1248-1331  AC A0A553QQ05.1
#=GS A0A286XXI5_CAVPO/1324-1465  AC A0A286XXI5.1
#=GS A0A2R8QC65_DANRE/995-1136   AC A0A2R8QC65.1
#=GS A0A3Q3MU53_9TELE/1376-1517  AC A0A3Q3MU53.1
#=GS A0A2R8Y521_HUMAN/1388-1529  AC A0A2R8Y521.1
#=GS A0A1U8ICD2_GOSHI/931-1067   AC A0A1U8ICD2.1
#=GS A0A2R8YDJ9_HUMAN/1023-1164  AC A0A2R8YDJ9.1
#=GS A0A061GJM4_THECC/825-961    AC A0A061GJM4.1
#=GS A0A2K5IMM2_COLAP/1381-1522  AC A0A2K5IMM2.1
#=GS E2BW72_HARSA/1355-1496      AC E2BW72.1
#=GS U3K588_FICAL/1385-1526      AC U3K588.1
#=GS G1RH82_NOMLE/1356-1497      AC G1RH82.3
#=GS A0A078FM95_BRANA/443-527    AC A0A078FM95.1
#=GS A0A665WH43_ECHNA/1244-1384  AC A0A665WH43.1
#=GS A0A1S2ZP30_ERIEU/1208-1349  AC A0A1S2ZP30.1
#=GS A0A2K5IM63_COLAP/1389-1530  AC A0A2K5IM63.1
#=GS A0A2Y9T2L7_PHYMC/1374-1515  AC A0A2Y9T2L7.2
#=GS A0A0K0DV54_STRER/1230-1369  AC A0A0K0DV54.1
#=GS A0A4W5RM11_9TELE/1295-1436  AC A0A4W5RM11.1
#=GS W5N9B6_LEPOC/1388-1529      AC W5N9B6.1
#=GS A0A072V2M5_MEDTR/932-1068   AC A0A072V2M5.1
#=GS A0A287BIB9_PIG/1230-1371    AC A0A287BIB9.2
#=GS A0A6Q2ZLL1_ESOLU/1377-1518  AC A0A6Q2ZLL1.1
#=GS A0A287DE00_ICTTR/1345-1486  AC A0A287DE00.1
#=GS A0A3Q7S5I2_VULVU/1408-1549  AC A0A3Q7S5I2.1
#=GS A0A194QWG1_PAPMA/1318-1459  AC A0A194QWG1.1
#=GS K7EMY3_HUMAN/771-912        AC K7EMY3.1
#=GS A0A669DKS3_ORENI/1168-1309  AC A0A669DKS3.1
#=GS A0A2A2LH28_9BILA/1361-1491  AC A0A2A2LH28.1
#=GS A0A388KTT0_CHABU/1384-1480  AC A0A388KTT0.1
#=GS A0A3P9D344_9CICH/1411-1552  AC A0A3P9D344.1
#=GS A0A2R8YER1_HUMAN/1373-1514  AC A0A2R8YER1.1
#=GS K7KIG0_SOYBN/931-1067       AC K7KIG0.1
#=GS A0A5N4D224_CAMDR/1380-1521  AC A0A5N4D224.1
#=GS A0A674GYX1_TAEGU/1305-1446  AC A0A674GYX1.1
#=GS A0A3Q0FFY0_VIGRR/68-168     AC A0A3Q0FFY0.1
#=GS A0A0J7KPY0_LASNI/946-1087   AC A0A0J7KPY0.1
#=GS A0A3Q0GRX3_ALLSI/1316-1457  AC A0A3Q0GRX3.1
#=GS I3IVZ7_ORENI/1268-1409      AC I3IVZ7.2
#=GS A0A672V3W5_STRHB/1410-1551  AC A0A672V3W5.1
#=GS A0A668AIZ7_9TELE/1277-1414  AC A0A668AIZ7.1
#=GS E9PYU4_MOUSE/1353-1494      AC E9PYU4.1
#=GS A0A093I3V1_STRCA/1373-1514  AC A0A093I3V1.1
#=GS A0A5N5J7L0_9ROSI/1063-1199  AC A0A5N5J7L0.1
#=GS A0A2G9SJL5_LITCT/1-93       AC A0A2G9SJL5.1
#=GS A0A2I2YM90_GORGO/1415-1499  AC A0A2I2YM90.1
#=GS A0A3Q4IBX4_NEOBR/1307-1448  AC A0A3Q4IBX4.1
#=GS A0A674B0A9_SALTR/1256-1397  AC A0A674B0A9.1
#=GS A0A0K0ETI6_STRER/1231-1371  AC A0A0K0ETI6.1
#=GS A0A3Q4H4F1_NEOBR/1245-1386  AC A0A3Q4H4F1.1
#=GS A0A673BHS0_9TELE/1329-1470  AC A0A673BHS0.1
#=GS A0A6A6KC83_HEVBR/17-80      AC A0A6A6KC83.1
#=GS A0A5A9NJR7_9TELE/1315-1456  AC A0A5A9NJR7.1
#=GS A0A5F7ZCZ7_MACMU/1204-1345  AC A0A5F7ZCZ7.1
#=GS A0A1S3LDL2_SALSA/1392-1533  AC A0A1S3LDL2.1
#=GS A0A2I4BV62_9TELE/1411-1552  AC A0A2I4BV62.1
#=GS A0A3P8Z211_ESOLU/1221-1361  AC A0A3P8Z211.2
#=GS A0A2Y9HFU7_NEOSC/1429-1570  AC A0A2Y9HFU7.1
#=GS A0A674A2Y4_SALTR/1371-1512  AC A0A674A2Y4.1
#=GS A0A4W6CQM9_LATCA/1286-1427  AC A0A4W6CQM9.1
#=GS A0A1S3N7L5_SALSA/1450-1591  AC A0A1S3N7L5.1
#=GS A0A6G1B428_CROCR/1408-1549  AC A0A6G1B428.1
#=GS A0A4W4EJZ3_ELEEL/1299-1440  AC A0A4W4EJZ3.1
#=GS A0A287D9W6_ICTTR/305-446    AC A0A287D9W6.1
#=GS A0A6J3S9B4_TURTR/1379-1520  AC A0A6J3S9B4.1
#=GS A0A4W6CQI5_LATCA/1343-1484  AC A0A4W6CQI5.1
#=GS A0A674B0D4_SALTR/1272-1413  AC A0A674B0D4.1
#=GS A0A3Q7XSP4_CICAR/971-1097   AC A0A3Q7XSP4.1
#=GS A0A3Q1H2Z2_ANATE/1302-1443  AC A0A3Q1H2Z2.1
#=GS A0A0N0BJI5_9HYME/1333-1474  AC A0A0N0BJI5.1
#=GS A0A2Y9Q6G6_DELLE/1368-1509  AC A0A2Y9Q6G6.1
#=GS A0A540NJD8_MALBA/966-1100   AC A0A540NJD8.1
#=GS A0A5F9DFK3_RABIT/1350-1491  AC A0A5F9DFK3.1
#=GS A0A2K6AMP3_MACNE/1376-1517  AC A0A2K6AMP3.1
#=GS A0A2K6SMV0_SAIBB/1373-1514  AC A0A2K6SMV0.1
#=GS A0A0L9UH92_PHAAN/1080-1210  AC A0A0L9UH92.1
#=GS A0A6I8T181_XENTR/1284-1425  AC A0A6I8T181.1
#=GS A0A3B6REL2_WHEAT/1010-1080  AC A0A3B6REL2.1
#=GS M4CUC0_BRARP/919-1055       AC M4CUC0.1
#=GS A0A673Y6U2_SALTR/1225-1366  AC A0A673Y6U2.1
#=GS I3JIX3_ORENI/1376-1517      AC I3JIX3.2
#=GS G1M6Q2_AILME/1393-1534      AC G1M6Q2.1
#=GS A0A1S3M233_SALSA/1397-1538  AC A0A1S3M233.1
#=GS A0A5K4EM54_SCHMA/890-1011   AC A0A5K4EM54.1
#=GS A0A672J1A6_SALFA/1250-1391  AC A0A672J1A6.1
#=GS U3J3N6_ANAPP/1180-1321      AC U3J3N6.2
#=GS A0A4W5RW23_9TELE/1127-1266  AC A0A4W5RW23.1
#=GS A0A1L8H3V6_XENLA/1401-1542  AC A0A1L8H3V6.1
#=GS A0A453QYA5_AEGTS/421-555    AC A0A453QYA5.1
#=GS A0A5J5DK43_9PERO/1254-1375  AC A0A5J5DK43.1
#=GS A0A667Z9A8_9TELE/1352-1493  AC A0A667Z9A8.1
#=GS A0A315B3X0_PRUYE/933-1069   AC A0A315B3X0.1
#=GS A0A493SXB5_ANAPP/1386-1527  AC A0A493SXB5.1
#=GS A0A670JY02_PODMU/1343-1484  AC A0A670JY02.1
#=GS A0A6Q2Y984_ESOLU/1295-1435  AC A0A6Q2Y984.1
#=GS A0A077Z2I2_TRITR/1373-1513  AC A0A077Z2I2.1
#=GS A0A183W4J3_TRIRE/1-43       AC A0A183W4J3.1
#=GS A0A663FCL8_AQUCH/1257-1398  AC A0A663FCL8.1
#=GS A0A669DJG9_ORENI/1272-1413  AC A0A669DJG9.1
#=GS B7PLQ0_IXOSC/1352-1494      AC B7PLQ0.1
#=GS A0A665T602_ECHNA/1192-1332  AC A0A665T602.1
#=GS A0A6A5F151_PERFL/1437-1578  AC A0A6A5F151.1
#=GS A0A2Y9T5A1_PHYMC/1408-1549  AC A0A2Y9T5A1.1
#=GS A0A1L8FMG5_XENLA/1352-1493  AC A0A1L8FMG5.1
#=GS A0A0V1HWE3_9BILA/1367-1507  AC A0A0V1HWE3.1
#=GS A0A674AKT0_SALTR/1309-1448  AC A0A674AKT0.1
#=GS A0A287D8C3_ICTTR/1344-1485  AC A0A287D8C3.1
#=GS R0F8D0_9BRAS/890-1026       AC R0F8D0.1
#=GS A0A072VCP2_MEDTR/932-1069   AC A0A072VCP2.1
#=GS G1M6Q8_AILME/1401-1542      AC G1M6Q8.1
#=GS A0A4W5RW11_9TELE/1192-1333  AC A0A4W5RW11.1
#=GS A0A4W3HFG3_CALMI/934-1074   AC A0A4W3HFG3.1
#=GS A0A0B0P6N8_GOSAR/974-1049   AC A0A0B0P6N8.1
#=GS A0A2K5QE54_CEBCA/1388-1529  AC A0A2K5QE54.1
#=GS H3C0V6_TETNG/1308-1422      AC H3C0V6.1
#=GS A0A5F8A0Q8_MACMU/1388-1529  AC A0A5F8A0Q8.1
#=GS A0A194YHQ5_SORBI/922-1057   AC A0A194YHQ5.1
#=GS A0A4W4FRK6_ELEEL/1264-1405  AC A0A4W4FRK6.1
#=GS A0A0L8HB92_OCTBM/1196-1338  AC A0A0L8HB92.1
#=GS A0A310SFG9_9HYME/1272-1413  AC A0A310SFG9.1
#=GS A0A3B6REH5_WHEAT/901-1035   AC A0A3B6REH5.1
#=GS A0A1U8BLM6_MESAU/1410-1551  AC A0A1U8BLM6.1
#=GS A0A401RSZ4_CHIPU/1632-1773  AC A0A401RSZ4.1
#=GS A0A445GA01_GLYSO/390-464    AC A0A445GA01.1
#=GS A0A668A3A0_9TELE/1269-1410  AC A0A668A3A0.1
#=GS A0A3Q1J171_ANATE/1260-1399  AC A0A3Q1J171.1
#=GS A0A4W5N8D5_9TELE/1205-1287  AC A0A4W5N8D5.1
#=GS A0A5F8GSU7_MONDO/1337-1478  AC A0A5F8GSU7.1
#=GS A0A1S3JBD3_LINUN/1386-1529  AC A0A1S3JBD3.1
#=GS A0A151JSY6_9HYME/1375-1522  AC A0A151JSY6.1
#=GS A0A2I2Y9R3_GORGO/1391-1532  AC A0A2I2Y9R3.1
#=GS A0A482WCC2_9CUCU/1262-1404  AC A0A482WCC2.1
#=GS A0A446X4T7_TRITD/897-1031   AC A0A446X4T7.1
#=GS A0A504Y5Z3_FASGI/1398-1531  AC A0A504Y5Z3.1
#=GS A0A4S4DHN3_CAMSI/153-205    AC A0A4S4DHN3.1
#=GS A0A670JZA0_PODMU/1383-1524  AC A0A670JZA0.1
#=GS A0A183J6U3_9BILA/56-196     AC A0A183J6U3.1
#=GS A0A665WK76_ECHNA/1078-1219  AC A0A665WK76.1
#=GS A0A4W5N9T8_9TELE/1216-1298  AC A0A4W5N9T8.1
#=GS A0A3S2NVP6_ORYJA/1410-1551  AC A0A3S2NVP6.1
#=GS A0A6A5FPP9_PERFL/1368-1509  AC A0A6A5FPP9.1
#=GS A0A3Q1ERH2_9TELE/1224-1365  AC A0A3Q1ERH2.1
#=GS A0A3Q3C8R0_HAPBU/1308-1449  AC A0A3Q3C8R0.1
#=GS A0A669F9I0_ORENI/1382-1523  AC A0A669F9I0.1
#=GS A0A132ALY3_SARSC/1358-1499  AC A0A132ALY3.1
#=GS A0A226P9Z1_COLVI/1323-1464  AC A0A226P9Z1.1
#=GS A0A669DKQ7_ORENI/1205-1346  AC A0A669DKQ7.1
#=GS A0A4W6CQ99_LATCA/1278-1419  AC A0A4W6CQ99.1
#=GS A0A402FR60_9SAUR/1336-1477  AC A0A402FR60.1
#=GS A0A671X494_SPAAU/1298-1439  AC A0A671X494.1
#=GS A0A3B6TFD4_WHEAT/940-1074   AC A0A3B6TFD4.1
#=GS I1K8P5_SOYBN/931-1067       AC I1K8P5.1
#=GS F6WR45_MOUSE/260-401        AC F6WR45.1
#=GS A0A2R9AWU7_PANPA/1355-1496  AC A0A2R9AWU7.1
#=GS G1L8H4_AILME/737-878        AC G1L8H4.1
#=GS A0A091INT1_EGRGA/1282-1423  AC A0A091INT1.1
#=GS A0A164YDQ3_9CRUS/1345-1486  AC A0A164YDQ3.1
#=GS A0A341CD88_NEOAA/1407-1548  AC A0A341CD88.1
#=GS A0A2I3RYT2_PANTR/1376-1517  AC A0A2I3RYT2.1
#=GS A0A2K6KY38_RHIBE/1251-1392  AC A0A2K6KY38.1
#=GS R7UTZ0_CAPTE/1175-1316      AC R7UTZ0.1
#=GS A0A674PIT9_TAKRU/1316-1457  AC A0A674PIT9.1
#=GS A0A3Q0FFZ7_VIGRR/68-173     AC A0A3Q0FFZ7.1
#=GS A0A2Y9GRV6_NEOSC/1414-1555  AC A0A2Y9GRV6.1
#=GS K3XUU3_SETIT/918-1054       AC K3XUU3.1
#=GS A0A1S3PYT1_SALSA/1390-1531  AC A0A1S3PYT1.1
#=GS A0A6J3QQ59_TURTR/1428-1569  AC A0A6J3QQ59.1
#=GS A0A1S3LDL7_SALSA/1334-1475  AC A0A1S3LDL7.1
#=GS G3RRA9_GORGO/1380-1521      AC G3RRA9.2
#=GS F1QWV5_DANRE/1391-1532      AC F1QWV5.2
#=GS A0A2H5NWW6_CITUN/921-1048   AC A0A2H5NWW6.1
#=GS A0A674N943_TAKRU/1179-1320  AC A0A674N943.1
#=GS A0A5F4VXV6_CALJA/1388-1529  AC A0A5F4VXV6.1
#=GS A0A2I4CIX7_9TELE/1402-1543  AC A0A2I4CIX7.1
#=GS A0A2Y9PW87_DELLE/1374-1515  AC A0A2Y9PW87.1
#=GS H9GBB5_ANOCA/1383-1524      AC H9GBB5.2
#=GS A0A6Q2WW00_ESOLU/1311-1435  AC A0A6Q2WW00.1
#=GS A0A183L4W3_9TREM/68-192     AC A0A183L4W3.1
#=GS A0A4W4DXB8_ELEEL/1208-1349  AC A0A4W4DXB8.1
#=GS A0A093IGF4_FULGA/1279-1420  AC A0A093IGF4.1
#=GS V7CUU2_PHAVU/933-1068       AC V7CUU2.1
#=GS A0A673BAH4_9TELE/98-239     AC A0A673BAH4.1
#=GS A0A4S8KFA9_MUSBA/838-895    AC A0A4S8KFA9.1
#=GS D8SVR2_SELML/937-1061       AC D8SVR2.1
#=GS A0A340X939_LIPVE/1362-1503  AC A0A340X939.1
#=GS A0A4W4EL23_ELEEL/1158-1294  AC A0A4W4EL23.1
#=GS A0A3Q0FG54_VIGRR/68-169     AC A0A3Q0FG54.1
#=GS G3QHS1_GORGO/1360-1501      AC G3QHS1.2
#=GS A0A673ZTY2_SALTR/1347-1488  AC A0A673ZTY2.1
#=GS V4UMD5_9ROSI/920-1056       AC V4UMD5.1
#=GS A0A3Q0GQX2_ALLSI/1316-1457  AC A0A3Q0GQX2.1
#=GS A0A182YBR9_ANOST/1451-1592  AC A0A182YBR9.1
#=GS G1TST9_RABIT/1408-1549      AC G1TST9.2
#=GS A0A1S3JCM7_LINUN/1354-1497  AC A0A1S3JCM7.1
#=GS A0A2Y9H4A8_NEOSC/1367-1508  AC A0A2Y9H4A8.1
#=GS A0A314L8W0_NICAT/947-1083   AC A0A314L8W0.1
#=GS A0A4W6CR27_LATCA/1138-1279  AC A0A4W6CR27.1
#=GS A0A669EFJ9_ORENI/1221-1362  AC A0A669EFJ9.1
#=GS A0A671Y9U0_SPAAU/1230-1371  AC A0A671Y9U0.1
#=GS A0A663FC47_AQUCH/1248-1389  AC A0A663FC47.1
#=GS A0A3Q3VJI6_MOLML/1240-1381  AC A0A3Q3VJI6.1
#=GS A0A267FTF7_9PLAT/1365-1503  AC A0A267FTF7.1
#=GS A0A0V0VYM5_9BILA/1343-1483  AC A0A0V0VYM5.1
#=GS A0A1L8FGE9_XENLA/1360-1501  AC A0A1L8FGE9.1
#=GS A0A665TRK5_ECHNA/1229-1370  AC A0A665TRK5.1
#=GS A0A2Y9R5K8_TRIMA/1202-1343  AC A0A2Y9R5K8.1
#=GS A0A3B6RAD7_WHEAT/924-1058   AC A0A3B6RAD7.1
#=GS A0A2I3MH45_PAPAN/1411-1542  AC A0A2I3MH45.1
#=GS A0A3P8S9Q1_AMPPE/1264-1405  AC A0A3P8S9Q1.1
#=GS A0A151MCQ8_ALLMI/1373-1514  AC A0A151MCQ8.1
#=GS A0A452SBN8_URSAM/1380-1521  AC A0A452SBN8.1
#=GS A0A455AQM4_PHYMC/1208-1349  AC A0A455AQM4.1
#=GS A0A4S2LMH8_OPIFE/1424-1554  AC A0A4S2LMH8.1
#=GS A0A3Q2CC07_CYPVA/1331-1472  AC A0A3Q2CC07.1
#=GS A0A4W5NFY6_9TELE/1079-1182  AC A0A4W5NFY6.1
#=GS A0A5F4CYP5_CANLF/1425-1566  AC A0A5F4CYP5.1
#=GS A0A0B1TI71_OESDE/975-1111   AC A0A0B1TI71.1
#=GS B4ML97_DROWI/1390-1531      AC B4ML97.2
#=GS A0A3Q2IB59_HORSE/1446-1587  AC A0A3Q2IB59.2
#=GS A0A670J553_PODMU/1156-1297  AC A0A670J553.1
#=GS A0A4W4EKV1_ELEEL/1355-1496  AC A0A4W4EKV1.1
#=GS L5JZA2_PTEAL/1382-1523      AC L5JZA2.1
#=GS A0A665WK20_ECHNA/1229-1370  AC A0A665WK20.1
#=GS A0A446X4V8_TRITD/48-182     AC A0A446X4V8.1
#=GS A0A2P8Y0H9_BLAGE/1033-1175  AC A0A2P8Y0H9.1
#=GS A0A091CJU8_FUKDA/1551-1692  AC A0A091CJU8.1
#=GS A0A3Q1M7P5_BOVIN/1251-1392  AC A0A3Q1M7P5.1
#=GS A0A453QY76_AEGTS/948-1082   AC A0A453QY76.1
#=GS W1P4K4_AMBTC/932-1067       AC W1P4K4.1
#=GS A0A2U1MBA5_ARTAN/1283-1419  AC A0A2U1MBA5.1
#=GS A0A4V5PAH5_MONMO/1386-1527  AC A0A4V5PAH5.1
#=GS A0A4P1RNQ2_LUPAN/909-1045   AC A0A4P1RNQ2.1
#=GS A0A674C299_SALTR/1162-1303  AC A0A674C299.1
#=GS A0A1S3P3A6_SALSA/1355-1496  AC A0A1S3P3A6.1
#=GS A0A2K3L1P5_TRIPR/353-427    AC A0A2K3L1P5.1
#=GS A0A2R8Y445_HUMAN/1373-1514  AC A0A2R8Y445.2
#=GS A0A671Y5R2_SPAAU/1401-1542  AC A0A671Y5R2.1
#=GS A0A6J3QQ45_TURTR/1434-1575  AC A0A6J3QQ45.1
#=GS A0A4W6FMM7_LATCA/1376-1517  AC A0A4W6FMM7.1
#=GS L9KQZ1_TUPCH/1524-1595      AC L9KQZ1.1
#=GS A0A3Q7RZR9_VULVU/1380-1521  AC A0A3Q7RZR9.1
#=GS A0A671VJ34_SPAAU/1274-1415  AC A0A671VJ34.1
#=GS A0A1S3E5W9_CICAR/929-1064   AC A0A1S3E5W9.1
#=GS A0A671WL18_SPAAU/1279-1420  AC A0A671WL18.1
#=GS A0A1D6NTP7_MAIZE/921-1056   AC A0A1D6NTP7.1
#=GS A0A1P6BYH3_BRUMA/1287-1427  AC A0A1P6BYH3.1
#=GS A0A2R9AXN6_PANPA/1353-1507  AC A0A2R9AXN6.1
#=GS A0A670JU54_PODMU/1343-1484  AC A0A670JU54.1
#=GS W5KNL0_ASTMX/1163-1304      AC W5KNL0.2
#=GS I3M162_ICTTR/1324-1465      AC I3M162.2
#=GS W2SVX7_NECAM/1302-1439      AC W2SVX7.1
#=GS A0A5E4BD84_MARMO/1259-1400  AC A0A5E4BD84.1
#=GS A0A016W857_9BILA/1280-1417  AC A0A016W857.1
#=GS A0A455ASS7_PHYMC/1204-1345  AC A0A455ASS7.1
#=GS A0A1S3M270_SALSA/1396-1537  AC A0A1S3M270.1
#=GS F7EP36_CALJA/1364-1505      AC F7EP36.3
#=GS A0A1A6HTQ8_NEOLE/1197-1338  AC A0A1A6HTQ8.1
#=GS A0A667YM20_9TELE/1197-1338  AC A0A667YM20.1
#=GS A0A1S3P3H7_SALSA/1377-1518  AC A0A1S3P3H7.1
#=GS A0A2A2LGU3_9BILA/1309-1448  AC A0A2A2LGU3.1
#=GS A0A1D6NTR6_MAIZE/615-750    AC A0A1D6NTR6.1
#=GS A0A674C0X6_SALTR/1248-1389  AC A0A674C0X6.1
#=GS A0A3Q0KIA2_SCHMA/1442-1575  AC A0A3Q0KIA2.1
#=GS A0A0B2VGY6_TOXCA/794-934    AC A0A0B2VGY6.1
#=GS A0A674C1G8_SALTR/1162-1303  AC A0A674C1G8.1
#=GS H2PXW2_PANTR/1354-1495      AC H2PXW2.2
#=GS A0A673Y917_SALTR/1159-1300  AC A0A673Y917.1
#=GS A0A452I167_9SAUR/1084-1225  AC A0A452I167.1
#=GS A0A4W4ERG8_ELEEL/1329-1470  AC A0A4W4ERG8.1
#=GS A0A0V1BE01_TRISP/1498-1579  AC A0A0V1BE01.1
#=GS A0A072V1N4_MEDTR/932-1068   AC A0A072V1N4.1
#=GS A0A1U8BIP4_MESAU/1404-1545  AC A0A1U8BIP4.1
#=GS A0A2R8Y8C1_HUMAN/1397-1538  AC A0A2R8Y8C1.1
#=GS A0A2K6FJ37_PROCO/1362-1503  AC A0A2K6FJ37.1
#=GS A0A2R9A4P1_PANPA/1380-1521  AC A0A2R9A4P1.1
#=GS A0A3Q2X3G3_HAPBU/1411-1552  AC A0A3Q2X3G3.1
#=GS A0A1S3N7M9_SALSA/1427-1568  AC A0A1S3N7M9.1
#=GS A0A671W9K3_SPAAU/1383-1524  AC A0A671W9K3.1
#=GS A0A3Q0FKF9_VIGRR/20-120     AC A0A3Q0FKF9.1
#=GS A0A2C9UD31_MANES/888-1024   AC A0A2C9UD31.1
#=GS G3UDS0_LOXAF/1213-1354      AC G3UDS0.1
#=GS A0A3Q4GAC6_NEOBR/1225-1366  AC A0A3Q4GAC6.1
#=GS A0A2G9GB02_9LAMI/468-540    AC A0A2G9GB02.1
#=GS A0A4W5NFJ5_9TELE/1139-1221  AC A0A4W5NFJ5.1
#=GS A0A3Q3GNL5_9LABR/898-1038   AC A0A3Q3GNL5.1
#=GS A0A3B6RAW0_WHEAT/924-1058   AC A0A3B6RAW0.1
#=GS A0A094ZWP0_SCHHA/1419-1540  AC A0A094ZWP0.1
#=GS H0VCI4_CAVPO/1368-1509      AC H0VCI4.2
#=GS A0A068VDI0_COFCA/929-1065   AC A0A068VDI0.1
#=GS A0A3Q3WYG3_MOLML/1329-1470  AC A0A3Q3WYG3.1
#=GS A0A2Y9R048_TRIMA/1208-1349  AC A0A2Y9R048.1
#=GS A0A090LJR9_STRRB/1243-1382  AC A0A090LJR9.1
#=GS A0A091GGJ8_9AVES/1373-1514  AC A0A091GGJ8.1
#=GS A0A2Y9L2U9_ENHLU/1373-1514  AC A0A2Y9L2U9.1
#=GS A0A5C6N7L5_9TELE/971-1104   AC A0A5C6N7L5.1
#=GS A0A452FFQ0_CAPHI/1373-1514  AC A0A452FFQ0.1
#=GS A0A670J166_PODMU/1315-1397  AC A0A670J166.1
#=GS A0A384CED3_URSMA/1340-1481  AC A0A384CED3.1
#=GS A0A2Y9HFK8_NEOSC/1429-1570  AC A0A2Y9HFK8.1
#=GS A0A250WUI6_9CHLO/318-467    AC A0A250WUI6.1
#=GS A0A3Q2CK44_CYPVA/1306-1447  AC A0A3Q2CK44.1
#=GS F1ST12_PIG/1370-1511        AC F1ST12.4
#=GS A0A6I8RG44_XENTR/1207-1348  AC A0A6I8RG44.1
#=GS A0A670J2L5_PODMU/1304-1386  AC A0A670J2L5.1
#=GS G3Q4E0_GASAC/1253-1394      AC G3Q4E0.1
#=GS A0A674F8T6_SALTR/1219-1360  AC A0A674F8T6.1
#=GS A0A0D3A2R0_BRAOL/506-650    AC A0A0D3A2R0.1
#=GS A0A4X3PWI4_PRIPA/1283-1421  AC A0A4X3PWI4.1
#=GS A0A0R4IM65_DANRE/939-1080   AC A0A0R4IM65.2
#=GS A0A0D3DVI4_BRAOL/955-1091   AC A0A0D3DVI4.1
#=GS A0A1S3N7L1_SALSA/1450-1591  AC A0A1S3N7L1.1
#=GS A0A670KE87_PODMU/1314-1455  AC A0A670KE87.1
#=GS A0A093CWW8_9AVES/1367-1508  AC A0A093CWW8.1
#=GS A0A2K6FW20_PROCO/1415-1556  AC A0A2K6FW20.1
#=GS A0A0V0UC29_9BILA/1399-1539  AC A0A0V0UC29.1
#=GS A0A2K5ZQG1_MANLE/1372-1513  AC A0A2K5ZQG1.1
#=GS A0A1S3PZ02_SALSA/1398-1539  AC A0A1S3PZ02.1
#=GS A0A2K6AMP5_MACNE/1209-1341  AC A0A2K6AMP5.1
#=GS A0A4W4DYQ0_ELEEL/1246-1387  AC A0A4W4DYQ0.1
#=GS A0A5F4C197_CANLF/1322-1463  AC A0A5F4C197.1
#=GS A0A2R8Y7M9_HUMAN/25-166     AC A0A2R8Y7M9.1
#=GS A0A3Q3BH47_KRYMA/1282-1423  AC A0A3Q3BH47.1
#=GS A0A665TJC7_ECHNA/1229-1370  AC A0A665TJC7.1
#=GS A0A5N5HP42_9ROSA/936-1070   AC A0A5N5HP42.1
#=GS A0A4U5U8V5_COLLU/1335-1476  AC A0A4U5U8V5.1
#=GS A0A1Y1HN26_KLENI/1081-1222  AC A0A1Y1HN26.1
#=GS A0A2Y9RQJ7_TRIMA/1380-1521  AC A0A2Y9RQJ7.1
#=GS A0A3Q7SUU9_VULVU/1400-1541  AC A0A3Q7SUU9.1
#=GS A0A4X2MBD8_VOMUR/1210-1351  AC A0A4X2MBD8.1
#=GS A0A5C7HZW6_9ROSI/930-1066   AC A0A5C7HZW6.1
#=GS A0A6I8RSM1_XENTR/1328-1469  AC A0A6I8RSM1.1
#=GS A0A3Q3L351_9TELE/1246-1387  AC A0A3Q3L351.1
#=GS A0A151N476_ALLMI/1303-1444  AC A0A151N476.1
#=GS A0A2Y9L8Z4_ENHLU/1408-1549  AC A0A2Y9L8Z4.1
#=GS A0A1J1IHS1_9DIPT/1367-1509  AC A0A1J1IHS1.1
#=GS A0A094KDC0_ANTCR/1358-1499  AC A0A094KDC0.1
#=GS A0A5B6WXS2_9ROSI/892-944    AC A0A5B6WXS2.1
#=GS A0A6G0YLF7_APHCR/1497-1622  AC A0A6G0YLF7.1
#=GS A0A091EIH5_CORBR/1381-1522  AC A0A091EIH5.1
#=GS A0A315VYW2_GAMAF/1482-1623  AC A0A315VYW2.1
#=GS A0A3P8V3N5_CYNSE/1277-1417  AC A0A3P8V3N5.1
#=GS A0A341AGY9_NEOAA/1408-1549  AC A0A341AGY9.1
#=GS A0A565CAW9_9BRAS/863-1003   AC A0A565CAW9.1
#=GS A0A2R9AVH2_PANPA/1368-1523  AC A0A2R9AVH2.1
#=GS A0A452I1R6_9SAUR/1088-1229  AC A0A452I1R6.1
#=GS A0A669BBN5_ORENI/1248-1389  AC A0A669BBN5.1
#=GS A0A673Y790_SALTR/1182-1323  AC A0A673Y790.1
#=GS A0A183A8N5_9TREM/1450-1575  AC A0A183A8N5.1
#=GS W5PVC6_SHEEP/1372-1514      AC W5PVC6.1
#=GS A0A158PDV7_ANGCS/1134-1273  AC A0A158PDV7.1
#=GS A0A4E0RB07_FASHE/1545-1682  AC A0A4E0RB07.1
#=GS A0A6J3S852_TURTR/1380-1521  AC A0A6J3S852.1
#=GS A0A3Q3WNK6_MOLML/1259-1400  AC A0A3Q3WNK6.1
#=GS A0A452GRV2_9SAUR/1163-1304  AC A0A452GRV2.1
#=GS A0A452SA75_URSAM/1170-1311  AC A0A452SA75.1
#=GS A0A2Y9PW74_DELLE/1374-1515  AC A0A2Y9PW74.1
#=GS A0A093PIK8_9PASS/1380-1521  AC A0A093PIK8.1
#=GS A0A484C6U9_PERFV/1415-1556  AC A0A484C6U9.1
#=GS CHD5_MOUSE/1390-1531        AC A2A8L1.1
#=GS A0A2P6PYC2_ROSCH/936-1072   AC A0A2P6PYC2.1
#=GS H2LS61_ORYLA/1314-1455      AC H2LS61.2
#=GS A0A671X6B3_SPAAU/1295-1436  AC A0A671X6B3.1
#=GS A0A673BGR5_9TELE/1283-1424  AC A0A673BGR5.1
#=GS A0A665VC84_ECHNA/1274-1415  AC A0A665VC84.1
#=GS A0A4X2MD02_VOMUR/1210-1351  AC A0A4X2MD02.1
#=GS A0A485NGS8_LYNPA/1250-1391  AC A0A485NGS8.1
#=GS A0A2K5UJJ5_MACFA/1376-1517  AC A0A2K5UJJ5.1
#=GS A0A3Q7GVY3_SOLLC/824-960    AC A0A3Q7GVY3.1
#=GS A0A446Y4J7_TRITD/924-1058   AC A0A446Y4J7.1
#=GS A0A4W6CQU8_LATCA/1187-1327  AC A0A4W6CQU8.1
#=GS A0A669D1V1_ORENI/1213-1348  AC A0A669D1V1.1
#=GS A0A4W2EL12_BOBOX/1387-1528  AC A0A4W2EL12.1
#=GS A0A2G5EYW4_AQUCA/933-1072   AC A0A2G5EYW4.1
#=GS A0A4Y7LK37_PAPSO/934-986    AC A0A4Y7LK37.1
#=GS A0A2K5QED7_CEBCA/1355-1496  AC A0A2K5QED7.1
#=GS A0A1S3M2E2_SALSA/1400-1541  AC A0A1S3M2E2.1
#=GS A0A674DKY8_SALTR/1300-1441  AC A0A674DKY8.1
#=GS A0A3Q3FAJ0_9LABR/1417-1558  AC A0A3Q3FAJ0.1
#=GS A0A671WWZ5_SPAAU/1378-1519  AC A0A671WWZ5.1
#=GS A0A3P8HNC0_9TREM/1332-1464  AC A0A3P8HNC0.1
#=GS E4Y195_OIKDI/1023-1166      AC E4Y195.1
#=GS F7FFR7_MONDO/1319-1460      AC F7FFR7.2
#=GS A0A4W6EIP3_LATCA/1274-1415  AC A0A4W6EIP3.1
#=GS A0A3Q3CWK4_HAPBU/1244-1385  AC A0A3Q3CWK4.1
#=GS A0A151X8W2_9HYME/1338-1485  AC A0A151X8W2.1
#=GS A0A091CMZ7_FUKDA/1612-1753  AC A0A091CMZ7.1
#=GS A0A2K5S0D7_CEBCA/98-239     AC A0A2K5S0D7.1
#=GS A0A6I8R9W6_XENTR/1346-1487  AC A0A6I8R9W6.1
#=GS A0A2K5WE20_MACFA/1251-1392  AC A0A2K5WE20.1
#=GS A0A1S4DZ79_CUCME/934-1070   AC A0A1S4DZ79.1
#=GS H0X1S9_OTOGA/1408-1549      AC H0X1S9.1
#=GS A0A3Q0FS67_ALLSI/1391-1532  AC A0A3Q0FS67.1
#=GS A0A2K5WA38_MACFA/1380-1521  AC A0A2K5WA38.1
#=GS A0A3P6V9J1_LITSI/1287-1427  AC A0A3P6V9J1.1
#=GS S9XFG7_CAMFR/1201-1342      AC S9XFG7.1
#=GS A0A2I0WRL0_9ASPA/958-1095   AC A0A2I0WRL0.1
#=GS A0A455ATY5_PHYMC/1373-1514  AC A0A455ATY5.1
#=GS A0A6I8P485_ORNAN/1347-1488  AC A0A6I8P485.1
#=GS A0A6J3QQ54_TURTR/1434-1575  AC A0A6J3QQ54.1
#=GS A0A1S3M2D6_SALSA/1403-1544  AC A0A1S3M2D6.1
#=GS A0A0L8HB58_OCTBM/1197-1339  AC A0A0L8HB58.1
#=GS A0A1J6ICC5_NICAT/930-1066   AC A0A1J6ICC5.1
#=GS S8DRK3_9LAMI/836-929        AC S8DRK3.1
#=GS A0A3Q1CFT1_AMPOC/1412-1553  AC A0A3Q1CFT1.1
#=GS A0A2Y9HLW4_NEOSC/1429-1570  AC A0A2Y9HLW4.1
#=GS A0A1S3P3H8_SALSA/1384-1525  AC A0A1S3P3H8.1
#=GS A0A2K5WAA7_MACFA/1360-1501  AC A0A2K5WAA7.1
#=GS A0A3P9P3L3_POERE/1297-1438  AC A0A3P9P3L3.1
#=GS A0A3S5WGG7_9MAGN/961-1094   AC A0A3S5WGG7.1
#=GS A0A368UK75_SOYBN/865-1000   AC A0A368UK75.1
#=GS A0A452GTI5_9SAUR/1243-1384  AC A0A452GTI5.1
#=GS A0A1U8I6U9_GOSHI/931-1067   AC A0A1U8I6U9.1
#=GS A0A1D5PXG3_CHICK/1385-1526  AC A0A1D5PXG3.2
#=GS A0A1Y3B704_EURMA/302-446    AC A0A1Y3B704.1
#=GS A0A452GJK4_9SAUR/1367-1508  AC A0A452GJK4.1
#=GS A0A2Y9HFV3_NEOSC/1197-1338  AC A0A2Y9HFV3.1
#=GS A0A067FJ95_CITSI/936-1072   AC A0A067FJ95.1
#=GS H0ZSY1_TAEGU/1373-1514      AC H0ZSY1.2
#=GS A0A1U8BUZ5_MESAU/1410-1551  AC A0A1U8BUZ5.1
#=GS A0A0V0WK91_9BILA/1492-1627  AC A0A0V0WK91.1
#=GS A0A4W4FRK2_ELEEL/1319-1460  AC A0A4W4FRK2.1
#=GS A0A673Y162_SALTR/1241-1382  AC A0A673Y162.1
#=GS A0A4W4DY94_ELEEL/1242-1383  AC A0A4W4DY94.1
#=GS A0A218UKV9_9PASE/1388-1529  AC A0A218UKV9.1
#=GS A0A5F7ZMT0_MACMU/1388-1529  AC A0A5F7ZMT0.1
#=GS A0A1V9X3W4_9ACAR/1351-1491  AC A0A1V9X3W4.1
#=GS A0A0E0L8N4_ORYPU/969-1030   AC A0A0E0L8N4.1
#=GS H0W109_CAVPO/1378-1519      AC H0W109.2
#=GS A0A674H437_TAEGU/1305-1446  AC A0A674H437.1
#=GS A0A2G9HD87_9LAMI/933-1065   AC A0A2G9HD87.1
#=GS A0A3S2MCB1_ORYJA/1396-1537  AC A0A3S2MCB1.1
#=GS G3WNE2_SARHA/1330-1471      AC G3WNE2.1
#=GS A0A1U8D4V2_MESAU/306-447    AC A0A1U8D4V2.1
#=GS A0A4W5RUH2_9TELE/1328-1469  AC A0A4W5RUH2.1
#=GS A0A674HM79_TAEGU/1378-1519  AC A0A674HM79.1
#=GS A0A2K6L7E5_RHIBE/1373-1528  AC A0A2K6L7E5.1
#=GS A0A0D2QK86_GOSRA/934-1070   AC A0A0D2QK86.1
#=GS A0A094ZZ08_SCHHA/1375-1508  AC A0A094ZZ08.1
A0A2K5PFP5_CEBCA/1356-1497             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W6CQN2_LATCA/1355-1496             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A556V630_BAGYA/1240-1403             ..............yvvreedgeeevqreiikqeenvdpdywekllrhhye--------..---.-.--.-.Q.....QQ.E..DL..ARNL..G.K...G.KR.IrkQ...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLKG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............L........KKLTES.---------lssdpntp..............................
A0A2K6SN26_SAIBB/1361-1502             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4E0RJA1_FASHE/1398-1531             ..............................................lpvtg--------..--R.R.TR.R.E.....RE.G..RM.pPVLS..R.I...N.GQ.I..E...........VL.GF...NS.RQRR.SFLNA..IM..R.............YGL..................PPS.D.QP...W......N...............V....RELRC.....K.PDRV......MR................AYTSLF.MRHMC..E.P...D...T...D.N..SD..TF..................SDG.VPRE....GM....SP....QHV.LSRIGIMALVRRK............V........REFENI.NGHFSMPE-a.....................................
A0A3P8RTH8_AMPPE/1306-1447             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K6SKA6_SAIBB/1414-1545             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....--....---.-----IMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1S3U4M9_VIGRR/933-1068              .................................................gt--TTAKRP..YKK.K.AR.-.N.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIS..E.D...I...-...T.E..SS..TF..................SDG.VPKD....GL....RI....QDV.LVRIAVLLLIRDK............V........KFASQN.PQTPLFSD-d.....................................
A0A3P9AY62_9CICH/1289-1430             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4U5MQ42_STECR/1320-1458             ..............................................tpgge------RR..RRK.G.DR.-.-.....SD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NS.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.TQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GM....NR....QHV.LTRIGIMALIRKK............V........QEFDSV.NGEWSVPE-i.....................................
A0A2K5WDX8_MACFA/1392-1533             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2I3TPK6_PANTR/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5N5L532_PANHP/1352-1493             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLKG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6I8QY33_XENTR/1230-1371             ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEQV.NGKYSTPD-l.....................................
A0A0V1HWI4_9BILA/1359-1499             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDAY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A5E4E701_PRUDU/933-1069              ................................................gtl---SGRKP..NKK.R.SR.V.D.....SA.E..PP..PLME..G.E...G.RS.F..K...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GEY.D.WK...E......F...............T....PRMKQ.....K.TFEE......IE................NYGRLF.LAHIA..E.E...M...-...T.D..SP..TF..................SDG.VPKE....GL....RI....GDV.LCRIAVLMQMQQR............V........DLASKN.PGAPLFSE-d.....................................
A0A0V1BDQ2_TRISP/1383-1526             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQcafR......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A2I3HBW2_NOMLE/1387-1528             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1D5RBC8_MACMU/1435-1576             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5N4C6T8_CAMDR/1418-1559             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0C2CR21_9BILA/594-731               ..............................................gvgge--------..-RK.K.KR.E.R.....ES.E..KL.pPLLA..K.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.SQ...W......L...............T....RDLKG.....K.SERA......FK................TYTSLF.MRHLC..E.P...G...A...D.T..QE..TF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEQV.NGEWSMPE-m.....................................
F7DE19_XENTR/1323-1464                 .................................................rs--EAARRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
CHD5_HUMAN/1388-1529                   ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
H2NSL6_PONAB/1310-1435                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........--.--...-N.TQRA.L---A..VM..R.............W--..................---.M.PQ...T......L...............I....QLRDR.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3Q1IBQ1_ANATE/1350-1490             ................................................erp---EGRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......F-................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A5J4NNX1_9TREM/834-967               ..........................................dkwrevank--------..---.-.--.-.-.....--.-..-M.gPKIT..W.E...Y.GH.M..F...........IY.GF...GP.DDRQ.SFANA..VM..R.............YGLpp..............pgIVP.P.QD...W......L...............P....PNLFY.....K.SPPR......VF................AYMALF.MQHLY..D.DpnaI...D...D.S..ID..SW..................SDG.LPKE....KL....CG....AAV.LARIAMMTLIRNK............V........MQFEDV.NGVHS----rtf...................................
H3CRG9_TETNG/1312-1453                 .................................................er--TNSRRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3P6GEV0_9CEST/963-1053              ...............................................pppe--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...W......L...............P....FSLRS.....K.PPLS......LF................AYTNLF.MRHLY..E.D...P...K...VlD..TE..TLsqpk.........fpprwSDG.LPTE....GV....SG....IMV.LSRIAMIALIRAK............V........IQFEDY.NA-------vprry.................................
A0A0D3A2Q9_BRAOL/909-1044              ..................................................g-NQMAKRP..YHR.T.--.S.D.....TL.K..PI..PLIE..G.E...G.RF.L..K...........VL.GF...NE.LQRK.KFLTT..LE..R.............YGV..................GNY.D.WK...E......F...............V....DPLKP.....R.TYDE......IK................NYGLRF.LKHIV..E.D...K...D...V.N..SP..TF..................SDG.VPKE....EL....KC....KDV.LARIASVMLVQKK............V........KHMEAN.PRNPVFSD-r.....................................
A0A0T6B4S0_9SCAR/425-567               ..............................................endls-----RRS..RRR.M.ERkD.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKI......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGEYSMPE-a.....................................
A0A674MGA3_TAKRU/1401-1542             .................................................se--ANSRRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
F7ENN8_ORNAN/1381-1522                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669CU59_ORENI/1219-1360             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A665TPT9_ECHNA/1192-1332             ............................................dertegl--------..KKK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A665WLL9_ECHNA/1116-1257             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A0S3RP76_PHAAN/1-114                 ...................................................--------..---.-.--.-.-.....--.-..--..--ME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...E......F...............A....SRMKH.....K.SYEE......IT................EYGKLF.LSHIA..E.D...I...-...T.D..SP..TF..................TDG.VPKE....GL....RI....QDV.LVRIALLNLISEK............V........KFASEN.PGLDLFS--ad....................................
A0A2T7PPK4_POMCA/1273-1414             ...............................................kdgd----QTRS..RSR.R.RG.N.E.....KD.R..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.TEKV......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGTHSMPY-l.....................................
A0A671WNP1_SPAAU/1375-1516             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A674A5E8_SALTR/1309-1450             ................................................rae---GKRKP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A6I8SWS1_XENTR/1230-1371             ................................................aeg---KSRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.S.TH...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSMPE-l.....................................
A0A2K6MIX9_RHIBE/1405-1546             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
H2QC61_PANTR/1434-1575                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A446Y4P4_TRITD/897-1031              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A6I8SNL5_XENTR/1369-1510             .................................................rs--EAARRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3M229_SALSA/1403-1544             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K5WDV2_MACFA/1371-1512             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W5KN59_9TELE/1309-1442             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........R-----.---------gqsftv................................
A0A5A7VBI4_CUCME/948-1084              ................................................gvp---SVKKP..YRR.K.SR.V.D.....ST.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............I....SRMKQ.....K.TYEE......IK................EYGTLF.LSHIA..E.D...I...-...T.E..SP..NF..................SDG.VPKE....GL....RI....QDV.LIRIAVLLLIRDK............A........KVVPEN.PSTPLFTD-d.....................................
A0A2G5EYX2_AQUCA/933-1072              .............................................gtaagr------KPqiSKK.K.SR.V.D.....GV.E..PL..PLLE..G.E...G.KS.L..K...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WS...E......F...............T....PRLKQ.....K.TFEE......IR................EYGTLF.LSHIA..E.D...I...-...T.E..SP..SF..................SDG.VPKE....GL....RI....HDV.LVRIAVLLLFREK............V........KKLQSVkPGTLLF---ded...................................
A0A3B1JZW7_ASTMX/99-240                ................................................erp---EGRRQ..SRR.Q.IR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSIPE-l.....................................
A0A341BPI2_NEOAA/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A484GHR7_SOUCH/1343-1484             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1D6NTR8_MAIZE/615-750               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A2G9R713_LITCT/1089-1163             .................................................rs--EAARRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------wiysvisvde............................
M0SQU0_MUSAM/924-1059                  ...........................................vsgrrgqf--------..SKR.K.TR.-.G.....YL.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.NQRS.LFQQL..VM..R.............FGF..................HDY.S.WK...E......Y...............L....PRLKG.....K.SWQE......VQ................DYAELF.MRHLQ..E.D...I...-...T.D..LP..NF..................SDG.VPKE....GA....RV....DDI.LVRIAHIQLIEEK............M........KFMREN.PGANLFPE-d.....................................
A0A4S2LP38_OPIFE/1424-1554             ........................................reavnkldaki--------..---.-.--.-.-.....--.-..--..---T..C.E...N.GH.M..F...........IY.GF...GP.ENRT.SFANA..VM..R.............YGLp...............ppGIIpP.QD...W......L...............P....PSLFH.....I.GQQR......LY................AYTALF.MYHLY..A.D...PnalD...D.T..VD..HW..................SDG.IPKE....NL....CA....SAV.LSRIAMMALIRNK............V........LQFEDI.NGVHS----rtf...................................
A0A674DIC9_SALTR/1330-1471             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2U3ZUI7_ODORO/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
E2R1M3_CANLF/1207-1348                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A158QCK4_HYMDI/1389-1510             ..............................................dvvwd--------..---.-.--.-.-.....--.-..--..----..-.-...G.DN.M..K...........VY.GL...NA.HDRQ.SYLDC..LM..K.............HGLp...............ppGPIpP.PE...W......L...............S....TLLLS.....K.RPEQ......IY................AYHTLF.MRHLY..N.DckiI...D...P.E..AL..HW..................SDG.LPNE....GV....NP....VAV.LSRVGAISLIRGK............V........IEFEDT.NM-------vpkkfk................................
A0A2K6SKI5_SAIBB/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2Y9EIZ4_PHYMC/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6Q2ZMS6_ESOLU/1356-1497             .................................................ae--ANSRRP..NRK.G.LR.G.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A5E4B491_MARMO/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A210Q7X7_MIZYE/1349-1490             .................................................ed--KESASK..SRR.R.ER.N.D.....RD.R..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRN.....K.SEKV......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEQI.NGVHSMPY-l.....................................
A0A3P9AEZ6_ESOLU/1305-1446             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A2K5QEE1_CEBCA/1355-1496             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9QXR6_TRIMA/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2H5NW06_CITUN/919-1046              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGILF.LTHIT..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVKFLSQ--............-........------.---------kpgtplftd.............................
F1SSZ2_PIG/1388-1529                   ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1S3PYU9_SALSA/1382-1523             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A671Y5S0_SPAAU/1349-1490             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A287CTW0_ICTTR/1342-1483             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3Q0FG10_VIGRR/68-150                ........................................etptptrrgkk--------..---.-.IC.S.G.....IP.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................DFY---.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------cipfslw...............................
H9G6J6_ANOCA/1403-1544                 ..................................................e-GQSGRRQ..SRR.Q.LK.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEPV.NGKYSTPD-r.....................................
A0A226MYT2_CALSU/1373-1514             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A453QYB8_AEGTS/230-364               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A4W6EEB1_LATCA/1267-1410             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........L-----.---------vpqpkafstqntkfsa......................
A0A212DAI3_CEREH/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A067FJA4_CITSI/934-1016              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYLT--.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------elcfi.................................
A0A446Y4P0_TRITD/786-920               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
B4H036_DROPE/1239-1380                 ..............................................eqngg-----ERR..GKR.R.VD.R.R.....DD.R..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-i.....................................
A0A6Q2XGW0_ESOLU/1298-1439             .................................................ae--ANSRRP..NRK.G.LR.G.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W6CQ54_LATCA/1359-1500             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q1BGN4_AMPOC/1243-1384             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1Q3AW41_CEPFO/931-1067              ..................................................g-TQSGRKS..CKK.R.AR.V.D.....ST.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GEF.D.WK...E......F...............T....GRLKQ.....K.SFEE......IH................EYGKVF.LSHIA..E.D...L...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFSLEK.PGTPPFTD-d.....................................
A0A5F5PN79_HORSE/1431-1572             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6J3S7I5_TURTR/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0R3R4P1_9BILA/438-580               ...............................................efds-----TQQ..GKK.R.HR.D.R.....GD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNAvmLM..R.............WGMp...............pqDTY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEVS.NGEWSMPE-t.....................................
A0A3Q7W044_URSAR/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2A3EEQ6_APICC/1375-1531             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......LvirsrynpqsenlklV....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A5J5D429_9PERO/495-636               .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A6I8P9R5_ORNAN/1231-1372             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0L7QSS6_9HYME/1304-1445             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..MF..................ADG.VPRE....GL....NR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A6I8QYE2_XENTR/1232-1373             ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEQV.NGKYSTPD-l.....................................
A0A0D2VEQ1_GOSRA/931-1067              .................................................vn--QPGRKP..YRK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SHDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSKK............V........KDASEK.PGTRLFTD-d.....................................
A0A3Q3KQT9_9TELE/1401-1542             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4S4EA66_CAMSI/1036-1167             .................................................il---TGRRP..YRK.K.IR.V.D.....SA.E..SL..PLME..G.E...G.RS.F..R...........VK.GF...NQ.NQRA.AFVQI..MM..R.............FGV..................GEF.D.WA...E......F...............T....PRLKQ.....K.TCEE......IK................EYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLLLIRDK............G........D-----.---------akanetpiee............................
L8HVA0_9CETA/1408-1549                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
M3ZFU1_XIPMA/1296-1437                 .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A182GNW3_AEDAL/1399-1540             ...............................................lnrr---SKRRI..ERN.Q.SE.-.R.....DN.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A455ASS0_PHYMC/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5N3X5F1_MUNRE/1433-1574             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0E0L8N5_ORYPU/969-1030              ..................................................r--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................-YAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A401Q8T7_SCYTO/42-183                ................................................erp---EGRRQ..SRR.Q.LR.G.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqEAF.N.SQ...W......L...............V....RDLRG.....K.SETE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
I3JIX2_ORENI/1376-1517                 .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1S3LDL6_SALSA/1385-1526             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
G3RCF2_GORGO/1376-1517                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3Q7S5I7_VULVU/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0D9S8T5_CHLSB/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6J3S7J0_TURTR/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
H2LPE8_ORYLA/1373-1514                 .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
V8NU88_OPHHA/1374-1515                 .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A670J3A9_PODMU/1277-1418             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEPV.NGKYSTPD-l.....................................
A0A6I8SAW7_XENTR/1147-1288             ................................................aeg---KSRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.S.TH...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSMPE-l.....................................
A0A3Q0FG68_VIGRR/44-140                ........................................srdgtstkgip--------..---.-.--.-.-.....--.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdist.............................
A0A4W6CR21_LATCA/1275-1416             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
M7ASQ0_CHEMY/1265-1406                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A5N5JG72_PANHP/1380-1521             .................................................ae--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W5NWN4_9TELE/1319-1460             .................................................re--SNSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A5F4CL47_CANLF/1425-1566             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2R8Y425_HUMAN/1356-1497             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W5PIQ2_9TELE/1216-1357             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
E2RTI2_CANLF/1353-1494                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2K5S0D1_CEBCA/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2P5WH70_GOSBA/966-1102              ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIS..E.D...I...-...T.E..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLISNK............V........KTASEH.PGTRLFTD-d.....................................
H3CKU8_TETNG/14-70                     .................................................at---SSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGM..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------ppqd..................................
A0A668AW64_9TELE/1300-1441             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A087RH92_APTFO/1380-1521             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A384BUS1_URSMA/1382-1523             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SH...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A341AG38_NEOAA/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A226EM65_FOLCA/1334-1474             ...............................................ggrr-----RRR..GMD.N.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.TQ...W......L...............V....RDLRG.....K.AEKC......FK................AYVSLF.MRHLC..E.P...G...A...D.N..TE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMALIRKK............V........QEFEHI.NGLYSMPE-v.....................................
A0A3Q7S8C3_VULVU/1379-1520             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4U5QK80_POPAL/967-1103              .................................................gi--QTIKRP..YKK.K.GR.V.D.....NM.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.TFVQI..LM..R.............YGV..................GNY.D.WK...E......F...............A....PRLKQ.....K.TYEE......VE................NYGRLF.LTHIA..E.D...L...-...S.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LIRIAVLLLIRDK............A........RFASEN.PGSLLYT--dd....................................
A0A2I4BGD7_9TELE/1379-1520             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2R6QMP8_ACTCC/932-1068              ................................................gip---AGRRP..YKK.K.AR.V.N.....SA.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRT.AFVQI..LM..R.............FGV..................GEY.D.WA...E......F...............A....PRLKQ.....K.TYEE......IK................EYGRLF.LSHIA..E.D...I...-...T.D..SL..TF..................TDG.VPKE....GL....RI....QDV.LVRLAQLMLIRDK............V........KYAPEK.PGSPLFAD-d.....................................
A0A4W4DXI6_ELEEL/105-246               ................................................erp---EGRRQ..SRR.Q.IR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSIPE-l.....................................
A0A553MTE5_9TELE/1438-1563             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsmp.........................
A0A218U8V8_9PASE/1351-1470             ..........................................pdvpnvpsm--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.S..Q...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A1U8HVK9_GOSHI/931-1067              .................................................vn--QPGRKP..YRK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SHDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSKK............V........KDASEK.PGTRLFTD-d.....................................
A0A671X2R0_SPAAU/1283-1424             ...............................................rpeg----GRRH..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A1S3P3I2_SALSA/1377-1518             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1R3J799_9ROSI/220-297               .................................................gn--QPGRRA..YRK.R.AR.T.D.....NT.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GEW.D.WK...E......F...............A....ARLKQ.....K.TYEE......IN................EYA---.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------n.....................................
A0A4W5RY56_9TELE/1295-1436             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W4DWC9_ELEEL/1219-1360             ................................................erp---EGRRQ..SRR.Q.IR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSIPE-l.....................................
A0A674F7F8_SALTR/1219-1360             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A674DIW8_SALTR/1272-1413             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A672J3L3_SALFA/1185-1326             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2Y9T6M3_PHYMC/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4W5KM41_9TELE/1278-1419             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A673ZYC6_SALTR/1340-1480             ..............................................derae------GK..RKK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K5XUW9_MANLE/1346-1487             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669EYF8_ORENI/1310-1451             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K5UJU6_MACFA/1194-1325             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5N3XV18_MUNRE/1362-1500             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VK.GP...RW.WPR-.VWPPA..WS..G.............QAP..................LDG.P.AQ...W......A...............V...lLPGWG.....R.PENS......LL................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K6DCX4_MACNE/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4S4DHN3_CAMSI/202-262               ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................-YGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPK-....GL....RI....EDV.LVRIAVLLLIRDK............V........KAASEK.PGTPLFPD-d.....................................
A0A2K6FW53_PROCO/1429-1570             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A251TEL3_HELAN/1046-1182             ...............................................giap----ARKP..YRK.K.TR.V.D.....NA.E..QL..PLME..G.E...G.RA.F..R...........VL.GF...NQ.SQRA.QFVQI..LM..R.............FGV..................GDF.D.WA...E......F...............T....SRLKQ.....K.SYEE......IK................VYGTLF.LSHIS..E.D...I...-...T.D..AA..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLLLVRDK............V........KSSSEN.PSAPLFTD-d.....................................
A0A6I8RYI3_XENTR/1239-1380             ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEQV.NGKYSTPD-l.....................................
A0A267FST8_9PLAT/1379-1517             ...........................................egegqagg--------..--R.R.-R.R.D.....RD.V..KM.pPLLS..K.L...N.NQ.I..E...........VF.GF...NP.RQRR.AFLNA..IM..R.............YGLp...............psEVY.N.SP...W......M...............S....RDLRS.....K.PEKV......FR................AYTALF.MRHLC..E.P...D...S...D.V..TD..TF..................SDG.VPRE....GI....NR....QHV.LTRIGIMALLRKK............V........QEFEKV.NGEYSMPS-m.....................................
A0A0H2UHP5_RAT/1386-1527               ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3Q3SPR1_9TELE/1371-1512             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W2EH06_BOBOX/1388-1529             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A022PZA4_ERYGU/934-1066              .................................................ga--AAVRRP..YRK.R.VR.-.D.....TS.E..KL..PLLE..G.E...G.RY.L..R...........VL.GF...NQ.NQRA.VFVQI..LM..R.............FGI..................GDC.D.WV...E......F...............A....PRLKQ.....K.TYEE......IN................DYGRLF.LEHMS..E.E...L...-...T.D..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRIGTLTLFREK............V........NALSEC.PT-------lftd..................................
A0A2Y9NDW2_DELLE/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4S2M113_OPIFE/1423-1556             ...............................................llam--------..-AR.R.TR.R.E.....RE.G..RL.pPLLS..R.V...S.GQ.I..E...........VL.GF...NV.RQRR.SFLNA..IM..R.............YGL..................PSL.E.LL...S......T...............V....RDLRC.....K.PDRV......LR................AYISLF.LRHLC..E.P...E...T...T.T..SD..TF..................SDG.VPRE....GI....AP....QHV.LSRIGIMALVAKK............V........KEFERI.NGRWSIPE-l.....................................
A0A078IWX8_BRANA/919-1055              ..................................................g-NQTGRRP..YRR.K.GR.-.D.....NS.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............FGV..................GNY.D.WK...E......F...............V....PRLKQ.....K.TYDE......IK................EYGVLF.LKHIA..E.D...I...D...E.N..SS..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLMLVQEK............V........KLVEDH.PGKPVFPN-r.....................................
A0A445B4X2_ARAHY/33-88                 ......................................cllspnlslmysp--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................VDG.VPKE....GL....RI....QDV.LVRIALLLLIRDK............V........KSASRN.LGTPLFSD-d.....................................
A0A674AVQ5_SALTR/1395-1536             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A671VNA1_SPAAU/1271-1412             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
G5C570_HETGA/1660-1772                 ................................................ppa--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..Q...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A673BKA3_9TELE/1275-1416             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2G8L6K2_STIJA/626-753               .............................................edfdes-------K..EVR.K.SR.R.E.....KE.K..LP..PLLA..R.V...G.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDPY.N.SQ...W......L...............V....RDLRG.....K.PERH......FK................AYVSLF.MRHLC..E.P...G...S...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............F........------.---------gkk...................................
A0A2K1WUI8_POPTR/937-1073              .................................................gi--QTLKRP..YKK.K.GR.V.D.....NM.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............YGV..................GDY.D.WK...E......F...............A....PRLKQ.....K.TYEE......VE................NYGRLF.LTHIA..E.D...L...-...S.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LIRIAVLLLIRDK............A........RFASEN.PGSLLYT--dd....................................
A0A0L8HCR4_OCTBM/1196-1338             ................................................edk---QESRS..NRK.RsGV.S.D.....RD.K..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKV......FR................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGTHSMPY-m.....................................
A0A6Q2ZPC2_ESOLU/1288-1429             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
K7GBZ7_PELSI/1381-1522                 .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2P6VJE1_9CHLO/2160-2295             ...........................................slrplggw--------..---.-.--.-.-.....--.-..--..PKVL..G.G...G.GA.A..R...........VW.GF...TA.MQRE.CFAQL..VM..L.............FGVhs.............aadGAF.D.WS...T......M...............Q....SIFST.....K.RPED......VA................KYGEML.MGALA..A.A...T...A...S.G..SG..AApak............fapADG.VPLDallcGI....PA....PDM.LQRVGLLHLLAAS............L........EELEQ-.---------gmarqp................................
R7TBU1_CAPTE/407-551                   .............................................eekiek---RRKKK..ELK.V.QK.N.E.....AM.E..MP..PLLC..R.V..tN.EN.V..Q...........VL.GF...TA.RQRR.AFLDA..VM..C.............YGMp...............peDAY.R.SQ...W......L...............V....RELRC.....K.PERV......FK................AYVSLF.MRHLC..E.P...V...A...E.H..AE..VF..................ADG.VPCE....GL....SR....QHV.LTRIGIMALLRKK............V........HDFEKV.QGTSSMKS-y.....................................
A0A158R806_TAEAS/1440-1595             ............................................egmgsqi--------..-GR.R.VR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NI.RQRR.AFVNS..VL..R.............YGLppppssls..magvpaasATA.S.TA...W......H...............S....RDLKG.....K.PERV......FR................AYVALF.MRHLC..E.P...EsmnQ...D.N..NA..TY..................SDG.TPRD....GI....SH....QPI.LSRIGIMALVRKK............V........QEFEQI.NGLYSIPD-s.....................................
A0A674H0D8_TAEGU/98-233                ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........R-----.---------ghpgdtag..............................
A0A3Q0GVG0_ALLSI/1316-1457             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A287DFP2_ICTTR/1361-1502             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6A5M2U5_LUPAL/930-1066              .................................................ga--TSARRP..YKK.K.AR.A.E.....NT.E..PL..PLME..G.V...G.RS.F..R...........VL.GF...NQ.IQRA.MFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRMKQ.....K.TYEE......IK................DYGILF.FSHIA..E.D...I...-...T.D..SS..TF..................ADG.VPKE....GL....RI....QDV.LVRIAILSLIRDK............V........KFASEN.PQNALFSD-d.....................................
A0A2I0MLN9_COLLI/1373-1514             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3S3PV35_9ACAR/1215-1351             .........................................wekllrhhye--------..---.-.--.-.Q.....QQ.E..DL..ARTL..G.K...G.KR.VrkQ...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FR................AYVSLF.MRHLC..E.P...G...A...D.N..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRVGIMSLIRKK............V........QEFEHI.NGTQSMP--i.....................................
A0A1U8CW16_MESAU/95-236                ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1P6BYH5_BRUMA/1277-1417             ...............................................efds-----TQQ..GKK.R.HR.D.R.....GD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDTY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEVS.NGEWSMPE-t.....................................
A0A096MRG6_PAPAN/1360-1501             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
I3MTW5_ICTTR/1373-1514                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A286ZJL1_PIG/1370-1511               ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6D2IZG9_9BRAS/918-1054              ..................................................g-NQTSRRP..YRR.R.GR.-.D.....NS.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............YGV..................GNY.D.WK...E......F...............V....PRLKQ.....K.TYDE......IK................EYGILF.LKHIA..E.E...I...D...E.N..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRVAVLLLVQEK............V........KFVEDH.PAKPVFTN-r.....................................
L5M0D9_MYODS/1374-1515                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1U8P355_GOSHI/934-1070              ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIS..E.D...I...-...T.E..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSNK............V........KTASEH.PGTRLFTD-d.....................................
A0A4W6CQX1_LATCA/1207-1348             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A1S3SDE2_SALSA/1440-1581             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
G0MX39_CAEBE/1247-1385                 ...........................................dfvaaplg--------..--K.R.SR.-.S.....RG.E..RL.pSLLA..E.N...N.GQ.L..E...........VL.GF...TP.RQRR.VYLNA..IL..R.............WGApp..............eeTAA.K.TV...W......R...............M....RDLRQ.....K.TPKQ......LN................AYTELF.FQHLC..E.T...E...-...N.E..SP..EF..................KDG.VPKE....NF....PR....NLL.LVRIGIMSLIRKK............V........AEFERY.NGKRSMPE-i.....................................
A0A212CDI9_CEREH/501-640               ................................................vap-----RRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2I4BV63_9TELE/1405-1546             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............cqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QLV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSIPE-l.....................................
A0A665TRP1_ECHNA/1183-1323             ............................................dertegl--------..KKK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W6CQX9_LATCA/1198-1339             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K5J9F5_COLAP/1395-1536             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A674F7A8_SALTR/1329-1470             ...............................................eggc----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3B0JB63_DROGU/1389-1530             ..............................................eqngg-----ERR..GKR.R.VD.R.R.....DD.R..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-i.....................................
H2MAR1_ORYLA/1275-1416                 .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W5NXK0_9TELE/1401-1542             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0D2RCZ8_GOSRA/931-1067              .................................................vn--QPGRKP..YRK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SHDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSKK............V........KDASEK.PGTRLFTD-d.....................................
A0A091IJH1_CALAN/1281-1430             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............VgalclaqvQEFEHV.NGKYSTPD-v.....................................
A0A485MCF4_LYNPA/1360-1501             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0V1LNN4_9BILA/1474-1614             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A1S3LDL9_SALSA/1392-1533             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A672J447_SALFA/98-236                ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSMF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............-........--FEHI.NGRWSLPE-l.....................................
A0A2Y9HLT9_NEOSC/1429-1570             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A673Y0K2_SALTR/1246-1387             ...............................................eggc----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A455AS57_PHYMC/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1D6NTR9_MAIZE/569-704               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A2K5JI05_COLAP/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
G1RFA2_NOMLE/1338-1471                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........SV----.---------fvwrr.................................
F4JTF7_ARATH/814-958                   ..................................................k-PRTVTRP..YRK.R.AR.-.D.....NS.E..EI..PLME..G.E...G.RY.L..M...........VL.GF...NE.TERD.IFLRT..FK..R.............YGA..................GNF.D.WK...E......F...............V....NPLYM.....K.TYDE......IN................KYGILF.LKHIA..E.N...P...T...D.N..ST..NFkvit..........amvyADG.VPKE....GI....SS....DEL.LVSMTFMMLVKEK............C........QFLDNH.PTAPVFSN-y.....................................
A0A4Z2DRA6_SCHJA/374-507               ...............................................vpvm--------..-SR.R.TR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NA.RQRR.SFLNA..VM..R.............YGL..................PPS.D.QP...W......M...............V....RDLRC.....K.PDRV......FR................AYICLF.MRHLC..E.P...E...T...E.N..SD..SF..................SDG.VPRE....GL....ST....QHV.LSRIGIMTLVRKK............V........QEFEKI.NGHWSMPD-l.....................................
A0A3Q1GZS0_ANATE/1440-1581             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3B6SEG0_WHEAT/924-1019              ..............................................nvsgr-----KAQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................SYVTKT.LDKIT..C.N...Q...R...D.L..IC..--..................---.----....--....--....---.-------------............-........------.---------hftk..................................
A0A553MTF8_9TELE/1447-1572             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsmp.........................
A0A452SHR4_URSAM/1259-1400             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4V6ASL6_COLLU/1359-1500             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A6J3S846_TURTR/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669CUA1_ORENI/1217-1358             .................................................de--RTEGKP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K6L7D5_RHIBE/1374-1529             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A4P1REP7_LUPAN/898-949               ................................................gtv---SARRP..HKR.K.VH.A.N.....SS.E..PL..PLME..G.E...G.RS.L..R...........VL.GF...NQ.NHRA.AFVQI..LM..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------snl...................................
A0A2I3H780_NOMLE/98-232                ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........SV----.---------fvwrrl................................
A0A4W5QWZ6_9TELE/1265-1404             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........HINQSS.NDS------ivtl..................................
A0A067FWA3_CITSI/934-1070              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGILF.LTHIT..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFLSQK.PGTPLFTD-d.....................................
A0A2Y9H479_NEOSC/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
V7AWG2_PHAVU/933-1069                  .................................................gt--TTARRP..YKK.K.AR.T.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.E..SS..TF..................TDG.VPKD....GL....RI....QDV.LVRIAVLLLIRDK............V........KFASQH.PQTSLFSD-d.....................................
A0A0P7UM29_SCLFO/1342-1387             ................................................aev---NCRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.R---.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------pmsrss................................
A0A074ZFB1_9TREM/1439-1569             ......................................reavnkldskinf--------..---.-.--.-.-.....--.-..--..----..-.E...N.GH.M..F...........IY.GF...GP.ENRT.SFANA..VM..R.............YGLp...............ppGIIpP.QD...W......L...............P....PSLFH.....V.GQQR......LY................AYTALF.MYHLY..A.D...PnalD...D.T..VD..HW..................SDG.IPKE....NL....CA....SAV.LSRIAMMALIRNK............V........LQFEDI.NGVHS----rtf...................................
A0A6Q2WVX8_ESOLU/1253-1394             .................................................ae--ANSRRP..NRK.G.LR.G.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A669C189_ORENI/1322-1463             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A663FA34_AQUCH/1156-1297             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A669D616_ORENI/1254-1395             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4Y7LK37_PAPSO/883-937               ..............................................gtaag-----KKP.qSKK.K.AR.A.D.....AS.G..PI..PLME..G.E...G.NS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............YGT..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------l.....................................
CHD5_RAT/1386-1527                     ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9QA94_DELLE/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3Q4BD34_MOLML/1193-1333             ................................................ddr---PERRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.A.SQ...W......L...............V....RDLRG.....K.TEKE......F-................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2K6RAM8_RHIRO/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2Y9NP42_DELLE/1379-1520             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W5PKD3_9TELE/1311-1451             ..............................................derae------GK..RKK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0R3WT79_HYDTA/2-154                 ...............................................gsqi--------..-GR.R.VR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NI.RQRR.AFVNS..VL..R.............YGLppppssls..mggvsaasATA.S.TA...W......H...............S....RDLKG.....K.PERV......FR................AYVALF.MRHLC..E.P...EsmnQ...D.N..NA..TY..................SDG.TPRD....GI....SH....QPI.LSRIGVMALVRKK............V........QEFEQI.NGLYSIPD-s.....................................
A0A0D9RFE3_CHLSB/1341-1482             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A444G9W0_ENSVE/322-370               ...........................................vsgrrgqf--------..SKR.K.TR.-.G.....YL.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.NQRS.LFQQL..VM..R.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A672Z5E5_9TELE/1308-1449             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A673B8R8_9TELE/1219-1360             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.NREG......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RTLT--.---------lmltnstahip...........................
A0A667ZJS6_9TELE/1172-1313             ................................................dqg---RGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A0V0YNJ2_TRIPS/1266-1406             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDAY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A2K6L7C0_RHIBE/1374-1529             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A673BBJ9_9TELE/1280-1420             ..........................................fdertegka--------..--N.W.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
F7G688_ORNAN/1378-1519                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W6EI07_LATCA/1286-1427             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A671X371_SPAAU/1295-1436             ...............................................rpeg----GRRH..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
B4LBL9_DROVI/1372-1513                 .................................................de--QNGERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A154PRM5_DUFNO/725-847               .....................................ksnqskffrllasy--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..SF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A5E4BB40_MARMO/1263-1404             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6I8S305_XENTR/1232-1373             ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............G........EIYKHL.NARSVH---ana...................................
A0A671DRE3_RHIFE/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A665VDH7_ECHNA/1278-1419             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
L5M993_MYODS/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669EQZ9_ORENI/1189-1330             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0M3KB69_ANISI/1-58                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.MRHLC..E.P...G...A...D.T..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFESS.NGDWSIPE-v.....................................
A0A1L8FDZ1_XENLA/1360-1501             .................................................rs--EAARRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pkDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A673BBT4_9TELE/1244-1385             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.NREG......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RTSKHI.NGPM-----espel.................................
A0A673ZTA4_SALTR/1340-1480             ..............................................derae------GK..RKK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A446Y4B4_TRITD/38-172                .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A553MTF0_9TELE/1399-1524             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsmp.........................
A0A5B8MU67_9CHLO/960-1100              ................................eesgeskakgavkkdagvl--------..---.-.--.-.-.....--.-..PH.rPLSD..G.A...I.ED.F..Q...........NLkTF...SK.SERK.RYYST..LM..R.............FGF.................dEQD.E.YR...N......F...............L....YALPA.....K.SADE......VE................AYKVFF.MKYLMmnE.D...E...F...E.Y..SE..AH..................TTF.V-KE....SIhvdgNR....EAI.ATRIADLHLIKLK............V........EESKNN.---------areg..................................
T1GDH8_MEGSC/506-573                   ................................................ned---AMNRR..NRR.R.AE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RD---.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A553MTE6_9TELE/1453-1577             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsm..........................
A0A287AAA4_PIG/1380-1521               ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A087VD60_BALRE/1349-1490             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A452FFU1_CAPHI/1365-1506             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2W1BUF3_HELAM/1380-1521             ..............................................dllsr------RS..KRRlE.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A1Y3BHG6_EURMA/441-559               ..........................................sltinffvl--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.F..Q...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FW................AYVSLF.MRHLC..E.P...G...P...D.N..AE..TF..................ADG.VPRE....GI....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGFISM---el....................................
H2YQ32_CIOSA/1203-1344                 ..............................................deefd-----NNE..NRR.K.NR.R.E.....KD.R..PL.pPMLA..R.V...G.GN.I..E...........VL.GF...SG.RQRR.TYLNF..VM..R.............YGMp...............ptEHF.Q.SR...W......L...............V....RELRV.....K.SEKE......FR................AYTSLF.MRHLC..E.P...G...S...E.N..SD..SY..................SDG.VPRE....GV....SR....QHV.LTRIGVMALIHKK............V........KEYKSI.NGDWSLPQ-l.....................................
K7KIF9_SOYBN/931-1068                  .................................................gt--TTARRP..YKK.K.AR.TaD.....ST.E..PH..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SA..TF..................ADG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KYASQH.PQTPLFSD-d.....................................
A0A3Q2DNX3_CYPVA/1348-1489             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0C4DGG9_HUMAN/1405-1546             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0D2UK31_GOSRA/931-1067              .................................................vn--QPGRKP..YRK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SHDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSKK............V........KDASEK.PGTRLFTD-d.....................................
A0A674EU67_SALTR/1338-1479             .................................................se--ANSRRP..SRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
W6VAX0_ECHGR/1330-1459                 .......................................dlladlpedvrf--------..---.-.--.-.-.....--.-..--..----..-.E...D.NK.M..T...........VF.GF...NA.HERQ.LFLES..VM..R.............YGIp...............pkGTLpP.PE...W......L...............P....FTLRS.....K.PPEE......LF................GYTNLF.MRHLY..S.D...P...K..vL.D..AEalRW..................SDG.VPTE....GV....SG....VAV.LSRIAMMALIRAK............A........VQFEEC.---------vavpkkfk..............................
A0A0K9QQ59_SPIOL/934-1070              ................................................gap---AGRRT..NKK.R.AR.V.D.....GM.E..AF..PLME..G.E...G.KL.F..R...........VL.GF...NQ.SQRA.VFVQV..LM..R.............FGV..................GEF.D.WA...E......F...............V....PRLKQ.....K.TYEE......IK................EYGTLF.LSHLA..E.E...I...-...T.D..SS..NF..................SDG.VPKE....GL....RV....QDV.LVRIAVLLLIRDK............V........KSATGN.PDGPLFAD-d.....................................
A0A452I1B2_9SAUR/1091-1232             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2I0BEE9_9ASPA/935-1072              ..........................................qtsgkrgpy--------..SRK.R.SR.V.G.....FT.E..PH..PLME..G.E...G.RS.F..R...........IR.GF...NQ.NQRA.AFLQI..LM..R.............FGF..................GKY.D.WK...E......F...............A....PRLKG.....K.SVQE......VQ................DYGRLF.MEHIT..E.D...L...-...N.D..ST..SF..................LDG.VPKE....GL....RV....DEV.LVRLGIIQSIEEK............I........DFLSEN.PKGSLFPE-d.....................................
A0A340WV36_LIPVE/1251-1392             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A674H9V2_TAEGU/1305-1446             ..................................................e-GQSGRRQ..SRR.Q.LK.T.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K6DCZ2_MACNE/1377-1518             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1S3M315_SALSA/1404-1545             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0E0L8N5_ORYPU/921-972               ..............................................iagrr------GP..YSK.K.KQ.R.S.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............Y--..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------ae....................................
A0A4W5RY07_9TELE/1268-1409             ...............................................eggc----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1S3JB55_LINUN/1405-1548             ............................................ekselgr-------G..GRR.RgGV.P.E.....KD.R..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.N.SH..cR......L...............V....RDLRG.....K.SEKV......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGTESMPY-k.....................................
A0A4U5QNH4_POPAL/1861-1997             .................................................gi--QTVRRP..YKK.K.AR.V.D.....NT.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...KQ.NQRA.AFVQI..LM..R.............FGV..................GDY.D.WK...E......F...............A....SRLKQ.....K.TYEE......VE................NYGRLF.LTHIA..E.D...L...-...T.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............A........RFASEN.PGSALFTD-d.....................................
A0A672J0F0_SALFA/1226-1367             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A4S4ESG6_CAMSI/130-181               ............................................klaenst--------..-GR.A.KL.M.D.....SA.E..SL..PLME..G.E...G.RS.F..R...........VK.GF...NQ.NQRA.AFVQI..MM..R.............YGT..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------l.....................................
A0A4D9DHC6_9SAUR/546-687               ................................................erp---EGRRQ..SKR.Q.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A452SHQ7_URSAM/1346-1487             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9EKX0_PHYMC/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
H0WCQ8_CAVPO/1361-1502                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A452GRU9_9SAUR/1235-1376             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTAD-l.....................................
F6Q627_HORSE/1446-1587                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A161YVQ9_DAUCS/928-1063              ................................................vea----EARP..SKK.K.KS.R.V.....DS.G..PP..PLME..G.E...G.KS.F..R...........VL.GF...SA.AQRA.AFVQI..LM..R.............FGA..................GEY.D.WA...E......F...............T....PRLKQ.....K.TFEE......VQ................AYGRLF.LAHIA..E.D...I...-...N.N..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAILSLMKDK............I........KRSTGL.HGASLFSE-d.....................................
A0A2J7RCR4_9NEOP/1404-1546             ..............................................dgepg-----RRS..RRRlE.RR.D.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A2K5KML3_CERAT/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
B0WBW6_CULQU/1400-1541                 ...............................................lnrr----SKRR..IER.R.EA.E.R.....DN.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A044VIM1_ONCVO/1284-1424             ...............................................efds-----NQQ..GKK.R.HR.D.R.....GD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDTY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEAS.NGEWSMPE-v.....................................
A0A4W4EUI4_ELEEL/1361-1502             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A5E4AZP0_MARMO/281-418               ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........DKMETQ.---------lgfvd.................................
A0A670KFE7_PODMU/1314-1455             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6J3QQQ8_TURTR/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A176WQC4_MARPO/1204-1340             .............................................rkfqpp-----KKK..ARE.D.PP.E.E.....RS.E..PH..PLME..G.D...G.RS.L..K...........VL.GF...TQ.KQRA.IFVQV..LM..R.............YGL..................GDF.T.WS...E......F...............I....PRLKQ.....K.SREE......IK................DYGTLF.LSHIA..E.D...I...-...S.D..SS..TF..................SDG.VPKE....GL....RI....QDV.LVRLAVLHLIGDK............V........RLLHEN.PQAPLL---si....................................
A0A3B6SEG0_WHEAT/1010-1080             .............................................qrdlic--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.---H......FT................KYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A1S3P3D5_SALSA/1326-1467             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
F1MFF9_BOVIN/1252-1393                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A5N5TP30_9CRUS/1308-1446             ................................................dgd---NNRRS..RRR.G.DR.N.D.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqEAF.N.SQ...W......L...............V....RDLRG.....K.SEKC......FR................AYTSLF.MRHLC..E.P...G...N...E.S..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........SRT---.---------patsvtpsp.............................
A0A668AJ24_9TELE/1258-1399             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A398AQU2_BRACM/894-1029              ..................................................g-NQMAKRP..YHR.-.TR.-.D.....TL.E..PI..PLIE..G.E...G.RF.L..K...........VL.GF...NE.LQRK.KFLTT..LE..R.............YGV..................GNY.D.WK...E......F...............V....DPLKP.....R.TYDE......IR................SYGLRF.LKHIV..E.D...K...D...V.N..SP..TF..................SDG.VPKE....GL....KC....KDV.LARIASVMLVQKK............V........KHMEAN.PTNPVFSD-r.....................................
A0A6J3QR83_TURTR/1433-1574             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
H3CFF6_TETNG/1317-1458                 .................................................er--TNSRRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A446X4S6_TRITD/939-1073              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A3Q4GCY3_NEOBR/1157-1298             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A673BBG7_9TELE/1275-1415             ..........................................fdertegka--------..--N.W.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W6CPQ0_LATCA/1189-1330             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A446X4T5_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A060YRN4_ONCMY/108-221               qkmmvklkegghrvlvfsqvrththththththththtlllvsrlssvvgx--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.--XS......SA................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........SNVL--.---------sidhll................................
A0A3Q3WS78_MOLML/1257-1390             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..-...........--.--...--.-ERK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
G1PQI5_MYOLU/1376-1517                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A673BEI6_9TELE/1287-1428             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1E5UTQ3_9POAL/926-1062              ..............................................gnvsg-----RRG..QYS.K.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.LFLQT..LN..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SAEE......IQ................RYAELV.MVHLV..D.D...I...-...N.D..SD..YF..................SDG.VPKE....GM....RV....DDV.LVRIANISLIEEK............V........AAMGQG.KITNLFPN-y.....................................
LE418_CAEEL/1268-1407                  ............................................sdeddyd--------..EKK.K.RR.R.D.....EE.K..MP..PLMA..K.V...N.GQ.V..E...........IL.GF...NP.RQRK.AFYGA..VM..R.............WGMp...............pqDSH.Q.SQ...W......L...............V....RDLRN.....K.SEKV......FR................AYASLF.MRHLC..E.P...G...A...D.G..HD..TF..................NDG.VPRE....GL....NR....QHV.LGRIGLLSLVRRK............V........QEFEQY.NGQWSMPE-i.....................................
A0A212EKR8_DANPL/1372-1513             ..............................................dllsr------RS..KRRlE.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A3B6S962_WHEAT/901-1035              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A670J3K6_PODMU/1171-1312             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEPV.NGKYSTPD-l.....................................
A0A5E4MTB0_9HEMI/1376-1517             .............................................geagkk---IKRKP..ERK.-.--.E.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..SE..NF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEEI.NGFYSMPE-l.....................................
A0A2K5NL31_CERAT/1435-1576             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6G1CP46_9ORYZ/925-1059              ............................................gitgrrg-------P..YSK.K.KQ.-.R.....NV.D..SL..PFME..G.E...G.RS.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A2P5WA70_GOSBA/728-810               .................................................vn--QPGRKP..YKK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SYDE......IK................ELSE--.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------filvc.................................
A0A446X4Z2_TRITD/865-999               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A2K6MIZ0_RHIBE/1360-1501             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
E9Q614_MOUSE/1428-1569                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4W3I3A9_CALMI/905-1045              ..................................................k-SEAGRRN..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..FM..R.............WGMp...............pqDSF.S.SH...W......L...............V....RDLRG.....K.SQKE......FR................AYVSLF.MRHLC..E.P...G...-...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEYI.NGRYSIPE-l.....................................
A0A4W5KRZ3_9TELE/1131-1272             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A5J4ZK21_9ASTE/960-1092              ................................................gal---TGRKP..HKK.K.AR.V.D.....SM.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WA...E......F...............A....PRLKQ.....K.TFEE......IK................GYGTLF.LSHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........SFVS--.---------ltevpii...............................
A0A232ESU5_9HYME/1374-1515             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A2Y9NUE3_DELLE/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K1J1K7_PHYPA/977-1114              ...............................................sgsk----KLQP..SRK.R.VK.E.R.....MTgE..PP..PLME..G.E...G.RE.L..R...........IL.GF...NH.RQRS.VFVNV..LM..R.............FGL..................GDF.S.WS...E......F...............I....PRLKP.....K.TPEE......IK................DYGTLF.LSHIA..E.D...I...-...N.D..SP..FF..................SDG.IPKE....GL....RI....QDV.LVRLAILHLIRDK............V........KALTED.PAMPLFSQ-g.....................................
A0A2R6Q300_ACTCC/932-1068              ................................................gip---AGRRP..HKK.K.TR.V.N.....SA.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.NQRT.AFVQI..LM..R.............FGV..................GEY.D.WV...E......F...............A....PRLKQ.....K.TYEE......IK................EYGRLF.LSHIA..E.D...I...-...T.D..SK..TF..................SDG.VPKE....GL....RI....QDV.LVRLAQLMLIRDK............V........KSAPEK.PGSPLFAD-d.....................................
A0A3Q7T845_VULVU/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
U3DRL5_CALJA/1388-1529                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A452CMB4_BALAS/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3P9AAH1_ESOLU/1406-1547             .................................................se--ANSRRP..NRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A383YU61_BALAS/1187-1328             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A061GQF3_THECC/935-1071              ..................................................g-NQSGRKP..YRK.R.VR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDY.D.FK...E......F...............V....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIV..E.D...M...-...N.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIATLLLIGQK............V........KSASEN.PGTSLFTD-d.....................................
A0A0V1N720_9BILA/1347-1487             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDAY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A452GTK8_9SAUR/1246-1386             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........EKEQSE.---------tqqngeke..............................
A0A672IZ88_SALFA/1265-1406             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A672J378_SALFA/1211-1352             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A671Y715_SPAAU/1401-1542             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q1LZU4_BOVIN/1430-1571             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6A3BPN8_HIBSY/632-761               ................................................sgt---QSGRT..SGK.R.NR.A.D.....SM.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.RK...E......F...............A....SRLKQ.....K.SYEE......IK................NYGVLF.LSHLA..E.G...V...-...N.D..SP..TF..................SDG.IHKE....GL....RI....SDV.LVRIAILLSISDK............V........SM----.---------liwihg................................
A0A4S4ESG6_CAMSI/178-213               ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................-YGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GR....RI....EDV.-------------............-........------.---------kaa...................................
A0A4S2LMH6_OPIFE/1240-1370             ........................................reavnkldaki--------..---.-.--.-.-.....--.-..--..---T..C.E...N.GH.M..F...........IY.GF...GP.ENRT.SFANA..VM..R.............YGLp...............ppGIIpP.QD...W......L...............P....PSLFH.....I.GQQR......LY................AYTALF.MYHLY..A.D...PnalD...D.T..VD..HW..................SDG.IPKE....NL....CA....SAV.LSRIAMMALIRNK............V........LQFEDI.NGVHS----rtf...................................
L8IRA9_9CETA/1359-1491                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FS................------.---LC..E.P...R...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9Q101_DELLE/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5A9MWB0_9TELE/1797-1938             ................................................sev---NSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q2U0J4_CHICK/99-252                .................................................er--SEARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..EvsnfyssyfhmVL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....LD....RFIwLLQLTHLSLCLMQ............V........QEFEHV.NGRWSMPE-l.....................................
A0A3Q1JIN3_ANATE/1279-1420             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q0DKI3_CARSF/1332-1473             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K5UJP5_MACFA/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2K5PFM6_CEBCA/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4X2M221_VOMUR/1167-1308             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGRYSTPD-l.....................................
A0A2K5NKP2_CERAT/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A452CMF8_BALAS/1202-1343             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1D6NTQ1_MAIZE/921-1003              ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYVKCA.L----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------hvl...................................
A0A1D6NTS1_MAIZE/317-452               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A671Y7B9_SPAAU/1230-1371             ...............................................rseg----KAQP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A669C7M8_ORENI/1270-1411             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A2K6SKJ0_SAIBB/1209-1340             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....--....---.-----IMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0V0WJP6_9BILA/1390-1530             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A2K5J999_COLAP/1370-1511             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6J3QQV4_TURTR/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A556U8P7_BAGYA/1365-1503             .................................................ae--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............P........HRINN-.---------emlllhf...............................
A0A0V0UCU8_9BILA/1341-1481             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
F1N544_BOVIN/1340-1481                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
G1NMS5_MELGA/1381-1522                 .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6Q2Z3W6_ESOLU/1305-1440             .................................................ae--ANSRRP..NRK.G.LR.G.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........NP----.---------vtlssaw...............................
A0A1U8BLP6_MESAU/1406-1547             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
H0YWQ4_TAEGU/1335-1476                 ...............................................rpeg----GRRQ..SRR.Q.LK.T.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K5ETC5_AOTNA/1405-1546             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2Y9R5L5_TRIMA/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A672IX61_SALFA/1315-1456             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A0L8HBI2_OCTBM/1234-1376             ................................................edk---QESRS..NRK.RsGV.S.D.....RD.K..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKV......FR................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGTHSMPY-m.....................................
H2YQ35_CIOSA/1165-1306                 .................................................es--NLATKG..NRR.K.NR.R.E.....KD.R..PL.pPMLA..R.V...G.GN.I..E...........VL.GF...SG.RQRR.TYLNF..VM..R.............YGMp...............ptEHF.Q.SR...W......L...............V....RELRV.....K.SEKE......FR................AYTSLF.MRHLC..E.P...G...S...E.N..SD..SY..................SDG.VPRE....GV....SR....QHV.LTRIGVMALIHKK............V........KEYKSI.NGDWSLPQ-l.....................................
A0A2P6VJB3_9CHLO/2160-2292             ...........................................slrplggw--------..---.-.--.-.-.....--.-..--..PKVL..G.G...G.GA.A..R...........VW.GF...TA.MQRE.CFAQL..VM..L.............FGVhs.............aadGAF.D.WS...T......M...............Q....SIFST.....K.RPED......VA................KYGEML.MGALA..A.A...T...A...S.G..SG..AAp...............akFDG.VPLDallcGI....PA....PDM.LQRVGLLHLLAAS............L........EELEQ-.---------gmarqp................................
A0A2R9AXP0_PANPA/1368-1523             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKV--------............-........------.---------svflspkestcagvrwrrlelpvqefehingrwsmpel
A0A090L5U8_STRRB/2329-2469             ...........................................dsdsaane-------L..KRR.R.NY.V.-.....-D.D..VL.pPLVG..K.V...N.GQ.I..E...........IL.GF...NP.RQRK.AFYQS..IM..R.............WGMp...............pnDAY.Q.SQ...W......L...............V....QDLKS.....K.SERA......YK................VYAALF.LRHLC..E.D...A...S...T.K..SE..FF..................SDG.VPRE....GL....NK....QHI.LSRIGMMGLIRKK............I........NEFESL.NGEWSVPE-i.....................................
A0A671WMF3_SPAAU/91-231                .............................................derteg-------K..DQK.G.LR.N.D.....KD.K..PL.pPPAG..Q.G...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.IASLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A060WEN1_ONCMY/999-1140              ...............................................eggc----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W5NXJ0_9TELE/1287-1427             .............................................deraeg-------K..REK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A099ZZF7_CHAVO/1379-1520             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3LDL1_SALSA/1385-1526             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
E2RHA0_CANLF/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1W4XI14_AGRPL/1379-1521             ................................................end---MSRRS..KRR.M.ER.KdE.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKI......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGEYSMPE-l.....................................
A0A4W4EQJ6_ELEEL/1400-1541             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A158P7G2_ANGCA/1-93                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..-M..R.............WGMp...............pqDAY.Q.SQ...W......L...............T....RDLKG.....K.SERA......FK................TYTSLF.MRHLC..E.P...G...A...D.T..QE..TF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEQA.NGEWSMPE-m.....................................
A0A3P9MWV4_POERE/1291-1432             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3P4MZL0_GULGU/1347-1488             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2Y9R5A9_TRIMA/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A667Z319_9TELE/1268-1406             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RP----.---------eaaiyeiksv............................
A0A3Q3L0E4_9TELE/1329-1470             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A4W5QLB5_9TELE/1294-1368             ...........................................tlnecdpv--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.---S......LR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A091T6D2_PHALP/1378-1519             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A504YB46_FASGI/1546-1683             ....................................lktsetwkrriphld--------..---.-.--.-.-.....--.-..--..PKIT..F.E...N.GH.M..F...........IY.DF...GP.NDRQ.AFAGA..VM..R.............FGLp...............ppGIVpP.QE...W......L...............P....NALHH.....K.SPAN......LF................AYTSVF.MRHLY..D.D...P...NgmdE.L..TD..CW..................SDG.LPKE....SL....CV....PAV.LSRIAIMALIRNK............I........LEFEDI.NGVHS----rtf...................................
A0A2Y9Q0Z6_DELLE/1370-1511             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4D9F8E4_9SAUR/854-995               ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A446X4X3_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A0E0L8N4_ORYPU/921-972               ..............................................iagrr------GP..YSK.K.KQ.R.S.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............Y--..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------ae....................................
A0A6J3QQ50_TURTR/1412-1553             .................................................qe--DQGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2Y9DK95_TRIMA/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5F4VY63_CALJA/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3P7WDC4_RODNA/1302-1448             .............................................adgsqi--------..-GR.R.VR.R.E.....RE.G..KM.pPILS..R.V...N.GQ.I..E...........VL.GF...NF.RQRK.AFVNS..VL..R.............FGLpppp..........gaskNCL.E.AA...W......H...............S....RDLRG.....K.PEKV......FR................AYVAHF.LRHLC..E.P...DsmnQ...D.N..NP..NY..................PDG.TPRD....GI....LH....QPI.LTRIGIMSLVRKK............V........QEFEQI.NGLYSMPE-h.....................................
A0A2K6SKI7_SAIBB/98-229                ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....--....---.-----IMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
F1LPP8_RAT/1208-1349                   ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1D6NTS2_MAIZE/98-171                ...........................................dgealpnt--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.---G......IG................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATGP-.---------gkitnifpny............................
D6X1V1_TRICA/1372-1514                 ..............................................egdln-----RRS..RRR.M.ERkD.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGEYSMPE-v.....................................
A0A1S4CTZ5_TOBAC/171-296               ...............................................eapv----VRKA..HRK.K.AR.V.D.....SA.E..SH..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GEF.D.WA...E......F...............T....PRLKQ.....K.TYEE......IK................DYGALF.LSHIA..E.D...V...-...I.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............A........------.---------slyl..................................
A0A0V1AEU4_9BILA/1361-1501             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A671ENL2_RHIFE/1436-1577             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
F6PUX9_XENTR/1400-1541                 .................................................er--AEGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.S.TH...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSMPE-l.....................................
A0A4W6EF93_LATCA/1277-1418             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A3P8S7Y8_AMPPE/1412-1553             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3Q1BY56_AMPOC/1412-1553             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A096N0D3_PAPAN/1380-1521             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A0D8XXQ0_DICVI/1311-1449             .............................................esigge-------K..KKK.R.ER.-.D.....AE.K..LP..PLLA..K.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.SQ...W......L...............T....RDLKG.....K.SERA......FK................TYTSLF.MRHLC..E.P...G...A...D.S..QE..TF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEQA.NGEWSMPE-m.....................................
A0A669EXM6_ORENI/1308-1449             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A484D8R7_PERFV/1439-1580             .................................................er--TNARRP..SRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A668AW74_9TELE/1285-1426             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1S3HM47_LINUN/1439-1576             ............................................rlettaq--------..-ED.K.KK.-.A.....AT.K..TF.pPLLS..K.V...N.GQ.V..Q...........VL.GF...TA.RKRK.AFLEQ..VM..R.............FGMp...............ieDAY.N.SQ...W......M...............N....KELQD.....I.PEHH......FK................AYVALF.MRHLC..E.N...V...P...E.K..AD..TY..................HDG.VPCE....GL....SR....QHV.LTRIGIMSLIRRK............I........NEYESS.EV-------ssvdsm................................
H2YQ34_CIOSA/1205-1346                 ..............................................deefd-----NNE..NRR.K.NR.R.E.....KD.R..PL.pPMLA..R.V...G.GN.I..E...........VL.GF...SG.RQRR.TYLNF..VM..R.............YGMp...............ptEHF.Q.SR...W......L...............V....RELRV.....K.SEKE......FR................AYTSLF.MRHLC..E.P...G...S...E.N..SD..SY..................SDG.VPRE....GV....SR....QHV.LTRIGVMALIHKK............V........KEYKSI.NGDWSLPQ-l.....................................
A0A452GJB6_9SAUR/1434-1575             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3M2F1_SALSA/1388-1529             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A674A036_SALTR/1340-1481             .................................................rk--SNSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
B9RNX6_RICCO/931-1067                  ..................................................g-TQSGRKP..YRK.R.AR.V.D.....NM.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEY.D.WK...E......F...............A....SRMKQ.....K.SYEE......IR................DYGILF.LSHIV..E.E...I...-...T.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLILEK............V........KFASEK.PGIPLFTD-d.....................................
CHDM_DROME/1375-1516                   ...............................................dqng----AERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
G1LTR2_AILME/1361-1502                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K6RZP7_SAIBB/1119-1260             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W5RUE1_9TELE/1266-1407             ...............................................eggc----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3P9CPN4_9CICH/1308-1449             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A553PA58_TIGCA/1351-1492             ................................................dpe---SLRRR..GMR.G.NH.R.E.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKC......LR................AYVSLF.MRHLC..E.P...G...N...E.Q..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........HEFEGI.NGKHSMPH-l.....................................
A0A2K3LIN4_TRIPR/1-63                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................-YGTLF.LSHIA..E.D...I...-...T.D..SS..TF.................tGDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFATEH.PQTPLFSD-d.....................................
A0A0V1LNA2_9BILA/1489-1632             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQcafR......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A0V0RT52_9BILA/1399-1539             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..SY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A1S3M2E7_SALSA/1404-1545             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A671X5Z1_SPAAU/1289-1430             ...............................................rpeg----GRRH..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
E1JI46_DROME/1375-1516                 ...............................................dqng----AERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A1U8BUY8_MESAU/1410-1551             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A091NVX2_HALAL/1342-1483             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4U5TUQ4_COLLU/1386-1527             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A452QM02_URSAM/1264-1405             ...............................................rpeg----GRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A091DNG6_FUKDA/1314-1455             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2J7RCP9_9NEOP/1404-1546             ..............................................dgepg-----RRS..RRRlE.RR.D.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A4W5KND2_9TELE/1347-1488             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
G1QWK9_NOMLE/1463-1604                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWK----enkk..................................
F6ZS61_MACMU/1360-1501                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A671X3P0_SPAAU/1378-1519             ...............................................rpeg----GRRH..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A2K5ZQK2_MANLE/1386-1527             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A452HYR2_9SAUR/1089-1230             ................................................sah---AGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1S3EYQ9_DIPOR/1379-1520             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A267FX06_9PLAT/1363-1501             ...........................................adgeaaag--------..--R.R.RR.-.D.....RD.V..KM.pPLLS..K.L...N.NQ.I..E...........VF.GF...NP.RQRR.AFLNS..VM..R.............FGLp...............psDVY.N.SA...W......M...............S....RDLRS.....K.PEKV......FR................AYTSLF.MRHLC..E.P...D...S...D.V..TD..TF..................SDG.VPRE....GI....NR....QHV.LTRIGIMALLRKK............V........QEFEKI.NGRSSLP--ya....................................
A0A1P8AZP2_ARATH/936-1072              .................................................gv--QTGRRP..YRR.K.GR.-.D.....NL.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............YGA..................GNF.D.WK...E......F...............V....PRLKQ.....K.TFEE......IN................EYGILF.LKHIA..E.E...I...D...E.N..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRIALLILVQEK............V........KFVEDH.PGKPVFPS-r.....................................
A0A3Q1I9W0_ANATE/1440-1581             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
M4D4A7_BRARP/907-1042                  ..................................................g-NQMAKRP..YHR.-.TR.-.D.....TL.E..PI..PLIE..G.E...G.RF.L..K...........VL.GF...NE.LQRK.KFLTT..LE..R.............YGV..................GNY.D.WK...E......F...............V....DPLKP.....R.TYDE......IR................SYGLRF.LKHIV..E.D...K...D...V.N..SP..TF..................SDG.VPKE....GL....KC....KDV.LARIASVMLVQKK............V........KHMEAN.PTNPVFSD-r.....................................
A0A2G9TG76_TELCI/1-93                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..-M..R.............WGMp...............pqDAY.Q.SQ...W......L...............T....RDLKG.....K.SERA......FK................TYTSLF.MRHLC..E.P...G...A...D.S..QE..TF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEQV.NGEWSMPE-v.....................................
A0A093N9C6_PYGAD/1389-1530             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3P7M318_STRVU/1-93                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..-M..R.............WGMp...............pqDAY.Q.SQ...W......L...............T....RDLKG.....K.SERA......FK................TYTSLF.MRHLC..E.P...G...A...D.T..QE..TF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEQV.NGEWSMPE-m.....................................
A0A2Y9DKT8_TRIMA/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A672J000_SALFA/1338-1479             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2I4H251_JUGRE/932-1068              ................................................gap---SGRKP..YKK.K.SR.V.D.....GT.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGVLF.LSHIA..E.D...I...-...T.D..TP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLMLVRDK............V........KFSSEN.PGTPLFTE-d.....................................
A0A3Q0D1I3_MESAU/1418-1559             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A553MTG7_9TELE/1438-1562             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsm..........................
A0A087Y8E8_POEFO/1406-1547             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3P8WKB5_CYNSE/1272-1413             ..............................................gdedf-----DEP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9Q6H1_DELLE/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
S9X619_CAMFR/1290-1431                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A673BB27_9TELE/1283-1423             ..........................................fdertegka--------..--N.W.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9HFK1_NEOSC/1429-1570             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0V1PNF0_9BILA/1352-1492             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
L9L0Y3_TUPCH/1376-1517                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
Q1LYP4_DANRE/1356-1497                 .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...S.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SERE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..SF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0E0PUC5_ORYRU/898-1032              ..............................................lagrr------GP..YSK.K.KQ.R.S.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......F...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A5F8GBF1_MONDO/1291-1432             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
M3W6N4_FELCA/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S4AIJ4_TOBAC/932-1068              ...............................................gapv----VRKA..HRK.K.AR.V.D.....SA.E..SH..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEF.D.WA...E......F...............T....PRLKQ.....K.TYEE......IK................DYGALF.LSHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KAFSEK.TGGPLFAE-d.....................................
A0A3B6SEA5_WHEAT/897-1031              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
H3AAQ2_LATCH/1340-1481                 .................................................ra--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMPE-l.....................................
V8P2A0_OPHHA/1042-1175                 ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIG--------............V........QEFEHI.NGRWSMPE-l.....................................
A0A4W5QWS6_9TELE/1217-1358             ...............................................eggc----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A158NPU9_ATTCE/1372-1513             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A4W5QWU8_9TELE/1229-1370             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A453QYJ1_AEGTS/1-56                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A1S3U4Q0_VIGRR/934-1069              .................................................gt--TTAKRP..YKK.K.AR.-.N.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIS..E.D...I...-...T.E..SS..TF..................SDG.VPKD....GL....RI....QDV.LVRIAVLLLIRDK............V........KFASQN.PQTPLFSD-d.....................................
A0A1S3M2L8_SALSA/1404-1545             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9H483_NEOSC/1321-1462             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5F4DA12_CANLF/1371-1512             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5D2WK97_GOSMU/822-958               .................................................vn--QPGRKP..YKK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SYDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSEK............V........KDASEK.PGTRLFTD-d.....................................
A0A2K6KY18_RHIBE/1387-1528             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K5XUV0_MANLE/1361-1502             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1D2M211_ORCCI/792-936               .............................................teagsr-----RRR..RGM.E.RR.E.E.....RD.R..PL.lHFWQ..E.W...E.EI.LshS...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.TQ...W......L...............V....RDLRG.....K.SEKC......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGLYSMPE-v.....................................
U3J7E9_ANAPP/1324-1465                 ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1J7HNH7_LUPAN/1032-1168             ................................................gtv---STRRS..HKK.K.VH.A.I.....ST.E..PL..PLME..G.E...G.RS.L..R...........IL.GF...NQ.NQRA.AFLQI..LM..R.............FGI..................GDN.D.WE...S......F...............V....PRMKQ.....K.SVEE......IR................EYGMLF.LSHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....TDL.LVRLAILILIKEK............V........QFASEN.PGTQLFSD-d.....................................
A0A446X4R9_TRITD/911-1049              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............F........T-----.---------sqvaameqgkitklfpny....................
A0A5J4NRE0_9TREM/1248-1297             ................................................lvm--------..-AR.R.TR.R.D.....RE.G..RL.pPLLS..R.V...S.GQ.I..E...........VL.GF...NV.RQRR.SFLNA..IM..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------seqvar................................
CHD4_HUMAN/1380-1521                   ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1V4KNJ8_PATFA/1361-1502             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1S3WHZ9_ERIEU/1379-1520             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A671XB40_SPAAU/1251-1392             ...............................................rpeg----GRRH..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A2K5YLG5_MANLE/1377-1508             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A162AKM5_DAUCS/919-1052              ...............................................eaap----VRKP..YKK.K.AR.-.-.....-V.A..PR..PLME..G.E...G.KT.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GEF.D.WA...E......F...............T....QRLKQ.....K.TYEE......ID................AYAKLF.LAHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............I........KSASQV.PGSPLFTE-d.....................................
A0A2H5NW10_CITUN/992-1119              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGILF.LTHIT..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVKFLSQ--............-........------.---------kpgtplftd.............................
A0A4S2LUZ4_OPIFE/1424-1554             ........................................reavnkldaki--------..---.-.--.-.-.....--.-..--..---T..C.E...N.GH.M..F...........IY.GF...GP.ENRT.SFANA..VM..R.............YGLp...............ppGIIpP.QD...W......L...............P....PSLFH.....I.GQQR......LY................AYTALF.MYHLY..A.D...PnalD...D.T..VD..HW..................SDG.IPKE....NL....CA....SAV.LSRIAMMALIRNK............V........LQFEDI.NGVHS----rtf...................................
A0A4W4ERW3_ELEEL/1394-1535             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A5D2YG97_GOSMU/934-1070              ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIS..E.D...I...-...T.E..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLISNK............V........KTASEH.PGTRLVTD-d.....................................
U3JPY8_FICAL/212-354                   ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VR.GH...EG.TLGGlGTLGA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............H........LECEHI.NRSWSLPE-x.....................................
A0A194Q834_PAPXU/1379-1520             ..............................................dllsr------RS..KRRlE.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A452GSC5_9SAUR/1285-1426             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTAD-l.....................................
A0A673TQK9_SURSU/1371-1507             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............T........K-----.---------wkpswatrm.............................
A0A287D8N5_ICTTR/1464-1605             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
K7IT58_NASVI/1362-1503                 ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A2R8Y4X2_HUMAN/730-871               ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
H9J096_BOMMO/1382-1523                 ..............................................dllsr------RS..KRRlE.KR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A671WLW7_SPAAU/1258-1399             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3L8SAN2_CHLGU/1379-1520             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A672J382_SALFA/1254-1395             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
PKL_ARATH/919-1055                     .................................................gv--QTGRRP..YRR.K.GR.-.D.....NL.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............YGA..................GNF.D.WK...E......F...............V....PRLKQ.....K.TFEE......IN................EYGILF.LKHIA..E.E...I...D...E.N..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRIALLILVQEK............V........KFVEDH.PGKPVFPS-r.....................................
A0A2K5JI01_COLAP/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2H5NW14_CITUN/964-1091              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGILF.LTHIT..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVKFLSQ--............-........------.---------kpgtplftd.............................
A0A6I8SD55_XENTR/1230-1371             ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEQV.NGKYSTPD-l.....................................
A0A341AI93_NEOAA/1392-1533             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2H5NW09_CITUN/949-1076              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGILF.LTHIT..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVKFLSQ--............-........------.---------kpgtplftd.............................
X1XTS3_ACYPI/1377-1518                 .............................................geagkk---LKRKP..ERK.-.--.E.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..SE..NF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEEI.NGFYSMPE-l.....................................
A0A2K5XUI9_MANLE/1391-1532             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0B0MBX0_GOSAR/926-1062              ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIS..E.D...I...-...T.E..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLISNK............V........KTASEH.PGTRLFTD-d.....................................
A0A2K6AMQ5_MACNE/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A667YAB6_9TELE/1251-1392             .................................................ae--ANARRP..NRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
G3Q6H2_GASAC/1303-1444                 ................................................drp---EGRRH..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...S...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A4S8KFA9_MUSBA/1007-1100             .............................................saffnh--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..W.............FGF..................QDY.S.WK...E......Y...............L....PRLKG.....K.SWQE......VQ................DYAELF.MRHLQ..E.D...I...-...T.D..LP..NF..................SDG.VPKE....GA....RV....DDI.LVRIAHIQLIEEK............M........KFMREN.PGANLFPE-d.....................................
A0A667YY47_9TELE/1283-1420             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........R-----.---------pegvcetssg............................
A0A0N4XW50_NIPBR/1149-1244             ................................ekkkkrdrdseklppllak--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............T....RDLKG.....K.SERA......FK................TYTSLF.MRHLC..E.P...G...A...D.S..QE..TF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEQV.NGDWSMPE-l.....................................
A0A0V1AF14_9BILA/1392-1532             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
R0G107_9BRAS/919-1055                  .................................................gv--QTGRRP..YRR.R.GR.-.D.....NS.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............YGV..................GNY.D.WK...E......F...............V....PRLKQ.....K.TYDE......IK................EYGITF.LKHIA..E.D...I...D...E.N..SP..TF..................SDG.VPKE....GL....RI....EDV.LIRIAVLILVQDK............V........KFVEDH.PAKPLFPS-r.....................................
A0A674M9Q9_TAKRU/1339-1480             ...............................................rpeg----GRRH..SRR.Q.LK.N.D.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.TH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A2Y9KV77_ENHLU/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A671Y5S2_SPAAU/1289-1430             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K5NKH0_CERAT/1414-1558             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....IMslvkKKL.KARAGFPVCMSVS............V........QEFEHI.NGRWSMPE-l.....................................
A0A452QM27_URSAM/1213-1354             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1U7YNN1_NICSY/932-1068              ...............................................gapv----VRKA..HRK.K.AR.V.D.....SA.E..SH..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEF.D.WA...E......F...............T....PRLKQ.....K.TYEE......IK................DYGALF.LSHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KAFSEK.TGGPLFAE-d.....................................
A0A5N5MED0_9ROSI/1078-1215             .................................................gi--QTVKRP..YKK.K.ARgV.D.....NT.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDY.D.WK...E......F...............A....PRLKQ.....K.TYEE......VE................NYGRLF.LTHIA..E.D...L...-...T.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............A........RFASEN.PGSPLFTD-d.....................................
A0A2K1IRI0_PHYPA/978-1113              ............................................gskklps--------..SRK.R.VK.ErM.....TG.E..PP..PLIE..G.E...G.RE.L..R...........IL.GF...NH.RQRS.IFVNV..LM..R.............FGL..................GDF.S.WS...E......F...............I....PRLKP.....K.TPEE......IK................DYGTLF.LSHIA..E.D...I...-...N.D..SP..FF..................SDG.VPKE....GL....RI....QDV.LVRLAILHLIRDK............V........KALSED.PSIPLFS--p.....................................
A0A6I8QB28_XENTR/1313-1454             .................................................er--AEGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.S.TH...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSMPE-l.....................................
A0A067QUX9_ZOONE/1442-1584             ..............................................dgepg-----RRS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A3P9P4Q4_POERE/1408-1549             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A177B9S0_9BILA/1268-1406             .............................................dstfnk--------..-GK.R.KL.T.D.....KD.K..KL.pPLIV..Q.N...N.NQ.V..D...........VF.GF...NT.RQRR.AFLNA..IL..R.............YGLp...............pnEVF.A.PH...W......L...............V....RDLRG.....K.SQAV......FK................AYTQMF.MRHLC..E.N...V...T...A.G..KD..YF..................SDG.VPRE....NL....NR....HQV.LTRIGIMSLIRKK............V........QEFEVI.NGKYCIP--gv....................................
G3SLZ2_LOXAF/1333-1474                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A553MTD7_9TELE/1421-1546             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsmp.........................
A0A4W6CQT9_LATCA/1226-1367             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A672Z7U3_9TELE/1288-1428             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........GTTYSD.NRK------igfqp.................................
A0A096MSK7_PAPAN/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A446Y4I2_TRITD/48-182                .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A444X676_ARAHY/930-1066              .................................................ga--TTVRRP..YKK.K.LR.A.D.....SG.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEF.D.WK...E......F...............T....SRMKQ.....K.TYQE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SS..TF..................TDG.VPKE....GL....RI....QDV.LVRIALLLLIRDK............V........KSASRN.PGTPLFTD-d.....................................
A0A671YDS5_SPAAU/1216-1357             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A674AJL0_SALTR/1344-1485             .................................................re--SNSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
F7FEN0_CALJA/1376-1517                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A670KIA4_PODMU/1270-1411             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5C6N0R3_9TELE/1370-1511             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.ANLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9KW06_ENHLU/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A453QY55_AEGTS/330-464               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A251VT42_HELAN/1015-1150             ................................................lap----AKKP..YRK.K.TR.V.D.....NA.E..LL..PLME..G.E...G.RA.F..R...........VL.GF...NQ.SQRA.QFVQI..LM..R.............FGV..................GDF.D.WA...E......F...............T....SRLKQ.....K.SYEE......IK................VYGTLF.LSHIS..E.D...I...-...T.D..AV..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLLLVREK............V........KNPSEN.QSAPLFTD-d.....................................
A0A2Y9HFF7_NEOSC/1429-1570             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A452SHT5_URSAM/1346-1487             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A674F8T4_SALTR/1305-1444             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........HIN---.---------qslkltnlsh............................
B1AR17_MOUSE/1428-1569                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1S3SDE3_SALSA/1449-1590             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3Q0FR51_ALLSI/1109-1250             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A3Q7RZS4_VULVU/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2R8YFK9_HUMAN/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
CHD4_MOUSE/1373-1514                   ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2Y9RQJ1_TRIMA/1408-1549             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
L5KI24_PTEAL/1322-1463                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669B4N2_ORENI/1266-1407             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
E9FRV7_DAPPU/1469-1612                 ...............................................epgr----GRRR..KGT.E.RR.D.E.....KD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.N.TQ...Wq....vL...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....NR....QHV.LTRIGVMSLIRKK............V........HEFEHI.NGLYSMPE-v.....................................
A0A671WQE7_SPAAU/1184-1324             .............................................derteg-------K..DQK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q1GYF9_9TELE/1285-1426             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A3Q7Y4Q3_URSAR/1392-1533             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K5J9S6_COLAP/1405-1546             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5F8G391_MONDO/1200-1341             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5E4BCY9_MARMO/1263-1404             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
G3WQQ3_SARHA/1384-1525                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K5UJV6_MACFA/1361-1492             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
F6Z898_MACMU/1372-1513                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A498MQR2_LABRO/1325-1466             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............aqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
A0A4W6CPH6_LATCA/1178-1319             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A663FFL9_AQUCH/1330-1471             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A183KEJ5_9TREM/1440-1485             ...............................................vpvm--------..-SR.R.TR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NA.RQRR.SFLNA..VM..R.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A2I2ZSH9_GORGO/1193-1348             ...............................................dcsr----WRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSV------............-........------.---------flspkestcagvrrrrlelpvqefehingrwsmpel..
I1H0C9_BRADI/926-1060                  ............................................nisgrrg-------Q..YAK.K.N-.S.R.....NV.D..SL..PLME..G.E...G.RS.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SLEE......IQ................KYAELV.MAHLV..E.D...M...-...N.E..ST..TY..................ADG.VPKE....-M....RN....DET.LVRLAKISLLEEK............V........AAMEQG.KITKLLPN-y.....................................
A0A452I0D4_9SAUR/1089-1230             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A446X4S7_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A1D6NTN8_MAIZE/921-980               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............L--..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------vtdmplepvw............................
A0A667YVP6_9TELE/1328-1469             .................................................ae--ANARRP..NRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2I4BVA3_9TELE/1404-1545             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............cqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QLV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSIPE-l.....................................
A0A484BPM4_DRONA/1365-1506             .................................................de--QNGERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A674A3W0_SALTR/1359-1500             ................................................see---GKRKP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A6G0UZQ6_9BILA/1308-1449             ...............................................efer----EERL..ERK.K.AS.R.Y.....RD.E..KL.pPLLA..R.V...N.GV.I..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGIp...............psEAY.Q.SQ...W......L...............V....RDLRC.....K.SERA......FK................AYTALF.MRHLC..E.P...G...S...E.T..SE..TF..................NDG.VPRE....GI....SR....QLV.LSRFGMLSLIRKK............V........QEFESV.NGDWSMPE-l.....................................
A0A4W5KM67_9TELE/1278-1419             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A6G1CPF6_9ORYZ/925-1059              ............................................gitgrrg-------P..YSK.K.KQ.-.R.....NV.D..SL..PFME..G.E...G.RS.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A3Q0E473_CARSF/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A401P5X9_SCYTO/1-58                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFDHI.NGQWSMPE-l.....................................
A0A2K6AMQ4_MACNE/98-230                ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1S3P397_SALSA/1384-1525             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3B6SCM7_WHEAT/939-1073              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
Q7ZWN3_XENLA/1371-1512                 .................................................rs--EAARRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3P8DVY1_9TREM/107-240               ...............................................vpvm--------..-SR.R.TR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NA.RQRR.SFLNA..VM..R.............YGL..................PPS.D.QP...W......M...............V....RDLRC.....K.PDRV......FR................AYICLF.MRHLC..E.P...E...T...E.N..SD..SF..................SDG.VPRE....GL....ST....QHV.LSRIGIMVLVRKK............V........QEFEKI.NGHWSMPD-l.....................................
A0A182E800_ONCOC/1278-1418             ...............................................efds-----NQQ..GKK.R.HR.D.R.....GD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDTY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEAS.NGEWSMPE-v.....................................
A0A0D9WMM4_9ORYZ/867-1000              .............................................vsgrrg-------P..YSK.K.KQ.-.R.....NV.D..SL..PFME..G.E...G.RS.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............T....PRLKG.....K.SVEE......IQ................RYAELV.MTHLI..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A0V1D6T8_TRIBR/1341-1481             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A565C5M4_9BRAS/919-1055              ..................................................g-NQTGRRP..YRR.R.GR.-.D.....NS.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............YGV..................GNY.D.WK...E......F...............V....PRLKQ.....K.TYDE......IK................EYGILF.LKHIA..E.D...I...D...E.N..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLLLVQEK............V........KYVEDH.PAKPVFPN-r.....................................
A0A2K6P1M5_RHIRO/98-253                ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A452I1S5_9SAUR/1100-1241             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A183XA42_TRIRE/1-73                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......M...............V....RDLRC.....K.PDRV......FR................AYICLF.MRHLC..E.P...E...T...E.N..SE..SF..................SDG.VPRE....GL....ST....QHV.LSRVGIMSLVRKK............V........S-----.---------lcifyenlh.............................
A0A3Q2WSK3_HAPBU/1264-1405             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A2R9AVK1_PANPA/1190-1344             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKV--------............-........------.---------svflspkestcagvrwrrlelpvqefehingrwsmpel
A0A1D6NTS0_MAIZE/416-551               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A2K6E9M5_MACNE/1360-1482             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....H.MS--......--................------.LSYIF..I.V...G...A...V.G..LF..L-..................FDG.VPRE....GL....SR....QHV.LTRIGV-------............-........QE----.---------felfngrwsmpel.........................
A0A2K5J9N4_COLAP/1350-1491             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3PYT4_SALSA/1385-1526             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3P8S9H2_AMPPE/1290-1430             .................................................ra--ENARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......F-................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A059B9T7_EUCGR/928-1064              .................................................gi--QTGRRP..YRK.R.SR.V.D.....ST.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.TYEE......IK................EYGRLF.LSHIA..E.E...I...-...T.D..LP..TF..................ADG.VPKE....GL....RI....QDV.LVRIAQLMLVKEK............V........LSASEN.VGAPLFPE-e.....................................
A0A2Y9KXU9_ENHLU/1379-1520             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A341AE03_NEOAA/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0E0A5X8_9ORYZ/898-1032              ..............................................lagrr------GP..YSK.K.KQ.R.S.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......F...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A3Q2VQR6_HAPBU/1307-1448             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A315VLI9_GAMAF/1-58                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0S3RC81_PHAAN/934-1070              .................................................gt--ATAKRP..YKK.K.AR.T.D.....SS.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIS..E.D...I...-...T.E..SS..TF..................TDG.VPKD....GL....RI....QDV.LVRIAVLLLIRDK............V........KFASQH.PQTPLFSD-d.....................................
A0A2U3Y2G8_LEPWE/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3Q0FF38_VIGRR/68-169                .......................................etptptrrgkki--------..---.-.-C.S.G.....IP.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdis..............................
A0A1S3PZ18_SALSA/1398-1539             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W6EJR9_LATCA/1266-1409             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........L-----.---------vpqpkafstqntkfsa......................
A0A493T4M3_ANAPP/1-58                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A3P8X2L3_CYNSE/1294-1435             .................................................se--ANSRRP..SRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0V0UE67_9BILA/1435-1557             ..........................................lhlfslssl--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.C..Y...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQcafR......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A669C7C1_ORENI/1240-1381             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A328E828_9ASTE/927-1063              ................................................gva---TLKRP..YRK.R.AR.V.D.....LS.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRT.AFVQI..LM..R.............FGV..................GEF.D.WA...E......F...............T....PRLKQ.....K.TYEE......IK................NYGRLF.LSHIA..E.D...L...-...T.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LVRIAELLLVRDK............V........KAASEK.PGSPLFTE-d.....................................
A0A2I3LYT0_PAPAN/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1S3SDD5_SALSA/1456-1597             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A0K0FA57_STRVS/1244-1382             .............................................vdgaae--------..ARK.R.KK.Y.G.....DD.K..LP..PLIG..R.V...N.GL.I..E...........VL.GF...NP.RQRK.AFYNA..VM..R.............WGMp...............psDAY.Q.SQ...W......L...............T....RDLKS.....K.SERV......FK................AYSSLF.MRHLC..E.P...V...A...E.S..AD..TF..................SDG.VPRE....GI....NR....HHI.LARMGIMCLIRRK............V........QEFESY.NGSWSMPE-v.....................................
U3D6C1_CALJA/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2G5EYU3_AQUCA/933-1072              .............................................gtaagr------KPqiSKK.K.SR.V.D.....GV.E..PL..PLLE..G.E...G.KS.L..K...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WS...E......F...............T....PRLKQ.....K.TFEE......IR................EYGTLF.LSHIA..E.D...I...-...T.E..SP..SF..................SDG.VPKE....GL....RI....HDV.LVRIAVLLLFREK............V........KKLQSVkPGTLLF---ded...................................
A0A446Y4M8_TRITD/939-1073              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A4W6CQS4_LATCA/1187-1327             .............................................fderte-------G..KAR.W.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9G0M9_TRIMA/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W6CQ10_LATCA/1399-1540             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
S7PV56_MYOBR/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W4FUC2_ELEEL/1286-1427             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLKG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A251L5I2_MANES/932-1068              .................................................ga--QTGRKP..YRK.R.AR.L.D.....NM.E..QL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEY.D.WK...E......F...............A....SRMKQ.....K.TYEE......IR................DYGVLF.LSHIV..E.D...I...-...N.D..SP..NF..................ADG.VPKE....GL....RI....LDV.LVRIAVLLLIRDK............V........KFVLEK.PGTPLFTD-d.....................................
A0A2A2LGJ7_9BILA/1361-1500             ............................................eefdgev--------..KRR.K.KE.R.D.....GE.K..LP..PLLA..K.V...N.GQ.I..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.T..QE..TY..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEKT.NGEWSMPE-a.....................................
A0A3P9MWP5_POERE/1376-1517             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A663DVM3_AQUCH/1418-1559             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A383Z4Y6_BALAS/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2U1MB79_ARTAN/613-749               ...............................................gtap----VRKP..TRK.K.TR.V.D.....NA.E..LL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.SQRA.QFVQI..LM..R.............FGV..................GDF.D.WA...E......F...............T....SRLKQ.....K.SYEE......IK................VYGTLF.LSHIS..E.D...I...-...T.D..AT..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLLLVRDK............V........KNSSDG.PSAPLFTD-d.....................................
A0A2B4SC18_STYPI/1340-1482             .............................................sqkseg-----RQR..RAA.R.GA.S.D.....KD.V..TP..PLLA..K.V...Q.GN.L..E...........VY.GF...NL.RQRK.AFLNA..IM..R.............YGLps..............pkGSP.R.SQ...W......F...............A....RDLRG.....K.SDKA......FQ................AYVSMF.LRHLC..E.P...G...T...D.N..RE..TF..................NDG.VPRE....GL....QR....TQV.LTRIGIMSLIRKK............V........EEFAHI.NGWEAYP--ee....................................
A0A2Y9L8Z9_ENHLU/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
CHR7_ARATH/855-999                     ..................................................k-PRTVTRP..YRK.R.AR.-.D.....NS.E..EI..PLME..G.E...G.RY.L..M...........VL.GF...NE.TERD.IFLRT..FK..R.............YGA..................GNF.D.WK...E......F...............V....NPLYM.....K.TYDE......IN................KYGILF.LKHIA..E.N...P...T...D.N..ST..NFkvit..........amvyADG.VPKE....GI....SS....DEL.LVSMTFMMLVKEK............C........QFLDNH.PTAPVFSN-y.....................................
D7LK56_ARALL/934-1070                  ..................................................e-VQTGRRP..YRR.K.GR.-.D.....NS.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............YGA..................GNF.D.WK...E......F...............V....PRLKQ.....K.TYDE......IN................EYGILF.LKHIA..E.D...I...D...E.N..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRIALLILVQEK............V........KFVEDH.PAKPVFTS-r.....................................
G3P6X0_GASAC/858-999                   .................................................ag--TNARRP..SRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A5J5N435_MUNRE/1416-1557             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3B6REH0_WHEAT/803-937               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A3B6TEW7_WHEAT/897-1031              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A670KJ11_PODMU/1314-1455             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3B3HAH2_ORYLA/1400-1541             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4U5MQW9_STECR/230-369               ..............................................tpgge-------R..RRR.K.GD.H.R.....SD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...SS.RQRR.AFYNA..VM..R.............WGMp...............phDAH.H.TQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GM....NR....QHV.LARIGIMALIRKK............V........QEFDSV.NGEWSVPE-i.....................................
A0A3Q0CL12_MESAU/1403-1544             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1S3SDF5_SALSA/1456-1597             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2K6KY24_RHIBE/1280-1421             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1S3U4P7_VIGRR/978-1102              .................................................lt--------..---.-.--.A.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIS..E.D...I...-...T.E..SS..TF..................SDG.VPKD....GL....RI....QDV.LVRIAVLLLIRDK............V........KFASQN.PQTPLFSD-d.....................................
A0A452I203_9SAUR/1124-1258             .................................................eg---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........RC----.---------qgreegw...............................
A0A2I3LYY7_PAPAN/1405-1546             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K6FW42_PROCO/1370-1511             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1V4JAN5_PATFA/1345-1486             .................................................er--SEARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5D2S4I7_GOSMU/619-755               .................................................vn--QPGRKP..YRK.R.IR.V.D.....NM.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SHDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSKK............V........KDASEK.PGTRLFTD-d.....................................
A0A674AY52_SALTR/1395-1536             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0P7XDL3_SCLFO/1300-1441             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3L8S385_CHLGU/1284-1425             ..................................................e-GQSGRRQ..SRR.Q.LK.T.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A087W0W9_ECHMU/1475-1630             ............................................egmgsqi--------..-GR.R.VR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NI.RQRR.AFVNS..VL..R.............YGLppppssfs..vagvpvasATA.S.TA...W......H...............S....RDLKG.....K.PERV......FR................AYVALF.MRHLC..E.P...E...SmnqE.N..NA..TY..................SDG.TPRD....GI....SH....QPI.LSRIGIMALVRKK............V........QEFEQI.NGLYSIPD-s.....................................
A0A4W5PFQ3_9TELE/1288-1429             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
H2N9B8_PONAB/1361-1502                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
F1NH78_CHICK/1385-1526                 ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-m.....................................
A0A3Q1H9G7_9TELE/1251-1392             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q1M5B6_BOVIN/1251-1392             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W5KQ24_9TELE/1271-1412             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2U3WPL5_ODORO/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2I0IGH7_PUNGR/37-173                .................................................gp--QPGKRP..YRK.R.AR.V.E.....SG.E..PH..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDY.D.WK...E......F...............V....PRLKQ.....K.TYEE......IR................NYGVLF.LTHIS..E.D...L...-...T.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LVRIATLMLIRDK............V........KWAAEN.TRVPLFTE-d.....................................
A0A6I8RW42_XENTR/1265-1406             ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............G........EIYKHL.NARSVH---ana...................................
A0A1S3LEW9_SALSA/1392-1533             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
F6H3J1_VITVI/934-1070                  ................................................gvp---SGRKP..YRK.K.AR.V.D.....NM.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQV..LM..R.............FGV..................GEF.D.WA...E......F...............T....PRLKQ.....K.TFEE......IK................DYGTLF.LAHIS..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....PDV.LVRIAVLLLVRDK............V........KLALEK.PGAPLFED-d.....................................
A0A674PEZ3_TAKRU/1274-1415             .................................................se--ANSRRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A091R1X4_MERNU/1380-1521             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3Q0FG19_VIGRR/21-120                ......................................satsrdgtstkgi--------..---.-.--.-.-.....-P.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdist.............................
A0A4W6FKL3_LATCA/1358-1499             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0N4TMU4_BRUPA/1267-1407             ...............................................efds-----TQQ..GKK.R.HR.D.R.....GD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDTY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEVS.NGEWSMPE-t.....................................
A0A1D6NTR2_MAIZE/921-1054              ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..S.............F--..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A0V1HVZ3_9BILA/1348-1488             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDAY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
F7GDA8_MACMU/1385-1526                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K6RAQ3_RHIRO/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A267FX29_9PLAT/1365-1503             ...........................................adgeaaag--------..--R.R.RR.-.D.....RD.V..KM.pPLLS..K.L...N.NQ.I..E...........VF.GF...NP.RQRR.AFLNS..VM..R.............FGLp...............psDVY.N.SA...W......M...............S....RDLRS.....K.PEKV......FR................AYTSLF.MRHLC..E.P...D...S...D.V..TD..TF..................SDG.VPRE....GI....NR....QHV.LTRIGIMALLRKK............V........QEFEKI.NGRSSLP--ya....................................
A0A4D9A0Q7_SALSN/957-1084              ................................................gaa---AVKKS..YRK.R.SR.-.D.....TS.E..KL..PLME..G.E...G.RY.L..R...........VL.GF...NQ.SQRA.VFVQI..LM..R.............FGV..................GEY.D.WT...E......F...............A....ARLKQ.....K.SYDE......IS................EYVPT-.-----..R.S...T...N...T.H..YL..LA..................ADN.VPKE....GL....RI....EDV.LVRIGTLSLIRDK............L........KVLSD-.---------gssvfkd...............................
Q7PZN7_ANOGA/1423-1564                 ...............................................lgrr----SRRR..IER.K.EA.E.R.....DN.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.H.SQ...W......L...............V....RDLRG.....K.SERI......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A445K5Q0_GLYSO/931-1067              .................................................gi--TTARRP..YKK.K.AR.T.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SA..TF..................TDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFVSQH.PQTPLFSD-d.....................................
G5CAQ0_HETGA/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A383Z562_BALAS/1379-1520             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1D6NTP4_MAIZE/921-998               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................R-----.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------aglv..................................
A0A2I4BGB9_9TELE/1379-1520             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
J3MBV3_ORYBR/910-1043                  .............................................isgrrg-------P..YSK.K.KQ.-.R.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SA..YY..................ADG.VPKE....-M....RA....DET.LVRLANISLVEEK............V........AAMEHG.KITKLFPS-y.....................................
A0A6Q2X934_ESOLU/1233-1372             .................................................pg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A452I1Q2_9SAUR/1095-1236             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A445B4X1_ARAHY/930-1066              .................................................ga--TTVRRP..YKK.K.IR.A.D.....SG.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEF.D.WK...E......F...............T....SRMKQ.....K.TYQE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SS..TF..................SDG.VPKE....GL....RI....QDV.LVRIALLLLIRDK............V........KSASRN.LGTPLFSD-d.....................................
A0A1D6NTN9_MAIZE/451-586               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A5N4C6W5_CAMDR/1397-1538             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A340YDI0_LIPVE/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A446Y4P9_TRITD/897-1031              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A402EXN2_9SAUR/1127-1268             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEPV.NGKYSTPD-l.....................................
A0A2Y9NDV6_DELLE/1408-1549             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A673B577_9TELE/1341-1482             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.NREG......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RTLTLI.T--------nmtsrrer..............................
A0A674PNF4_TAKRU/1365-1506             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDTF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2K3LHR5_TRIPR/1-63                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................-YGTLF.LSHIA..E.D...I...-...T.D..SS..TF.................tGDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFATEH.PQTPLFSD-d.....................................
A0A671VLM8_SPAAU/1260-1396             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RQ----.---------klkalcsv..............................
A0A673BBN7_9TELE/1270-1411             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.NREG......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RTSKHI.NGPM-----espel.................................
A0A0D2SYE7_GOSRA/737-873               .................................................vn--QPGRKP..YRK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SHDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSKK............V........KDASEK.PGTRLFTD-d.....................................
A0A556TUP2_BAGYA/727-832               ...................................mneylssfkevdreii--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....----K.....Q.EENV......DP................DYWEKL.LRHHY..E.Q...Q...Q...E.V..LA..SHlgkgkrprkpvnyndcsqEEQ.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K6R2Q7_RHIRO/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A074ZFV1_9TREM/1434-1567             ...............................................llam--------..-AR.R.TR.R.E.....RE.G..RL.pPLLS..R.V...S.GQ.I..E...........VL.GF...NV.RQRR.SFLNA..IM..R.............YGL..................PSL.E.LL...S......T...............V....RDLRC.....K.PDRV......LR................AYISLF.LRHLC..E.P...E...T...T.T..SD..TF..................SDG.VPRE....GI....AP....QHV.LSRIGIMALVAKK............V........KEFERI.NGRWSIPE-l.....................................
A0A151N473_ALLMI/1307-1448             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A2K3DHS8_CHLRE/1451-1581             .............................................aagaat--------..---.-.--.-.-.....--.-..-L.pPLKS..G.N...G.TT.L..Q...........VY.GL...NP.RDRS.TFIAA..LM..R.............FGLqia............dgqPDE.M.YR...A......F...............A....ARLPH.....R.PPAA......VR................EYTNLL.VAALS..E.P...V...-...G.A..GG..AW..................SNG.LRPE....DLlgphRA....TDV.LERIGFLHLVRRK............M........AEYRNR.---------talvde................................
A0A2K5QE90_CEBCA/1376-1517             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A663FFZ8_AQUCH/1173-1314             .................................................er--SEARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K5BUP0_AOTNA/1395-1536             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSIPD-l.....................................
A0A3Q0DIN9_CARSF/1355-1496             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W6CQ13_LATCA/1343-1484             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
G3X2W6_SARHA/1333-1428                 ...............................................gmrv--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..T.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
V3ZCR7_LOTGI/90-230                    .............................................fedktd-------S..RNR.T.RK.N.E.....KD.R..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.GEKV......FK................AYVSLF.MRHLC..E.P...G...A...D.N..SE..SF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGVQSMPY-k.....................................
A0A195DSZ7_9HYME/1370-1517             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...WqvngvlL...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A6Q2XZJ2_ESOLU/1290-1431             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A2R8QAE3_DANRE/1268-1409             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............aqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
B4IIS0_DROSE/1314-1455                 ...............................................dqng----AERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A2R8YDW2_HUMAN/666-807               ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A445K5R6_GLYSO/931-1067              .................................................gi--TTARRP..YKK.K.AR.T.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SA..TF..................TDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFVSQH.PQTPLFSD-d.....................................
A0A452EPT7_CAPHI/1389-1530             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
B9HAU9_POPTR/935-1071                  .................................................vv--QTVRRP..YKK.K.AR.V.D.....NT.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...KQ.NQRA.AFVQI..LM..R.............FGV..................GDY.D.WK...E......F...............A....SRLKQ.....K.TYEE......VE................NYGRLF.LTHIA..E.D...L...-...T.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............A........RFASEN.PGSALFTD-d.....................................
A0A267GNS5_9PLAT/1385-1523             ............................................gegqagg--------..--R.S.RR.R.D.....RD.V..KM.pPLLS..K.L...N.NQ.I..E...........VF.GF...NP.RQRR.AFLNA..IM..R.............YGLp...............psEVY.N.SP...W......M...............S....RDLRS.....K.PEKV......FR................AYTALF.MRHLC..E.P...D...S...D.V..TD..TF..................SDG.VPRE....GI....NR....QHV.LTRIGIMALLRKK............V........QEFEKV.NGEYSMPS-m.....................................
A0A0N5CYV6_THECL/1328-1467             ............................................fdssqlg--------..-RK.R.HR.D.R.....GD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDTY.H.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFELT.NGEWSMPE-v.....................................
A0A674GIC0_TAEGU/1305-1446             ..................................................e-GQSGRRQ..SRR.Q.LK.T.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
M4E5C0_BRARP/392-443                   .......................................rrrthrrkthhm--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.VPKI....GL....TR....DKV.LARITVMMLLQEK............V........KLIENH.PSKTVFPD-p.....................................
A0A667YYH2_9TELE/1263-1404             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3Q2GAE9_CYPVA/1225-1366             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1S3M318_SALSA/1400-1541             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A096NH31_PAPAN/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
G1MR33_MELGA/1390-1531                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-m.....................................
T1I428_RHOPR/1203-1345                 ..............................................knddg-----TKK..KRRpE.RR.D.E.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKH......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A672GYT3_SALFA/1307-1448             ................................................ert---EGERA..GGR.W.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A452CMC2_BALAS/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3Q0FG58_VIGRR/48-149                .......................................etptptrrgkki--------..---.-.-C.S.G.....IP.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdis..............................
Q59E34_DROME/1376-1517                 ...............................................dqng----AERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A2Y9K9E9_ENHLU/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A452SBM2_URSAM/1355-1496             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6I8PUL7_XENTR/1210-1347             ................................................aeg---KSRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.S.TH...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........R-----.---------psckqaystt............................
A0A093P2K7_PYGAD/1270-1411             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.Q..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............G....RDLRG.....K.REKG......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A672HK41_SALFA/1230-1371             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
L8INA7_9CETA/1343-1484                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A218U8V8_9PASE/1298-1356             .................................................gs---RGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WXV..................P--.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------dvpnv.................................
A0A452GSK1_9SAUR/1242-1383             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTAD-l.....................................
U3JQC8_FICAL/1373-1514                 .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2A2LJ70_9BILA/1253-1392             ............................................eefdgev--------..KRR.K.KE.R.D.....GE.K..LP..PLLA..K.V...N.GQ.I..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.T..QE..TY..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEKT.NGEWSMPE-a.....................................
A0A5F8GMB2_MONDO/1249-1389             ................................................egg----RRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
F7C307_MACMU/1388-1529                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A5F8GX17_MONDO/1279-1420             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6I8QIQ0_XENTR/1228-1369             ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............G........EIYKHL.NARSVH---ana...................................
H2YQ31_CIOSA/1111-1252                 ..............................................deefd-----NNE..NRR.K.NR.R.E.....KD.R..PL.pPMLA..R.V...G.GN.I..E...........VL.GF...SG.RQRR.TYLNF..VM..R.............YGMp...............ptEHF.Q.SR...W......L...............V....RELRV.....K.SEKE......FR................AYTSLF.MRHLC..E.P...G...S...E.N..SD..SY..................SDG.VPRE....GV....SR....QHV.LTRIGVMALIHKK............V........KEYKSI.NGDWSLPQ-l.....................................
A0A392SBP0_9FABA/1-26                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................EY----.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A383Z4Z4_BALAS/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
F7E9J1_CALJA/1432-1573                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4W5NBC1_9TELE/1197-1300             .................................................se--ANSRRP..SRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................KVGSSVpYTHLC..T.H...T...H...T.H..TH..TH..................---.----....--....--....---.-------------............-........------.---------thth..................................
A0A452EP92_CAPHI/1389-1530             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K5EJZ4_AOTNA/1267-1408             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A668AR85_9TELE/1349-1490             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1S3PZ08_SALSA/1395-1536             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2I3MAB0_PAPAN/1434-1566             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
E1ZCW7_CHLVA/1145-1276                 .............................................lrpaag--------..---.-.--.-.-.....--.-..-W..PLVQ..G.T...G.DQ.L..R...........VW.GF...TA.LQRR.CFLGI..VM..Q.............HGVaa.............lpgGGF.D.WA...P......M...............R....ARLPF.....K.HGRE......VE................KYGKLL.MELVA..A.A...A...V...P.R..ED..GGa................qPTGwELREevlgDV....CA....KDV.MARLGLLHLLRTT............T........EQ----.---------lravgsaaa.............................
A0A673BLI8_9TELE/1235-1376             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9Q6P5_DELLE/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2G3C7W9_CAPCH/927-1063              ...............................................gapv----VRRP..YRK.R.AR.G.D.....SS.V..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVKI..LM..R.............FGV..................GDY.D.WA...E......F...............T....PRLKQ.....K.TYEE......IR................DYGTLF.LSHIA..E.D...I...-...T.E..SP..SF..................TDG.VPKE....GL....RI....PDV.LVRIAVLLLIRDK............V........KAFLEE.RNSPLFS--md....................................
A0A2I2USQ8_FELCA/1435-1576             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
E9PU01_RAT/1373-1514                   ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1V4KNJ7_PATFA/1324-1465             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3Q1CAU4_AMPOC/1389-1530             .................................................ae--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A553MTF5_9TELE/1387-1512             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsmp.........................
A0A2K6L7F5_RHIBE/1202-1357             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A663FDX3_AQUCH/1194-1335             .................................................er--SEARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W5RZH5_9TELE/1169-1310             .................................................ed--QGSRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A670KE01_PODMU/1292-1428             .................................................eg---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........GNLT--.---------irvgkav...............................
L5LPT8_MYODS/1-58                      ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFELV.NGRYSTPD-l.....................................
F6Z8B5_MACMU/1357-1483                 ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.-------------............-........------.---------qefehingrwsmpel.......................
A0A183NDC4_9TREM/1425-1470             ...............................................vpvm--------..-SR.R.TR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NA.RQRR.SFLNA..VM..R.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A6J3QR94_TURTR/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
G3SAS1_GORGO/1376-1517                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0Q3M673_AMAAE/1380-1520             .................................................sp---AARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A668AIJ7_9TELE/1273-1414             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W5PD16_9TELE/1303-1444             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
H3CEN6_TETNG/1303-1417                 ....................................llclegnphmyglfc--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.HRQK.IFWNN..YM..E.............ISS..................DLN.G.FS...W......C...............I....VGLVS.....D.ITLS......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSLP--wm....................................
A0A0D2LUC9_GOSRA/934-1070              ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIS..E.D...I...-...T.E..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSNK............V........KTASEH.PGTRLFTD-d.....................................
A0A665T7F3_ECHNA/1375-1516             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A5N6R831_9ROSI/935-1071              ................................................app---AGRKP..YKK.K.AR.V.D.....GS.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.E...M...-...T.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFSPEN.PGSPLFTE-d.....................................
A0A067FJF2_CITSI/934-1070              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGILF.LTHIT..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFLSQK.PGTPLFTD-d.....................................
A0A5F8ATJ0_MACMU/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2R6XKK9_MARPO/967-1103              .............................................rkfqpp-----KKK..ARE.D.PP.E.E.....RS.E..PH..PLME..G.D...G.RS.L..K...........VL.GF...TQ.KQRA.IFVQV..LM..R.............YGL..................GDF.T.WS...E......F...............I....PRLKQ.....K.SREE......IK................DYGTLF.LSHIA..E.D...I...-...S.D..SS..TF..................SDG.VPKE....GL....RI....QDV.LVRLAVLHLIGDK............V........RLLHEN.PQAPLL---si....................................
F7AE12_XENTR/1328-1469                 .................................................rs--EAARRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3B5QWN8_XIPMA/1367-1508             ...............................................rpeg----GRRQ..SRR.Q.LK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A218VD67_9PASE/1373-1514             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3B6TAS8_WHEAT/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A665XDR4_ECHNA/1349-1490             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
G3Q4D3_GASAC/1400-1541                 .................................................te--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A485ME29_LYNPA/1359-1500             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
H3D637_TETNG/1333-1476                 ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDTF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FKt..............rAYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A670J335_PODMU/1243-1384             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEPV.NGKYSTPD-l.....................................
A0A670KFB6_PODMU/1302-1443             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A453QY94_AEGTS/231-365               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A673BAP2_9TELE/1248-1385             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.NREG......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RTLT--.---------lmltevk...............................
A0A654H8Y8_9CEST/1614-1736             ..............................................evtwt--------..---.-.--.-.-.....--.-..--..----..-.E...D.RR.M..L...........VY.GF...NA.HDRQ.MFLDS..VM..R.............FGLp...............pkGVLpP.QE...W......L...............P....MCLRS.....K.PPVH......LF................AYTALF.MRHLY..D.DplvA...D...D.N..AP..EW..................SDG.LPKE....GV....SG....LTV.LSRIGMMSLIRNK............V........IQFEDY.NAV------prkhr.................................
A0A2K5S0B7_CEBCA/1435-1576             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A084W4H4_ANOSI/1453-1594             ...............................................lgrr----SRRR..IER.K.EA.E.R.....DN.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.H.SQ...W......L...............V....RDLRG.....K.SERI......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A1S3E5S4_CICAR/929-1066              .................................................et--AASRRP..CKK.K.AR.SaD.....NT.D..PL..PLME..G.E...G.KS.L..R...........VL.GF...SR.SQRA.AFLQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SHIKQ.....K.TYEE......IK................EYGTLF.LSHIA..E.D...I...-...N.D..SS..SF..................SDG.VPKE....GL....QI....QDV.LIRIAVLLLIREK............V........KFASEN.PGTPLFSD-d.....................................
A0A3Q0E7Q2_CARSF/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A671YAJ9_SPAAU/1230-1371             ...............................................rseg----KAQP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A671VL87_SPAAU/1164-1305             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2K6P1L5_RHIRO/1338-1493             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A673BBP2_9TELE/1270-1408             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.NREG......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RTLT--.---------lmltkgqr..............................
A0A674HKR6_TAEGU/1311-1452             ..................................................e-GQSGRRQ..SRR.Q.LK.T.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A674DLG3_SALTR/1180-1321             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A674DHW1_SALTR/1330-1471             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A665T8L8_ECHNA/1268-1409             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A671X5U6_SPAAU/1282-1423             ...............................................rpeg----GRRH..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A3P9AUL2_9CICH/1250-1391             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A4W4EMC9_ELEEL/1344-1485             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W6CQN7_LATCA/1304-1445             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2Y9Q6P0_DELLE/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A674PPM4_TAKRU/1369-1510             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A383YTR4_BALAS/1047-1188             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A5E4MP38_9HEMI/1381-1522             .............................................geagkk---IKRKP..ERK.-.--.E.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..SE..NF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEEI.NGFYSMPE-l.....................................
H2SZ78_TAKRU/1401-1542                 .................................................se--ANSRRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2V0NYX9_9CHLO/1306-1452             ........................aaaaaaararrafesglpplvmdkhlg--------..---.-.--.-.-.....--.-..--..----..-.-...P.GG.M..R...........VY.GL...GA.AERG.ALLEA..FM..A.............FGLrpa...........asgeAAE.A.FA...R......L...............A....AAVPG.....R.TLKN......VA................FYVCLL.LRHIS..T.P...T...V...P.G..TD..VF..................ADG.VPRA....ATlghyKA....QEV.LARLGALHLAGRK............L........QEFGSR.PP-------sqfav.................................
A0A2G5EYW9_AQUCA/933-1072              .............................................gtaagr------KPqiSKK.K.SR.V.D.....GV.E..PL..PLLE..G.E...G.KS.L..K...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WS...E......F...............T....PRLKQ.....K.TFEE......IR................EYGTLF.LSHIA..E.D...I...-...T.E..SP..SF..................SDG.VPKE....GL....RI....HDV.LVRIAVLLLFREK............V........KKLQSVkPGTLLF---ded...................................
A0A2I3M2M5_PAPAN/1411-1542             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A452EPR9_CAPHI/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A5N4D2A6_CAMDR/1355-1496             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
K1RRH1_CRAGI/1327-1468                 .................................................ed--SEKNKR..GSR.Q.RG.S.E.....KD.R..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRN.....K.SEKV......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..AF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEQI.NGLHSMP--yi....................................
A0A6I8QK83_XENTR/1197-1338             .................................................er--AEGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.S.TH...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSMPE-l.....................................
A0A1S3JBC8_LINUN/1405-1547             ............................................ekselgr-------G..GRR.RgGV.P.E.....KD.R..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKV......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGTESMPY-k.....................................
A0A1S3U4M3_VIGRR/977-1101              .................................................lt--------..---.-.--.A.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIS..E.D...I...-...T.E..SS..TF..................SDG.VPKD....GL....RI....QDV.LVRIAVLLLIRDK............V........KFASQN.PQTPLFSD-d.....................................
A0A0V0RT37_9BILA/1399-1539             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..SY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A1D6NTP5_MAIZE/924-1059              ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A5F8G5C1_MONDO/1341-1482             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A091G5S6_9AVES/1294-1435             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A315VLI6_GAMAF/1463-1555             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FN................S-----.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------akykqnldynkqke........................
A0A430QHZ4_SCHBO/1449-1582             ...............................................vpvm--------..-SR.R.TR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NA.RQRR.SFLNA..VM..R.............YGL..................PPS.D.QP...W......M...............V....RDLRC.....K.PDRV......FR................AYICLF.MRHLC..E.P...E...T...E.N..SD..SF..................SDG.VPRE....GL....ST....QHV.LSRIGIMVLVRKK............V........QEFEKI.NGHWSMPD-l.....................................
A0A2K6FJ22_PROCO/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A674AY76_SALTR/1321-1462             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q1H2B6_ANATE/1167-1308             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2K6KY55_RHIBE/1280-1421             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A493TQL1_ANAPP/429-476               .................................................mp--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..Q...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.SEKE......FK................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A674AZ12_SALTR/1295-1436             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A139WC28_TRICA/1375-1517             ..............................................egdln-----RRS..RRR.M.ERkD.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGEYSMPE-v.....................................
A0A0A0L332_CUCSA/932-1068              ................................................gvp---SVKKP..YRR.K.SR.V.D.....SS.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................EYGTLF.LSHIA..E.D...I...-...T.E..SA..NF..................SDG.VPKE....GL....RI....QDV.LIRIAVLLLIRDK............A........KFVPES.LSAPLFTD-d.....................................
A0A674F8M3_SALTR/1289-1430             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1S3PYT6_SALSA/1386-1527             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1R3J7B5_9ROSI/1-50                  ..................................................m--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLLGTK............V........KSASEN.PGTRLFTD-d.....................................
A0A0K9NTM9_ZOSMR/938-1074              ...............................................etgk----RTQN..PKK.R.AR.V.E.....NM.E..PL..PLID..G.E...G.KV.F..R...........VL.GF...NR.SQRF.AFLKL..LM..R.............FGL..................GDF.C.WN...E......F...............V....SALKG.....K.SLEE......IK................QYAMLF.LSHVI..E.E...P...-...T.E..SQ..NF..................LDG.VPKE....GL....RP....SDV.LVRISTLQLIRDK............F........RFVKDN.QVTSLFSE-q.....................................
A0A1S3PYS6_SALSA/1394-1535             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3L6S0I0_PANMI/895-1031              ..............................................gnvsg-----RRG..QYS.K.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.M..R...........VL.GF...NH.AQRS.LFLQT..LN..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.D...I...-...N.D..SD..YF..................SDG.VPKE....GM....RV....DDV.LVRIANISLIEEK............V........AAMGQG.KNTNLFPN-y.....................................
A0A6Q2XGF3_ESOLU/1207-1344             .............................................pdnrri-------L..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RA----.---------qggsqrpeml............................
W5LL44_ASTMX/1306-1447                 .................................................ae--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A674DL88_SALTR/1299-1440             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2I4BUT3_9TELE/1368-1509             ...............................................rpeg----GRRQ..SRR.Q.LK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A1S3WBR6_ERIEU/1214-1355             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5B7FN30_PORTR/15-102                ...............................asstrllnthvelfilkers--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.P.SS...R......L...............V....RDLRG.....K.SEKC......FR................AYTSLF.MRHLC..E.P...G...N...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........------.---------n.....................................
A0A485MDU5_LYNPA/1136-1277             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2R8Q004_DANRE/98-245                ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............aqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKEklhfnsVM................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
B4IXP0_DROGR/1373-1514                 .................................................de--QNGERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A2I0U4B3_LIMLA/1227-1367             .................................................ss---AARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0B0P6N8_GOSAR/896-979               .................................................vn--QPGRKP..YKK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SYDE......IK................ELSE--.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------filvcf................................
A0A2R6XKD5_MARPO/967-1103              .............................................rkfqpp-----KKK..ARE.D.PP.E.E.....RS.E..PH..PLME..G.D...G.RS.L..K...........VL.GF...TQ.KQRA.IFVQV..LM..R.............YGL..................GDF.T.WS...E......F...............I....PRLKQ.....K.SREE......IK................DYGTLF.LSHIA..E.D...I...-...S.D..SS..TF..................SDG.VPKE....GL....RI....QDV.LVRLAVLHLIGDK............V........RLLHEN.PQAPLL---si....................................
A0A2I4CIX3_9TELE/1406-1547             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q2DNZ2_CYPVA/1348-1489             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W6FN43_LATCA/1229-1370             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W4EM30_ELEEL/1339-1480             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
F6Z8A7_MACMU/1371-1512                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A1U8BU95_MESAU/1402-1543             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0N4UAR8_DRAME/1095-1235             .............................................grsdge-------D..KKK.R.HR.D.R.....ND.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFETS.NGEWSMPE-i.....................................
A0A665WLM7_ECHNA/1201-1342             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A674NWE1_TAKRU/1339-1480             ...............................................rpeg----GRRH..SRR.Q.LK.N.D.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.TH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
T1K2L0_TETUR/1158-1299                 ................................................kte--EKTGRR..KGR.N.EK.T.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDSF.N.SQ...W......L...............V....RDLRC.....K.SERN......FR................AYVSLF.MRHLC..E.P...G...A...D.H..LE..TF..................ADG.VPRE....GM....SR....QHV.LTRIGIMSLIRKK............V........QEFEHI.NGIQSMP--i.....................................
A0A671V9W4_SPAAU/1219-1360             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3L6PHK5_PANMI/856-992               ..............................................gnvsg-----RRG..QYS.K.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.LFLQT..LN..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVDE......IQ................RYAELV.MAHLV..E.D...I...-...N.D..SD..YF..................SDG.IPKE....GM....RV....DDV.LVRIANISLIEEK............V........AAMGQG.KNTNLFPN-y.....................................
A0A2R8Y5M9_HUMAN/225-366               ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3M2K6_SALSA/1404-1545             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1A6GGU2_NEOLE/1332-1473             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3P8TRH4_AMPPE/1265-1406             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A4P1REP7_LUPAN/947-1014              ................................................snl--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......LT................SYGTLF.LSHIA..D.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....PDI.LVRIAVLLLIREK............V........KYASEN.PGTPLFSD-d.....................................
A0A667YQ95_9TELE/1355-1496             ................................................dqg---RGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A1S3U4S4_VIGRR/934-1070              .................................................gt--TTAKRP..YKK.K.AR.T.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIS..E.D...I...-...T.E..SS..TF..................SDG.VPKD....GL....RI....QDV.LVRIAVLLLIRDK............V........KFASQN.PQTPLFSD-d.....................................
M3YBT4_MUSPF/1082-1223                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3P9AXA2_9CICH/1376-1517             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
M3YZJ4_MUSPF/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A452SAY2_URSAM/1370-1511             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A446Y4D9_TRITD/865-999               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A673UG63_SURSU/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3ACD9_ERIEU/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W5PJY3_9TELE/1314-1455             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A446Y4A6_TRITD/901-1035              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A286ZJ13_PIG/1414-1555               ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
J9NW81_CANLF/1350-1491                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6Q2XVB4_ESOLU/1176-1316             .............................................deraeg-------K..REK.G.LR.G.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W5NYP1_9TELE/1401-1542             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A452SBK9_URSAM/1287-1428             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5F8ASA7_MACMU/1344-1485             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
J9NRN3_CANLF/1371-1512                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A674P0A6_TAKRU/1356-1497             ...............................................rpeg----GRRH..SRR.Q.LK.N.D.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.TH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A665WHB2_ECHNA/1223-1364             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2R2MRS4_LINUN/996-1138              ............................................ekselgr-------G..GRR.RgGV.P.E.....KD.R..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKV......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGTESMPY-k.....................................
M3W5P4_FELCA/1386-1527                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2G2WKS5_CAPBA/179-315               ...............................................gapv----VRRP..YRK.R.AR.G.D.....SS.V..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVKI..LM..R.............FGV..................GDY.D.WA...E......F...............T....PRLKQ.....K.TYEE......IR................DYGTLF.LSHIA..E.D...I...-...T.E..SP..SF..................TDG.VPKE....GL....RI....PDV.LVRIAVLLLIRDK............V........KAFLEE.RNSPLFS--md....................................
A0A667Y4Y1_9TELE/1181-1322             .................................................kv--SNARRP..NRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A5F8H404_MONDO/1281-1422             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A674F838_SALTR/1288-1426             ................................................lac----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........HIN---.---------qslkltnlsh............................
A0A369RVZ2_9METZ/1180-1320             ...................................qkpnkiikndiskddk--------..---.-.--.-.-.....IV.K..PA..ELLS..T.V...N.GR.V..E...........VY.GF...NV.RQRR.AFVNL..IL..R.............YGMpp..............edISA.D.RK...W......F...............T....RDLRS.....K.PIKE......YQ................EYVNLF.LKHLC..ElE...G...D...S.N..SE..SY..................SDG.VPKD....NL....SR....GLV.LSRLAMMQLIKRK............V........KEYESV.NGV------sykn..................................
A0A067FMV6_CITSI/934-1070              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGILF.LTHIT..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFLSQK.PGTPLFTD-d.....................................
M4AA75_XIPMA/1266-1407                 .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
T1JDG0_STRMM/1346-1490                 ........................................rnegnerrgrk--------..RGS.G.MG.S.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FR................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEAI.NGTHSMP--ld....................................
A0A654GYQ6_9CEST/1504-1640             ...............................................imig--------..--R.R.MR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NI.RQRR.SFVNA..VM..R.............YGLpp..............adQSY.V.SA...W......N...............A....RDLRG.....K.PERV......FR................AYVSLF.MRHLC..E.P...E...S...V.N..QE..TY..................ADG.VPRD....GI....SH....QQL.LSRIGIMSLVRKK............V........QEFEHI.NGQYSMPE-l.....................................
A0A3N7G5U0_POPTR/828-964               .................................................gi--QTLKRP..YKK.K.GR.V.D.....NM.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............YGV..................GDY.D.WK...E......F...............A....PRLKQ.....K.TYEE......VE................NYGRLF.LTHIA..E.D...L...-...S.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LIRIAVLLLIRDK............A........RFASEN.PGSLLYT--dd....................................
A0A1S3N801_SALSA/1443-1584             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3Q1C616_AMPOC/1276-1417             .................................................ae--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A445KWD6_GLYSO/1044-1180             .................................................gt--TTARRP..YKK.K.AR.T.D.....ST.E..PH..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..ST..TF..................ADG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KYASQH.PQTPLFSD-d.....................................
A0A5F5Y6P1_FELCA/1349-1490             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2G9UW43_TELCI/741-878               ..............................................gigge-------K..KKK.R.ER.-.D.....AE.K..LP..PLLA..K.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.SQ...W......L...............T....RDLKG.....K.SERA......FK................TYTSLF.MRHLC..E.P...G...A...D.S..QE..TF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEQV.NGEWSMPE-v.....................................
A0A182GTX9_AEDAL/3048-3189             ...............................................lnrr---SKRRI..ERN.Q.SE.-.R.....DN.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A093G9I8_DRYPU/1278-1413             .................................feerpegqsgrrqsrrql--------..---.-.--.-.-.....--.-..--..--KS..D.R...G.PL.A..P...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-v.....................................
A0A670KIP2_PODMU/1259-1399             .................................................eg---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0D9RDH2_CHLSB/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5F8G7P5_MONDO/1194-1335             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A059BA43_EUCGR/932-1068              .................................................gi--QTGRRP..YRK.R.SR.V.D.....ST.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.TYEE......IK................EYGRLF.LSHIA..E.E...I...-...T.D..LP..TF..................ADG.VPKE....GL....RI....QDV.LVRIAQLMLVKEK............V........LSASEN.VGAPLFPE-e.....................................
A0A3S2MU28_ORYJA/1372-1513             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0V0RT45_9BILA/1505-1586             ...............................................iafr--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..SY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A183TE50_SCHSO/178-315               ..............................................gimig--------..--R.R.MR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NI.RQRR.SFVNA..VM..R.............YGLpp..............adQSY.V.SA...W......N...............A....RDLRG.....K.PERV......FR................AYVSLF.MRHLC..E.P...E...S...V.N..QE..TY..................ADG.VPRD....GI....SH....QQL.LSRIGIMSLVRKK............V........QEFEHI.NGQYSMPE-l.....................................
A0A446X4V2_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A446Y488_TRITD/820-954               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A3Q7XPF0_URSAR/1435-1576             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A674N2G8_TAKRU/1389-1530             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
I3JS39_ORENI/1232-1373                 ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A091I8R0_CALAN/1380-1521             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
K7HE50_CAEJA/447-587                   .............................................dddeyd-------E..KKK.R.RR.D.E.....SS.E..KM.pPLMA..K.V...N.GQ.I..E...........IL.GF...NT.RQRK.AFYGA..IM..R.............WGMp...............pqDAH.H.SL...W......L...............V....RDLRS.....K.SEKV......FR................AYASLF.MRHLC..E.P...G...A...D.G..ND..TF..................NDG.VPRE....GL....NR....QLV.LSRIGWLSLLRRK............V........QEFEAF.NGDWSMPE-v.....................................
A0A674DK65_SALTR/1299-1440             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A670JXP3_PODMU/1343-1484             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K6MIY2_RHIBE/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A540MHA8_MALBA/953-1044              ..............................................asggk-----RPP..NRK.R.SR.V.E.....ST.E..PP..PLME..G.E...G.RS.F..K...........VL.GF...NQ.SQRA.LFVQI..MM..R.............FGV..................GDY.D.WK...E......F...............T....ARMK-.....K.TFEE......ID................RHGYGR.WQAIV..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------ddkdlrlq..............................
A0A3B6REL2_WHEAT/924-1019              ..............................................nvsgr-----KAQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................SYVTKT.LDKIT..C.N...Q...R...D.L..IC..--..................---.----....--....--....---.-------------............-........------.---------hftk..................................
A0A2U3Y2E4_LEPWE/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669DV73_ORENI/1319-1460             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K5EK28_AOTNA/1187-1328             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6A2Z7C0_HIBSY/117-192               .............................................dddlag------LP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDY.D.WK...E......F...............A....PRLKQ.....K.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------hgygrwka..............................
A0A3Q0GQV0_ALLSI/1316-1457             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
D7MAU0_ARALL/861-1004                  ..................................................k-PRTVTKP..YRK.R.NR.-.D.....KS.-..EL..PVME..G.G...G.KS.F..E...........VL.GF...NR.TERE.IFLRT..FK..R.............YGA..................GNF.D.WK...E......F...............I....HPLHM.....K.TFDE......IN................KYGILF.LQHIA..E.N...S...K...N.N..SS..TFsvis..........amvsADG.IPKE....GI....RS....DEL.LMSMTFMMLLKEK............C........QFLDDH.PTEPVFRD-y.....................................
A0A4W3I3V7_CALMI/909-1049              ..................................................k-SEAGRRN..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..FM..R.............WGMp...............pqDSF.S.SH...W......L...............V....RDLRG.....K.SQKE......FR................AYVSLF.MRHLC..E.P...G...-...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEYI.NGRYSIPE-l.....................................
A0A1S3N1D8_SALSA/1395-1536             .................................................se--ANSRRP..SRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2A2LGY6_9BILA/1155-1294             ............................................eefdgev--------..KRR.K.KE.R.D.....GE.K..LP..PLLA..K.V...N.GQ.I..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.T..QE..TY..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEKT.NGEWSMPE-a.....................................
A0A3Q0FF12_VIGRR/68-169                .......................................etptptrrgkki--------..---.-.-C.S.G.....IP.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdis..............................
E2AEH3_CAMFO/1372-1513                 ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A668AHZ6_9TELE/1310-1451             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
F6ZS77_MACMU/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W6EIC3_LATCA/1293-1434             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A2I0MLP4_COLLI/1373-1514             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2G5EYW7_AQUCA/841-980               .............................................gtaagr------KPqiSKK.K.SR.V.D.....GV.E..PL..PLLE..G.E...G.KS.L..K...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WS...E......F...............T....PRLKQ.....K.TFEE......IR................EYGTLF.LSHIA..E.D...I...-...T.E..SP..SF..................SDG.VPKE....GL....RI....HDV.LVRIAVLLLFREK............V........KKLQSVkPGTLLF---ded...................................
A0A4U5MQH9_STECR/985-1124              ..............................................tpgge-------R..RRR.K.GD.H.R.....SD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...SS.RQRR.AFYNA..VM..R.............WGMp...............phDAH.H.TQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GM....NR....QHV.LARIGIMALIRKK............V........QEFDSV.NGEWSVPE-i.....................................
A0A2K6RZM2_SAIBB/1347-1488             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3P8ZUB4_ESOLU/1289-1413             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVITLL---............-........------.---------yt....................................
A0A4W4EHT7_ELEEL/1361-1502             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A673ZW82_SALTR/1337-1478             .................................................rk--SNSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2R8Y5J0_HUMAN/1360-1501             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3A1J3_ERIEU/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3Q0CLH2_MESAU/1410-1551             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6A2XCY9_HIBSY/929-1065              ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDY.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGFLF.LTHIA..E.E...L...-...T.D..TP..TF..................SDG.VPKE....GL....RI....PDV.LVRISVLLLLRKK............V........KTASEQ.PGASLFTN-d.....................................
A0A2Y9RYS6_TRIMA/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K5EJZ6_AOTNA/98-239                ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A455AQL8_PHYMC/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3P8S9Q9_AMPPE/1388-1529             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2U3WWY2_ODORO/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3N3V0_SALSA/495-636               .................................................se--ANSRRP..SRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q3GS44_KRYMA/1315-1368             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------lvas..................................
A0A1D6NTR1_MAIZE/921-1056              ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A2U3TZM0_HUMAN/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
E9QAS4_MOUSE/1360-1501                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
F7C528_MOUSE/1335-1476                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A452HW37_9SAUR/1118-1252             .................................................eg---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........RC----.---------qgreegw...............................
A0A0V0WJD5_9BILA/1412-1552             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A195ATC9_9HYME/1362-1509             ...........................................ddkedddf--------..DEK.E.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...WqvngvlL...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A671WDD3_SPAAU/1383-1524             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A452SBM7_URSAM/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A662YRW5_ACIRT/1469-1562             .................................................rt--ENARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................IGVM--.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------slirkkeskape..........................
F7C337_MACMU/1388-1529                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
F7ABK0_MONDO/1320-1461                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4W4ELC4_ELEEL/1165-1301             ..............................................lvpqw--------..--K.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1U7YBE1_NICSY/937-1073              ...............................................gapv----VRKA..HRK.K.AR.V.D.....SA.E..SH..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEF.D.WA...E......F...............T....PRLKQ.....K.TYEE......IK................DYGALF.LSHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KAFSEK.TGGPLFAE-d.....................................
A0A3Q7TIQ1_VULVU/1375-1516             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A446Y4P1_TRITD/924-1019              ..............................................nvsgr-----KAQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................SYVTKT.LDKIT..C.N...Q...R...D.L..IC..--..................---.----....--....--....---.-------------............-........------.---------hftk..................................
A0A484CPB5_PERFV/1383-1524             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A553MTF1_9TELE/1462-1586             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsm..........................
A0A2K6RAS1_RHIRO/1360-1501             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K3P0Y7_TRIPR/485-560               .................................................gt--TTSRRP..YKK.K.AR.T.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................EY----.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A2K6SKG0_SAIBB/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2K5EJW2_AOTNA/1339-1480             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2K3LUE4_TRIPR/1-63                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................-YGTLF.LSHIA..E.D...I...-...T.D..SS..TF.................tGDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFATEH.PQTPLFSD-d.....................................
A0A3P9PHA6_POERE/1302-1443             ...............................................rpeg----GRRQ..SRR.Q.LK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A3Q0FG83_VIGRR/20-121                ........................................ssatsrdgtst--------..---.-.-K.A.G.....IP.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdist.............................
A0A3Q1GZQ0_ANATE/1410-1551             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A0V0UCF0_9BILA/1370-1510             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A087XUZ1_POEFO/1375-1516             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2I3HV10_NOMLE/1372-1513             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........SVFVLC.PSSASVPE-f.....................................
L8Y5W7_TUPCH/1341-1482                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6A5BN55_NAEFO/940-1066              ............................................kikiypn--------..---.-.--.-.-.....--.-..--..----..-.-...-.NS.V..S...........VV.GF...SP.MERM.IFVAT..LW..R.............YGLgfpn..........snnsKDE.K.WY...E......F...............Y....NILRKvsklrK.TLKQ......VI................EFGTFM.LDHFS..E.Q...V...D...Q.R..YS..HY..................SDG.TPTD....RL....NN....VKI.LQQIASMFIIYNV............V........NKYKN-.---------mlienkd...............................
A0A668AJT6_9TELE/1154-1295             ..............................................edfde-----RTE..GKR.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
I3K598_ORENI/1184-1325                 .................................................de--RTEGKP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9SUZ3_PHYMC/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W3HKP4_CALMI/905-1045              ..................................................k-SEAGRRN..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..FM..R.............WGMp...............pqDSF.S.SH...W......L...............V....RDLRG.....K.SQKE......FR................AYVSLF.MRHLC..E.P...G...-...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEYI.NGRYSIPE-l.....................................
G1PPV0_MYOLU/1383-1524                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3P8S7T9_AMPPE/1249-1390             .................................................is--SNARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
D8T4M1_SELML/912-1047                  .................................................iq---SVEEK..TKK.Q.KG.E.S.....TV.H..PA..PLME..G.D...G.KS.L..K...........VL.GF...RR.KHRV.RFVQI..LM..R.............FGL..................GDF.T.WS...S......F...............V....PYFKQ.....K.QLHE......IK................EYGTLF.LTHIA..E.D...V...-...T.D..SD..TF..................ADG.VPKE....GL....RI....QDV.LVRVAVLHLITNK............V........KQYTQN.PKARLFS--ya....................................
A0A2P5ANE0_PARAD/963-1099              ................................................gta---SLRKT..NRK.K.SR.V.D.....SS.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WR...D......F...............T....ARMKQ.....K.TYEE......IK................DYGTLF.LTHIT..E.E...I...-...T.D..SP..TF..................SDG.VPKD....GL....RI....QDV.LVRIAVLMLVREK............V........TFALEN.PGGPLFVD-d.....................................
A0A2G9HDW0_9LAMI/924-1046              ............................................etaapap--------..---.-.--.-.D.....TP.E..ET..PLME..G.E...G.AN.L..R...........VL.GF...NR.RQRA.AFVNI..MR..R.............FGP..................GDY.D.WA...D......F...............V....PRLKQ.....K.TPGE......IA................KYGKLF.LRHVT..E.D...I...-...T.D..SP..TY..................SDG.VPKE....GL....DV....DDL.LVRIGTVNLIRDK............A........KAI---.---------sggsil................................
A0A2Y9Q106_DELLE/1368-1509             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
D8S9B2_SELML/906-1043                  ...............................................kdaa----KRTP.gSRK.K.PR.V.E.....AT.G..PP..PLME..G.E...G.KS.I..L...........IL.GF...NR.KQRA.MFVQV..LM..R.............FGF..................GDF.S.WS...E......F...............A....SCFKH.....K.TVDE......IK................EYAALF.LMHVT..E.E...Q...-...T.D..IP..TF..................SDG.IPKE....GL....RI....QDV.FVRLAILHLIWEK............V........KNLNEN.PSTSLFPS-v.....................................
A0A151N497_ALLMI/1313-1454             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A553R279_9TELE/1329-1470             .................................................ae--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...S.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SERE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..SF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSLP--wm....................................
A0A3Q3KRF2_9TELE/1239-1380             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3M6TWK6_9CNID/1304-1446             .............................................nqkseg-----RQR..RAA.R.GA.S.D.....KD.V..TP..PLLA..K.V...Q.GN.L..E...........VY.GF...NL.RQRK.AFLNA..IM..R.............YGLps..............pkGSP.R.SQ...W......F...............A....RDLRG.....K.SDKA......FQ................AYVSMF.LRHLC..E.P...G...T...D.N..RE..TF..................NDG.VPRE....GL....QR....TQV.LTRIGIMSLIRKK............V........EEFAHI.NGWEAYPD-e.....................................
A0A446Y4T0_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A5K1UUG4_CALJA/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K6G6D1_PROCO/1343-1484             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
W5JRF8_ANODA/1464-1605                 ...............................................lgrr----SRRR..IER.K.EA.E.R.....DN.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.H.SQ...W......L...............V....RDLRG.....K.SERI......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A3S4RLC0_9ACAR/1282-1422             ................................................nde---KIGRR..KGR.N.ER.S.E.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FR................AYVSLF.MRHLC..E.P...G...A...D.N..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRVGIMSLIRKK............V........QEFEHI.NGTQSMP--i.....................................
A0A1S3PYS4_SALSA/1397-1538             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A5A7PRP3_STRAF/949-1064              .................................................ga--ASTRRP..YRK.R.TR.-.D.....AS.E..KL..PLME..G.E...G.KY.L..R...........VL.GF...NH.AQRA.IFVQL..FM..R.............FGT..................SRN.G.WG...E......Y...............E....KRLKQ.....K.TPEE......IK................EYV---.-----..-.-...-...-...-.-..--..--..................TDG.VPKD....GL....RV....DDV.LVRLGTLSLIRDK............L........EALSK-.---------gsvlftd...............................
A0A1A6GMS6_NEOLE/1167-1308             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A671VBN3_SPAAU/1292-1433             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A4W3HKP8_CALMI/923-1063              ..................................................k-SEAGRRN..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..FM..R.............WGMp...............pqDSF.S.SH...W......L...............V....RDLRG.....K.SQKE......FR................AYVSLF.MRHLC..E.P...G...-...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEYI.NGRYSIPE-l.....................................
I3K597_ORENI/1402-1543                 .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A446Y4V6_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A1D2M9Q1_ORCCI/1248-1351             ..............................................teagt----RRRR..RGM.E.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.TQ...W......L...............V....RDLRG.....K.SEKC......FK................AYVSLF.MRHLC..E.P...G...K...H.-..--..--..................---.----....--....--....---.-------------............-........------.---------yyssscfsr.............................
A0A3M0K2V2_HIRRU/1373-1514             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2J6LJA7_LACSA/927-1063              ...............................................gatp----VKKP..YRK.K.TR.V.D.....NA.E..LL..PLME..G.E...G.RA.F..R...........VL.GF...NQ.SQRA.QFVQI..LM..R.............FGV..................GDF.D.WA...E......F...............T....SRLKQ.....K.SYEE......IK................VYGTLF.LSHIS..E.D...I...-...T.D..AA..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLLLVRDK............V........KNTSEN.QSAPLFTD-d.....................................
A0A2F0B1G8_ESCRO/1111-1252             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6Q2Y678_ESOLU/1292-1433             .................................................ae--ANSRRP..NRK.G.LR.G.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K6RZN2_SAIBB/1119-1260             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K6L7B8_RHIBE/98-253                ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A669DFU8_ORENI/1303-1444             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
F1RIM3_PIG/1414-1555                   ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K6E9K0_MACNE/1405-1527             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....H.MS--......--................------.LSYIF..I.V...G...A...V.G..LF..L-..................FDG.VPRE....GL....SR....QHV.LTRIGV-------............-........QE----.---------felfngrwsmpel.........................
A0A553MTF2_9TELE/1442-1567             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsmp.........................
F7EA07_CALJA/1376-1517                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2K5IMK0_COLAP/1398-1539             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A5F8A879_MACMU/1246-1387             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A091V734_OPIHO/1372-1513             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W6EJQ8_LATCA/1281-1422             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A3P7YD55_9TREM/624-745               ............................................itwhrde--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.L..F...........IY.NF...GP.NDRQ.LFNNA..VM..R.............FGLpp..............pgIVP.P.QD...W......L...............P....PALYY.....K.SQFQ......LF................GYVCLY.MKHLY..D.D...PnglD...E.S..EE..SW..................SDG.LPKE....HL....CV....PAV.LSRIAVMALIRNK............V........LQYEDV.NGPTSIS--td....................................
A0A2K6AMM4_MACNE/1414-1546             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6J3S946_TURTR/1408-1549             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3Q3B9Y4_KRYMA/1317-1458             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............cqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QLV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSMPE-l.....................................
A0A3Q1M3Y2_BOVIN/1430-1571             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0V1BE52_TRISP/1483-1564             ...............................................iafr--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
K7FGR4_PELSI/1317-1458                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A315WB83_GAMAF/1301-1442             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A446X4T9_TRITD/201-335               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A674F8T0_SALTR/1190-1331             .................................................ed--QGGRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A670J280_PODMU/1233-1374             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEPV.NGKYSTPD-l.....................................
S7Q3J5_MYOBR/1359-1500                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1S3M238_SALSA/1401-1542             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1I7VLI1_LOALO/1287-1427             ...............................................efds-----TQQ..GKK.R.HR.D.R.....GD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDTY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEAS.NGEWSMPE-a.....................................
A0A1D6NTP1_MAIZE/921-1056              ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
S9XJP7_CAMFR/1267-1408                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0K0FKC5_STRVS/1234-1374             ..........................................dsdsaanel--------..--K.R.RR.N.Y.....AD.D..VL.pPLVG..K.V...N.GQ.I..E...........IL.GF...NP.RQRK.AFYQS..IM..R.............WGMp...............pnDAY.Q.SQ...W......L...............V....PDLKS.....K.SERA......YK................VYAALF.LRHLC..E.D...A...S...T.K..SE..FF..................SDG.VPRE....GL....NK....QHI.LSRIGMMGLIRKK............I........NEFESL.NGEWSIPE-i.....................................
A0A674EW60_SALTR/1260-1401             .................................................se--ANSRRP..SRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4Z2DRH0_SCHJA/374-507               ...............................................vpvm--------..-SR.R.TR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NA.RQRR.SFLNA..VM..R.............YGL..................PPS.D.QP...W......M...............V....RDLRC.....K.PDRV......FR................AYICLF.MRHLC..E.P...E...T...E.N..SD..SF..................SDG.VPRE....GL....ST....QHV.LSRIGIMTLVRKK............V........QEFEKI.NGHWSMPD-l.....................................
A0A2I4CIX8_9TELE/1406-1547             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A455AS62_PHYMC/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A067FJE6_CITSI/934-1070              .................................................gt--QPGRKP..NKK.R.SR.V.D.....SM.E..PP..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.SYEE......IR................EYGILF.LTHIT..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFLSQK.PGTPLFTD-d.....................................
A0A4W2E4D7_BOBOX/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2K6E9P5_MACNE/1380-1502             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....H.MS--......--................------.LSYIF..I.V...G...A...V.G..LF..L-..................FDG.VPRE....GL....SR....QHV.LTRIGV-------............-........QE----.---------felfngrwsmpel.........................
A0A2Y9PW81_DELLE/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A383YTT8_BALAS/1251-1392             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6I8U977_AEDAE/1373-1514             ...............................................lnrr---SKRRI..ERN.Q.SE.-.R.....DN.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A0E0DXZ4_9ORYZ/860-994               ..............................................lagrr------GP..YSK.K.KQ.R.S.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......F...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A4U6UTT9_SETVI/918-1054              .............................................gnvsgr------RG..QYS.K.RK.S.R.....NV.D..LI..PLME..G.E...G.RT.L..R...........VL.GF...NT.AQRA.MFLQT..LN..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.D...I...-...N.D..SD..YF..................SDG.VPKE....GI....RV....DDV.LVRIANISLIEEK............V........AAMGQG.KITNLFPN-y.....................................
A0A0D3GDJ7_9ORYZ/929-1063              ..............................................lagrr------GP..YSK.K.KQ.R.S.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......F...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A453QY66_AEGTS/662-796               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A446X4X0_TRITD/939-1073              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A5F5XRZ3_FELCA/1386-1527             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A672HFW7_SALFA/1257-1398             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1S3LDZ2_SALSA/1363-1504             .................................................ed--QGGRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3Q2EB83_CYPVA/1270-1411             ...............................................rpeg----GRRQ..SRR.Q.LK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A6I8RFD2_XENTR/1346-1487             .................................................rs--EAARRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A446Y4S6_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A2G5TJP6_9PELO/1271-1411             .............................................ddddyd-------E..KRK.K.RR.D.E.....NN.E..KM.pPLMA..K.V...N.GQ.V..E...........IL.GF...NP.RQRK.AFYGA..VM..R.............WGMp...............pqDSH.Q.SQ...W......L...............V....RDLRN.....K.SEKV......FR................AYASLF.MRHLC..E.P...G...A...D.G..HD..TF..................NDG.VPRE....GL....NR....QHV.LGRIGLLSLVRRK............V........NEFEDF.NGDWSMPE-v.....................................
A0A672Z5V8_9TELE/1309-1450             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A5F8HIE5_MONDO/1249-1379             ................................................egg----RRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........------.---------wttly.................................
A0A093IQI4_EURHL/1343-1478             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FN................------.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A455AQV6_PHYMC/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
G5B5E4_HETGA/1177-1318                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
D3ZR50_RAT/1369-1510                   ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6J3QQU3_TURTR/1430-1571             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A674MHJ0_TAKRU/1313-1454             ...............................................rpeg----GRRH..SRR.Q.LK.N.D.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.TH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A455AQV1_PHYMC/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
B9IL39_POPTR/945-1081                  .................................................gi--QTLKRP..YKK.K.GR.V.D.....NM.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............YGV..................GDY.D.WK...E......F...............A....PRLKQ.....K.TYEE......VE................NYGRLF.LTHIA..E.D...L...-...S.D..SP..NF..................SDG.VPKE....GL....RI....QDV.LIRIAVLLLIRDK............A........RFASEN.PGSLLYT--dd....................................
A0A287BG95_PIG/1370-1511               ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A446Y4F8_TRITD/296-430               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A3P8UYW4_CYNSE/1246-1387             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SH...W......L...............V....RDLRI.....K.TERE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A0E0HLU3_ORYNI/929-1063              ..............................................lagrr------GP..YSK.K.KQ.R.S.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......F...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A2Y9Q6N5_DELLE/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
CHD3_HUMAN/1376-1517                   ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
G3QEK0_GORGO/1361-1502                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6J3QQ03_TURTR/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A484GVG3_SOUCH/1365-1506             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A673B639_9TELE/1353-1490             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.NREG......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RTLT--.---------lmltevk...............................
A0A485MDE2_LYNPA/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K6SN05_SAIBB/1356-1497             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A493T8G1_ANAPP/1162-1303             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669B657_ORENI/1225-1356             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............V........R-----.---------rnll..................................
A0A3Q0F5Q5_VIGRR/1010-1145             ............................................etptpar--------..RGK.K.VR.A.E.....NP.G..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRMKH.....K.SYEE......IT................EYGILL.LSHIS..E.D...I...-...T.D..SP..TF..................TDG.VPKE....GL....RI....QDV.LVRISLLIMISDK............V........KFVSEN.PGIQLFSS-d.....................................
A0A6I8V0X0_DROPS/1390-1531             ..............................................eqngg-----ERR..GKR.R.VD.R.R.....DD.R..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-i.....................................
A0A556TZ34_BAGYA/1479-1620             ................................................erp---EGRRQ..SRR.Q.IR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.T.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
A0A2R8Q555_DANRE/1129-1270             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............aqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
A0A3Q3CXU5_HAPBU/1411-1552             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A6J3QQ08_TURTR/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A226MWH2_CALSU/1384-1525             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-m.....................................
A0A673VB92_SURSU/1342-1483             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4W6FMU8_LATCA/1376-1517             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A087Y3P7_POEFO/1413-1554             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QLV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A4W5NC09_9TELE/1210-1291             .................................................se--ANSRRP..SRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------lewa..................................
A0A392R9L6_9FABA/17-64                 ........................................sdeddnyeael--------..---.-.TD.A.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A453QY62_AEGTS/622-675               ..............................................nvsgr-----KAQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------vwfse.................................
W6UI63_ECHGR/1988-2143                 ............................................egmgsqi--------..-GR.R.VR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NI.RQRR.AFVNS..VL..R.............YGLppppssfs..magvpvasATA.S.TA...W......H...............S....RDLKG.....K.PERV......FR................AYVALF.MRHLC..E.P...E...SmnqE.N..NA..TY..................SDG.TPRD....GI....SH....QPI.LSRIGIMALVRKK............V........QEFEQI.NGLYSIPD-s.....................................
A0A665WKU7_ECHNA/1189-1330             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2R8Q3B4_DANRE/1269-1410             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............aqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
T1K2K7_TETUR/1158-1299                 ................................................kte--EKTGRR..KGR.N.EK.T.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDSF.N.SQ...W......L...............V....RDLRC.....K.SERN......FR................AYVSLF.MRHLC..E.P...G...A...D.H..LE..TF..................ADG.VPRE....GM....SR....QHV.LTRIGIMSLIRKK............V........QEFEHI.NGIQSMP--i.....................................
F7CN25_HORSE/1376-1517                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0N7KLN2_ORYSJ/16-149                .............................................lagrrg-------P..YSK.K.KQ.-.R.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......F...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A6Q2XWZ0_ESOLU/1289-1430             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........HINHSS.KD-------ipvstds...............................
A0A2K5EJN1_AOTNA/1396-1537             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4W5KNF4_9TELE/1318-1459             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3Q1BMQ4_AMPOC/1368-1509             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A669E3W9_ORENI/1232-1373             ................................................erp---EGRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A669CI53_ORENI/1367-1508             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A0R3W3H5_TAEAS/1342-1483             .........................................adlpedvlfe--------..---.-.--.-.-.....--.-..--..----..-.-...D.SK.M..T...........VF.GF...NA.HERQ.LFLES..VM..R.............YGGririclstymhsygippkGTLpP.PE...W......L...............P....FTLRS.....K.PPEK......LF................GYTNLF.MRHLY..S.D...P...K..vL.D..AEalRW..................SDG.VPTE....GV....SG....VAV.LSRIAMMALIRAK............A........IQFED-.---------ciaipknts.............................
H2YQ36_CIOSA/1285-1426                 ..............................................deefd-----NNE..NRR.K.NR.R.E.....KD.R..PL.pPMLA..R.V...G.GN.I..E...........VL.GF...SG.RQRR.TYLNF..VM..R.............YGMp...............ptEHF.Q.SR...W......L...............V....RELRV.....K.SEKE......FR................AYTSLF.MRHLC..E.P...G...S...E.N..SD..SY..................SDG.VPRE....GV....SR....QHV.LTRIGVMALIHKK............V........KEYKSI.NGDWSLPQ-l.....................................
A0A667YBV2_9TELE/1197-1338             ..............................................dedfd-----ERA..EGK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9H9L0_NEOSC/1379-1520             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
G0MXJ8_CAEBE/1274-1414                 .............................................ddddyd-------E..KRK.R.RR.D.E.....NS.E..KM.pPLMA..K.V...N.GQ.V..E...........IL.GF...NP.RQRK.AFYGA..VM..R.............WGMp...............pqDSH.Q.SQ...W......L...............V....RDLRN.....K.SEKV......FR................AYASLF.MRHLC..E.P...G...A...D.G..HD..TF..................NDG.VPRE....GL....NR....QHV.LGRIGLLSLVRRK............V........QEFEQY.NGEWSMPE-v.....................................
A0A6J3S955_TURTR/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W4DYV5_ELEEL/1163-1304             ................................................erp---EGRRQ..SRR.Q.IR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSIPE-l.....................................
A0A1S3M265_SALSA/1401-1542             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A6A6L793_HEVBR/97-190                ...................reqeqarflklfedgdgieyevrlgivicgmv--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....L.TRLS......FV................LYGVLF.LSHIT..E.D...I...-...T.D..LP..NF..................TDG.VPKE....GL....RI....QDV.LVRIAVLLLIKDK............-........------.---------egnnlpsf..............................
F7ECA7_XENTR/1228-1369                 ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEQV.NGKYSTPD-l.....................................
A0A669B1P2_ORENI/1237-1378             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A1S3M2L1_SALSA/1399-1540             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
W5MC98_LEPOC/1349-1490                 ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHI.NGKYSTPD-l.....................................
W5MC76_LEPOC/1343-1484                 ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHI.NGKYSTPD-l.....................................
M4D4A6_BRARP/475-526                   .................................................gn--QMAYWP..YNR.R.NP.-.D.....TS.E..PI..PLIE..G.E...G.RY.L..K...........VL.GF...NE.LQRK.KFIRT..LE..S.............YGI..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
L5KJ82_PTEAL/1282-1423                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A667YBQ4_9TELE/1117-1258             ..............................................dedfd-----ERA..EGK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
F1RBT2_DANRE/1392-1533                 .................................................ea--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A484DIL2_PERFV/1368-1509             ...............................................rpeg----GRRQ..SRR.Q.MK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A2K6RZL6_SAIBB/1343-1484             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A446X4S0_TRITD/19-149                ...........................................grlsilrk--------..---.-.T-.H.G.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A6I8VLD0_DROPS/1393-1534             ..............................................eqngg-----ERR..GKR.R.VD.R.R.....DD.R..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-i.....................................
A0A482XD93_LAOST/1122-1261             ...............................................gvrs------KK..KRP.E.RR.E.E.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A2P6R723_ROSCH/935-1071              ................................................nls---AGRKP..NKK.R.SR.V.D.....SA.E..PL..PLME..G.E...G.NS.F..K...........VL.GF...NQ.NQRA.AFLKN..FM..R.............FGM..................VDD.D.YK...E......F...............V....ARMKQ.....K.TYEE......IK................AYATLF.LKHII..E.P...L...-...T.D..FP..TF..................SDG.VPKE....GL....NI....TDV.LVRYSVMSMIHKK............A........KFATEN.PGAPLYED-y.....................................
A0A3B6TM49_WHEAT/996-1130              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A553QW80_9TELE/1383-1524             ................................................erp---EGRRQ..SRR.Q.LR.S.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............aqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...S...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
A0A498NJC5_LABRO/1295-1436             .................................................ea--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1P8AZP6_ARATH/945-1081              .................................................gv--QTGRRP..YRR.K.GR.-.D.....NL.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............YGA..................GNF.D.WK...E......F...............V....PRLKQ.....K.TFEE......IN................EYGILF.LKHIA..E.E...I...D...E.N..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRIALLILVQEK............V........KFVEDH.PGKPVFPS-r.....................................
A0A446X525_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A3Q3X3X3_MOLML/1257-1398             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
V4P3L5_EUTSA/897-1044                  ..................................................g-NQVAKRP..YYT.R.RT.R.D.....NS.E..PI..PLIE..G.E...G.KY.L..R...........VL.GF...SE.MQRK.TFLKT..VM..R.............YGF..................GDY.D.WK...Q......F...............V....HPLKQ.....K.TYDE......IK................DYGILF.MKHLA..E.D...D...S...E.E.tSL..TFsvkll.......tqlmisADG.VPKE....GL....KR....EDV.LVRISLLMLVEEK............S........LPLE--.---------leestfpyr.............................
A0A2Y9HAX2_NEOSC/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5F5Y6C7_FELCA/1326-1467             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A5F8GL37_MONDO/1255-1395             ................................................egg----RRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2Y9QU10_TRIMA/976-1117              ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3Q0FFY6_VIGRR/68-175                .......................................etptptrrgkki--------..---.-.-C.S.G.....IP.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------afeghnstviahga........................
A0A4Z2DRI3_SCHJA/1444-1577             ...............................................vpvm--------..-SR.R.TR.R.E.....RE.G..KM.pPLLS..R.V...N.GQ.I..E...........VL.GF...NA.RQRR.SFLNA..VM..R.............YGL..................PPS.D.QP...W......M...............V....RDLRC.....K.PDRV......FR................AYICLF.MRHLC..E.P...E...T...E.N..SD..SF..................SDG.VPRE....GL....ST....QHV.LSRIGIMTLVRKK............V........QEFEKI.NGHWSMPD-l.....................................
A0A1S3FSS6_DIPOR/1361-1502             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
H2QZP6_PANTR/1360-1501                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K5EJT1_AOTNA/1267-1408             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A087ZSL5_APIME/1374-1515             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A151N3K5_ALLMI/1262-1403             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2R8YD40_HUMAN/952-1093              ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K5WE03_MACFA/1251-1392             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A665T8L4_ECHNA/1235-1376             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2I3GMQ6_NOMLE/1368-1509             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........SVFVLC.PSSASVPE-f.....................................
A0A3Q3A414_KRYMA/1409-1550             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W5NAR0_9TELE/1215-1269             ...............................................ppls--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..Q...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................K-----.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------eaee..................................
A0A3Q3KUZ2_9TELE/1185-1326             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A446X4V7_TRITD/924-1019              ..............................................nvsgr-----KAQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................SYVTKT.LDKIT..C.N...Q...R...D.L..IC..--..................---.----....--....--....---.-------------............-........------.---------hftk..................................
A0A2Y9R5B4_TRIMA/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1V4JB80_PATFA/1346-1487             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1J7G7L8_LUPAN/942-1078              .................................................gt--TSARRP..YRK.K.AR.A.D.....SS.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKK.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SS..TF..................ADG.VPKE....GL....HI....QDV.LVRIAILLLIKDK............V........KFASEN.PRIALFSD-d.....................................
A0A2I3SKD2_PANTR/1194-1348             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSV------............-........------.---------flspkestcagvrrrrlelpvqefehingrwsmpel..
A0A2Y9EKA1_PHYMC/1379-1520             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6A4V8X1_AMPAM/1345-1484             ............................................lddsdvr--------..-KR.R.RG.E.A.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FR................AYVSLF.MRHLC..E.P...G...A...D.N..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRVGIMSLIRKK............V........QEFEAV.NGSFSVPE-l.....................................
A0A6I8RL94_XENTR/1241-1382             .................................................er--AEGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.S.TH...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSMPE-l.....................................
A0A183MLS3_9TREM/1398-1519             ............................................itwhrde--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.L..F...........IY.NF...GP.NDRQ.LFNNA..VM..R.............FGLpp..............pgIVP.P.QD...W......L...............P....PALYY.....K.SQFQ......LF................GYVCLY.MKHLY..D.D...PnglD...E.S..EE..SW..................SDG.LPKE....HL....CV....PAV.LSRIAVMALIRNK............V........LQYEDV.NGPTSIS--td....................................
A0A5C6PJD3_9TELE/1397-1550             .................................................se--ANSRRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKKasrsgyrswcreV........QEFEHV.NGQWSMP--wm....................................
A0A669E468_ORENI/1242-1383             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A091J953_EGRGA/1379-1520             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
S8CHM5_9LAMI/1-43                      ..................................................l--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................SDG.VPKE....GL....RV....DEV.LVRIGTLTLFRDK............V........NAVA--.---------icldfpmmss............................
A0A5D2YJL4_GOSMU/934-987               ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..S.............YGV..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------l.....................................
A0A1W0WSJ7_HYPDU/1461-1600             ..............................................sdlpk--------..EAK.K.GR.K.R.....DD.G..PL.pPLLS..KlA...G.GG.F..E...........VL.GF...NP.RQRK.SFGNG..VL..R.............YGIp...............seDEQ.S.WQ...W......N...............I....RDLRA.....K.SEKH......FR................AYAAMF.MRHLC..E.P...G...P...D.N..AE..AF..................SDG.VPRE....GI....SR....HHI.LSRIGITSLIKKK............V........KEFEPV.NGKHSMPE-l.....................................
A0A4W6CQI6_LATCA/1309-1450             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q7RWT7_VULVU/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A452SAQ8_URSAM/1405-1546             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0R0JI09_SOYBN/931-1067              .................................................gi--TTARRP..YKK.K.AR.T.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SA..TF..................TDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFVSQH.PQTPLFSD-d.....................................
A0A341ADZ6_NEOAA/1404-1545             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
E9PYL1_MOUSE/1390-1531                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A643CGN7_BALPH/1297-1438             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2I3TD11_PANTR/1414-1568             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSV------............-........------.---------flspkestcagvrrrrlelpvqefehingrwsmpel..
A0A453QYH6_AEGTS/924-1036              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LV-----------............-........------.---------aameq.................................
E0W1M0_PEDHC/1354-1496                 .............................................ddlnsr------RS..RRKpE.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..AF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGFYSMPE-a.....................................
A0A6A4JNE1_APOLU/1371-1512             ...............................................ddgt----MKKK..RRP.E.RR.E.E.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKH......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-i.....................................
A0A5N5Q3H9_PANHP/1387-1528             .................................................se--ANNRRP..SRK.G.LR.N.D.....KE.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2K5ETE2_AOTNA/1361-1502             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A445K5H6_GLYSO/903-1039              .................................................gi--TTARRP..YKK.K.AR.T.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SA..TF..................TDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFVSQH.PQTPLFSD-d.....................................
A0A2G5EYS2_AQUCA/933-1069              .............................................gtaagr------KPqiSKK.K.SR.V.D.....GV.E..PL..PLLE..G.E...G.KS.L..K...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WS...E......F...............T....PRLKQ.....K.TFEE......IR................EYGTLF.LSHIA..E.D...I...-...T.E..SP..SF..................SDG.VPKE....GL....RI....HDV.LVRIAVLLLFREK............V........SIMP--.---------tmqflkimc.............................
G3Q4E4_GASAC/1256-1397                 .................................................te--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A094LDR4_PODCR/1026-1167             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9KW14_ENHLU/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3N8L8_SALSA/1434-1575             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2R8QGR4_DANRE/967-1108              ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...S.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKFSTPD-r.....................................
A0A5E4PXT3_9NEOP/1380-1521             ..............................................dllsr------RS..KRRlE.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..SF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A1S4ARJ7_TOBAC/106-242               ...............................................gapv----VRRP..YRK.R.SR.V.D.....SS.V..TL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVKI..LM..R.............FGV..................GDY.D.WA...E......F...............T....PRLKQ.....K.TYEE......IR................DYGNLF.LSHIA..E.D...I...-...T.E..SP..TF..................TDG.VPKE....GL....RI....QDV.LLRIAVLLLIRDK............V........KASSEE.TNGPLFA--kd....................................
A0A341AGZ4_NEOAA/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A286ZUW6_PIG/1203-1344               ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
F1N3F6_BOVIN/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3P8WS67_CYNSE/1268-1409             ...............................................rpeg----GRRQ..SRR.Q.LK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFVNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A1D6NTP9_MAIZE/744-879               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A673Y5N5_SALTR/1232-1373             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A096M4P9_POEFO/1334-1475             .................................................ev--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1J1IA10_9DIPT/1337-1478             ...............................................deia----ARSR..NRA.R.AR.Q.E.....RE.R..PL.pPLLA..K.V...A.GN.I..E...........VL.GF...NA.RQRK.SFLNS..IM..R.............YGMp...............pqDCF.S.GQ...W......L...............V....RDLRA.....K.SERQ......FK................AYVALF.MRHLC..E.P...G...A...D.N..SD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEKV.NGCYSMPE-i.....................................
A0A6A6KGH1_HEVBR/867-1003              ..................................................g-TQTGRKP..YRK.K.AR.V.D.....NM.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEY.D.WK...E......F...............A....SRMKQ.....K.TYEE......IR................DYAVLF.LSHIT..E.D...I...-...T.D..SP..NF..................SDG.VPKE....GL....RI....LDV.LVRIAILLLIRDK............V........KFALEK.PGTPLFTD-d.....................................
A0A3B6REL7_WHEAT/901-1035              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A2K5YLH4_MANLE/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4U5V432_COLLU/1431-1572             .................................................er--TNARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
B3M8T6_DROAN/1367-1508                 ...............................................dqng----GERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A5N6P2F4_9ASTR/924-1060              ...............................................ggap----SRKP..YRK.K.TR.V.D.....NA.E..LL..PLME..G.E...G.RA.F..R...........VL.GF...NQ.SQRA.QFVQI..LM..R.............FGV..................GDF.D.WA...E......F...............T....SRLKQ.....K.SYEE......IK................VYGTLF.LSHIS..E.D...I...-...T.D..AA..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLLLVRDK............V........KNPSEN.QSAPLFTD-d.....................................
A0A1S3Q070_SALSA/1398-1539             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A665WJ77_ECHNA/1161-1302             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A183EHB6_9BILA/1-90                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..-M..R.............WGMp...............pqDTY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGVMSLIRKK............V........QVGDA-.---------krddega...............................
M4AJS6_XIPMA/1305-1446                 ...............................................rpeg----GRRQ..SRR.Q.LK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A5D2YJL4_GOSMU/981-1045              ..................................................l--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......-M................SYGVLF.LSHIS..E.D...I...-...T.E..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLISNK............V........KTASEH.PGTRLVTD-d.....................................
A0A397Y2S8_BRACM/618-754               ..................................................g-NQTGRRP..YRR.K.GR.-.D.....NS.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............FGV..................GNY.D.WK...E......F...............V....PRLKQ.....K.TYDE......IK................EYGVLF.LKHIA..E.D...I...D...E.N..SS..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLMLVQEK............V........KLVEDH.PGKPVFPN-r.....................................
A0A1S3M325_SALSA/1391-1532             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A672HGK5_SALFA/1335-1476             ................................................ert---EGERA..GGR.W.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A096P2S7_PAPAN/1194-1325             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6A3AFH6_HIBSY/897-1033              ..................................................e-TESGKRT..YKK.R.NR.A.D.....ST.E..PI..PLME..G.E...G.KS.F..M...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SSLKQ.....K.SYEE......IK................DYGVLF.LSHLA..E.G...V...-...N.D..SP..TF..................SDG.IPKE....GL....RI....PDV.LVRIAILLSISDK............V........KKVSER.PGTPLFTN-d.....................................
CHD3_CAEEL/1279-1419                   .............................................qtdedy-------E..ERR.R.RR.E.E.....RS.E..KL.pPLLA..K.V...N.GQ.I..E...........VL.GF...NP.RQRK.AFYNA..VM..R.............WGMp...............pqDLT.Q.SS...W......Q...............V....RDLRN.....K.SEKV......FK................AYSSLF.MRHLC..E.P...V...V...D.N..SD..SF..................MDG.VPRE....GL....NR....QAV.LSRIGLMSILRKK............V........QEFEKF.NGEWSMPE-t.....................................
A0A663FFK3_AQUCH/1353-1494             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0V0WJU3_9BILA/1427-1567             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A6A5LC16_LUPAL/1008-1144             ................................................gtv---SARRP..HKR.K.AH.A.N.....SS.E..PL..PLME..G.E...G.RS.L..R...........VL.GF...NQ.NHRA.AFAQI..LM..R.............FGV..................GDY.D.WK...D......F...............T....SRMKQ.....K.SFEE......IR................DYGTLF.LSHIA..D.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....PDL.LVRIAVLILIRDK............V........KFASEN.PGTPLFSD-d.....................................
A0A4C1XSD1_EUMVA/1191-1332             ..............................................dllsr------RS..KRRiE.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
W5Q8X2_SHEEP/1336-1477                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A671XAC7_SPAAU/1318-1459             ...............................................rpeg----GRRH..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A667YD83_9TELE/1128-1269             .................................................ae--ANARRP..NRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A0D2UIB0_GOSRA/822-958               .................................................vn--QPGRKP..YRK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SHDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSKK............V........KDASEK.PGTRLFTD-d.....................................
A0A5N6MAN6_9ASTR/946-1081              ................................................lap----ARKP..YRK.K.TR.V.D.....NA.E..LL..PLME..G.E...G.RA.F..R...........VL.GF...NQ.SQRA.QFVQI..LM..R.............FGV..................GDF.D.WA...E......F...............T....SRLKQ.....K.SYEE......IK................VYGTLF.LSHIS..E.D...I...-...T.D..AA..TF..................LDG.IPKE....GL....RI....EDV.LVRIAVLLLVRDK............V........KHSPEN.PSAPLFTD-d.....................................
A0A452GSF4_9SAUR/1270-1411             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTAD-l.....................................
A8X9E2_CAEBR/1276-1416                 .............................................ddddyd-------E..KRK.K.RR.D.E.....NN.E..KM.pPLMA..K.V...N.GQ.V..E...........IL.GF...NP.RQRK.AFYGA..VM..R.............WGMp...............pqDSH.Q.SQ...W......L...............V....RDLRN.....K.SEKV......FR................AYASLF.MRHLC..E.P...G...A...D.G..HD..TF..................NDG.VPRE....GL....NR....QHV.LGRIGLLSLVRRK............V........NEFEDF.NGAWSMPE-v.....................................
A0A5F4CH71_CANLF/1408-1549             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
F7B896_HORSE/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A671WLT6_SPAAU/1267-1407             .............................................derteg-------K..DQK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A060W4R3_ONCMY/109-250               ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2Y9RUG7_TRIMA/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6J3QCG7_TURTR/1446-1587             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W6CQN6_LATCA/1256-1397             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A446Y4V0_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A1U7WBS2_NICSY/930-1066              ...............................................gapv----VRRP..YRK.R.SR.V.D.....SS.V..TL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVKI..LM..R.............FGV..................GDY.D.WA...E......F...............T....PRLKQ.....K.TYEE......IR................DYGNLF.LSHIA..E.D...I...-...T.E..SP..TF..................TDG.VPKE....GL....RI....QDV.LLRIAVLLLIRDK............V........KASSEE.TNGPLFA--kd....................................
A0A485MFY0_LYNPA/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669FA21_ORENI/1250-1385             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............V........R-----.---------rnllpfld..............................
A0A1D6NTQ3_MAIZE/923-1059              ............................................sgkrgqy-------S..KRK.S.LS.L.G.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A2R6QMP8_ACTCC/797-886               ................................................gip---AGRRP..YKK.K.AR.V.N.....SA.E..PI..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRT.AFVQI..LM..R.............FGV..................GEY.D.WA...E......F...............A....PRLKQ.....K.TYEE......IK................EYSGRM.F----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------rltahgiys.............................
A0A4Y7L5G1_PAPSO/944-1082              ..............................................gtaag-----KRP.qSKK.K.AR.A.D.....TS.G..PI..PLME..G.E...G.NS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDY.D.WV...E......F...............A....PRLKQ.....K.AYEE......IK................EYGTLF.LSHIT..E.E...I...-...N.D..AP..CFsdlgl........ssgfaTDG.VPKE....GL....RI....QDV.LVRMAVLMLIKEK............A........SN----.---------ylve..................................
A0A6J3S7V4_TURTR/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
K7HE51_CAEJA/474-614                   .............................................dddeyd-------E..KKK.R.RR.D.E.....SS.E..KM.pPLMA..K.V...N.GQ.I..E...........IL.GF...NT.RQRK.AFYGA..IM..R.............WGMp...............pqDAH.H.SL...W......L...............V....RDLRS.....K.SEKV......FR................AYASLF.MRHLC..E.P...G...A...D.G..ND..TF..................NDG.VPRE....GL....NR....QLV.LSRIGWLSLLRRK............V........QEFEAF.NGDWSMPE-v.....................................
A0A6G0HTX9_LARCR/1379-1520             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1S3GID8_DIPOR/1348-1489             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2T7E233_9POAL/915-1051              ..............................................gnvsg-----RRG..QYS.K.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.LFLQT..LN..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVDE......IQ................RYAELV.MAHLV..E.D...I...-...N.D..SD..YF..................SDG.VPKE....GM....RV....DDV.LVRIANISLIEEK............V........AAMGQG.KNTNLFPN-y.....................................
A0A674F835_SALTR/1313-1452             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........HIN---.---------qslkltnlsh............................
A0A446X4Y0_TRITD/786-920               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A2K5NKG5_CERAT/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A251RA87_PRUPE/933-1069              ................................................gtl---SGRKP..NKK.R.SR.V.D.....SA.E..PP..PLME..G.E...G.RS.F..K...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GEY.D.WK...E......F...............T....PRMKQ.....K.TFEE......IE................NYGRLF.LAHIA..E.E...M...-...T.D..SP..TF..................SDG.VPKE....GL....RI....GDV.LCRIAVLMQMQQR............V........DLASKN.PGTPLFSE-d.....................................
A0A2Y9QXQ9_TRIMA/1204-1345             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A668ADF6_9TELE/1185-1326             ..............................................edfde-----RTE..GKR.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
M7BFC6_CHEMY/1319-1460                 .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S2ZP45_ERIEU/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1V4L0I2_PATFA/1-93                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..-M..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A6A5DY14_PERFL/1415-1556             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3Q0H7X5_ALLSI/1373-1514             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A672TWM2_STRHB/1373-1514             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A674F7H3_SALTR/1324-1465             ...............................................eggc----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A0L7LG87_9NEOP/1296-1437             ..............................................dllsr------RS..KRRlE.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A091T9J5_PHALP/1290-1431             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K5S0D5_CEBCA/1435-1576             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A0V1PN99_9BILA/1433-1541             .............................................sdgtrf--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...QR.STTS.RFLQC..YY..A.............MGNa................tGGF.A.-F...R......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A3Q3GY62_9LABR/1313-1453             ................................................sly----SRRQ..SRR.Q.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2P5VND8_GOSBA/720-856               .................................................vn--QPGRKP..YRK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SHDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSKK............V........KDASEK.PGTRLFTD-d.....................................
A0A0R3X7V2_HYDTA/602-726               ............................................sedvrfe--------..---.-.--.-.-.....--.-..--..----..-.-...D.SK.M..T...........VF.GF...NA.HERQ.LFLES..VM..R.............YGIp...............pkGALpP.PE...W......L...............P....FTLRS.....K.PPEE......LF................GYTNLF.MRHLY..S.D...P...K..vL.D..AEalRW..................SDG.VPTE....GV....SG....VAV.LSRIAMMALIRAK............A........IQFEDC.NAI------pkrfsq................................
A0A060WIN9_ONCMY/1320-1461             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A668ARY6_9TELE/1199-1340             ..............................................edfde-----RTE..GKR.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A498J6V8_MALDO/908-1055              ...............................................sggk-----RLP..NRK.R.SR.V.E.....SM.E..PP..PLME..G.E...G.RS.F..K...........VL.GF...NQ.SQRA.MFVQV..LM..RgfflvirfsgmcrFGV..................GDY.D.WK...E......F...............T....ARMK-.....K.TFEE......VD................RYAKLF.LEHIA..E.G...D...-...N.D..SP..TF..................ADG.VPKD....GL....RI....GDV.LIRVATLMLVKKR............V........EAALRN.PGAPLFSQ-d.....................................
I3JS40_ORENI/1232-1373                 ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A5A9NDD3_9TELE/1280-1421             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKFSTPD-l.....................................
A0A3M7T7T2_BRAPC/136-280               ...............................................skes----QERA..RRK.RlTA.G.G.....KE.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRR.AYLNG..IM..R.............FGMp...............phDVF.N.SQ...W......M...............S....RDLRG.....K.TDKE......FK................AYTAMF.MRHLC..E.P...C...V...D.NqqQQ..TF..................ADG.VPRE....GM....SR....QQV.LTRMAVMSLIRKK............V........QEYEQV.NGMWSMPE-l.....................................
A0A452SB72_URSAM/1328-1469             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K5NU12_CERAT/1368-1509             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3P9D1R1_9CICH/1411-1552             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLKG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLLKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A665XBV3_ECHNA/1273-1414             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A1U8AIG1_NELNU/934-1070              ................................................gag---SGKRP..QKK.K.SR.V.D.....SS.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............YGV..................GEF.D.WR...E......F...............T....PRLKQ.....K.SFEE......IK................EYGTLF.LSHIS..E.D...I...-...T.E..SP..CF..................SDG.VPKE....GL....RI....GDV.LVRIAVLLLIRDK............V........KIMAEM.PGTSLFAE-d.....................................
A0A118JZU8_CYNCS/1050-1185             ................................................iap----VRKP..HRK.K.TR.V.D.....NA.E..LL..PLME..G.E...G.RA.F..R...........VL.GF...NQ.SQRA.QFVQI..LM..R.............FGV..................GDF.D.WA...E......F...............T....SRLKQ.....K.SYEE......IK................VYGTLF.LSHIS..E.D...I...-...T.D..AS..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLLLVRDK............V........KCSSEN.PSAPLFSD-d.....................................
H2T2L5_TAKRU/1339-1480                 ...............................................rpeg----GRRH..SRR.Q.LK.N.D.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.TH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A199UP16_ANACO/934-1067              ...........................................pgkrgqfs--------..-KK.K.GR.-.-.....GY.V..ES..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.LFVQI..LM..R.............FGF..................QDY.E.WK...E......F...............L....PRLKG.....K.TARE......IK................EYAALF.MTHLL..E.G...I...-...N.D..SA..NF..................LDG.VPKE....GL....RV....DDV.LVRLANINLIEEK............V........QYMSEN.PGAKLFPE-n.....................................
A0A4W4DX74_ELEEL/1155-1296             ................................................erp---EGRRQ..SRR.Q.IR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSIPE-l.....................................
A0A674C0S0_SALTR/1154-1295             ................................................dqg---SSRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
H3BZS0_TETNG/1308-1422                 ....................................llclegnphmyglfc--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.HRQK.IFWNN..YM..E.............ISS..................DLN.G.FS...W......C...............I....VGLVS.....D.ITLS......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSLP--wm....................................
A0A6A5NQ35_LUPAL/924-1060              ................................................gtv---STRRS..HKR.K.VH.A.I.....ST.E..PL..PLME..G.E...G.RS.L..K...........IL.GF...NQ.HQRA.TFVQI..LM..R.............FGV..................GDY.D.WK...D......F...............V....PRIKQ.....K.SVEE......IR................EYGMLF.LSHIA..E.Q...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....RDL.LVRIAILIMIGDK............V........KFALEN.PGTQLFSD-a.....................................
A0A2Y9NGE4_DELLE/1367-1508             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2I0TFR8_LIMLA/891-976               ....................................datddtelqnmneyl--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....S.SFKV......AQ................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A673TNU9_SURSU/1371-1512             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3Q0FJ20_VIGRR/43-141                .......................................csrdgtstkagi--------..---.-.--.-.-.....-P.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdist.............................
A0A3P4M9W2_GULGU/314-455               ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VX.XF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
H9G906_ANOCA/1427-1568                 ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A452CME2_BALAS/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4W6FME5_LATCA/1214-1355             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A446X505_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
M8A2Q7_TRIUA/910-1050                  .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LMrlR.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............F........T-----.---------sqvaameqgkitklfpny....................
A0A446Y4H4_TRITD/939-1073              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A4W3HK67_CALMI/934-1074              ..................................................k-SEAGRRN..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..FM..R.............WGMp...............pqDSF.S.SH...W......L...............V....RDLRG.....K.SQKE......FR................AYVSLF.MRHLC..E.P...G...-...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEYI.NGRYSIPE-l.....................................
G0PHA3_CAEBE/1290-1430                 .............................................ddddyd-------E..KRK.R.RR.D.E.....NS.E..KM.pPLMA..K.V...N.GQ.V..E...........IL.GF...NP.RQRK.AFYGA..VM..R.............WGMp...............pqDSH.Q.SQ...W......L...............V....RDLRN.....K.SEKV......FR................AYASLF.MRHLC..E.P...G...A...D.G..HD..TF..................NDG.VPRE....GL....NR....QHV.LGRIGLLSLVRRK............V........QEFEQY.NGEWSMPE-v.....................................
A0A3Q7YF37_CICAR/756-893               .................................................et--AASRRP..CKK.K.AR.SaD.....NT.D..PL..PLME..G.E...G.KS.L..R...........VL.GF...SR.SQRA.AFLQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SHIKQ.....K.TYEE......IK................EYGTLF.LSHIA..E.D...I...-...N.D..SS..SF..................SDG.VPKE....GL....QI....QDV.LIRIAVLLLIREK............V........KFASEN.PGTPLFSD-d.....................................
D2VX38_NAEGR/790-928                   ..............................sirlriysrqmknsniriisp--------..---.-.--.-.-.....--.-..--..----..-.-...-.TN.V..L...........VK.GF...TR.KERL.VFYQT..IL..R.............YGLgi.............gstQDG.K.WQ...Q......F...............YsiinPKLRG.....K.SIQE......IK................EFGAFI.LDHLS..E.Q...V...D...Q.N..YS..HY..................SDG.TPTD....SI....NG....TKI.LQRIGSMFLVHSI............V........EKYSQF.PIETN----fdi...................................
A0A1S3FRU2_DIPOR/1354-1495             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3Q7IH67_SOLLC/934-1069              ...............................................apvl-----RKA..HRK.K.AR.V.D.....SA.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGA..................GEF.D.WA...D......F...............T....PRLKQ.....K.TYEE......IQ................DYGALF.LSHIS..E.E...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....PDV.LVRIAVLLLIRDK............V........KAFSEM.TGGSLFAD-d.....................................
A0A2Y9QA97_DELLE/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9HAX9_NEOSC/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A0M3J2A5_ANISI/1-58                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.MRHLC..E.P...G...A...D.T..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFESS.NGDWSIPE-v.....................................
A0A087QS52_APTFO/1286-1427             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A5C6N9H5_9TELE/1410-1551             ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDTF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
F4W7E5_ACREC/1257-1404                 ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...WqvngvlL...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A4Z2FKI9_9TELE/1-93                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..-M..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A3Q0JKG3_DIACI/7-94                  ..........................................yylvlvesi--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...L......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..NF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-v.....................................
A0A0R3UC02_9CEST/30-170                ..............................................gsmig--------..--R.R.VR.R.E.....RE.G..KM.pALLS..R.V...N.GQ.I..E...........VL.GF...NI.RQRR.AFVNS..VM..R.............YGLpp.............adqNAY.V.SA...W......H...............S....RDLKG.....K.PEKV......FR................AYISLF.MRHLC..E.P...D...S...M.NqeTT..TY..................SDG.TPRD....GI....AH....QPI.LSRIGIMALVRKK............V........QEFEQI.NGLYSIPS-l.....................................
A0A553QW79_9TELE/1383-1524             ................................................erp---EGRRQ..SRR.Q.LR.S.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............aqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...S...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
A0A2K5XUQ2_MANLE/1366-1507             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K5YLF9_MANLE/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2K5EJS5_AOTNA/1394-1535             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A068XYH7_ECHMU/1319-1448             .......................................dlladlpedvrf--------..---.-.--.-.-.....--.-..--..----..-.E...D.NK.M..T...........VF.GF...NA.HERQ.LFLES..VM..R.............YGIp...............pkGTLpP.PE...W......L...............P....FTLRS.....K.PPEE......LF................GYTNLF.MRHLY..S.D...P...K..vL.D..AEalRW..................SDG.VPTE....GV....SG....VAV.LSRIAMMALIRAK............A........VQFEDC.---------vavpkkfr..............................
A0A0L8HBI6_OCTBM/1235-1377             ................................................edk---QESRS..NRK.RsGV.S.D.....RD.K..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKV......FR................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGTHSMPY-m.....................................
M4ANR0_XIPMA/1177-1318                 ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QLV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A3Q1K1U8_ANATE/1374-1443             .................................................se--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGM..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------ppktpsphsgwfetce......................
A0A3B6SA08_WHEAT/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A3M0IT33_HIRRU/1378-1519             ..................................................e-GQSGRRQ..SRR.Q.LK.T.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3Q0FKE9_VIGRR/33-124                .............................................qqagip--------..---.-.--.-.-.....--.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdist.............................
A0A4W5P039_9TELE/1393-1534             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q1BVY5_AMPOC/1189-1330             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A5F5PNH1_HORSE/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A093GC00_DRYPU/1380-1521             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A401T2T8_CHIPU/1268-1359             .................................................kp--EAGRRQ..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFVNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------ystpemvpehpenk........................
H0WMB8_OTOGA/1345-1486                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
K7B9Z5_PANTR/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2R8Y212_HUMAN/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
D8SK03_SELML/912-1047                  .................................................iq---SVEEK..TKK.Q.KG.E.S.....SV.H..PA..PLME..G.D...G.KS.L..K...........VL.GF...RR.KHRV.RFVQI..LM..R.............FGL..................GDF.T.WS...S......F...............V....PYFKQ.....K.QLHE......IK................EYGTLF.LTHIA..E.D...V...-...T.D..SD..TF..................ADG.VPKE....GL....RI....QDV.LVRVAVLHLITNK............V........KQYTQN.PKARLFS--ya....................................
A0A5F4WIJ8_CALJA/1373-1513             .......................................pegqkgvrnlwl--------..---.-.-K.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2I3SB75_PANTR/1389-1530             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2K6G6D9_PROCO/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W6FMJ1_LATCA/1376-1517             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A383Z5R8_BALAS/1408-1549             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K6P1M2_RHIRO/1209-1364             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A1U8BHZ4_MESAU/1406-1547             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A5J9TN31_9POAL/918-1053              ............................................sisgrrg-------Q..YSK.-.RK.S.R.....NV.D..LI..PLME..G.E...G.RS.L..R...........IL.GF...NQ.AQRA.LFLQT..LN..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MVHLV..D.E...S...-...N.D..PD..HF..................SDG.VPRE....GL....RT....DET.LVRIANISLIEAK............V........AAMEQG.KITTLIPN-y.....................................
W5PC02_SHEEP/1349-1490                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6Q2Y4I6_ESOLU/1258-1398             .................................................pg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RA----.---------qggsqrpemyilmd........................
A0A667ZJA6_9TELE/1257-1398             ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A672V4K5_STRHB/1408-1549             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6Q2X3Y5_ESOLU/1243-1384             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A498HNI5_MALDO/907-1042              ..............................................asggk-----RPP..NRK.R.SR.V.E.....ST.E..PP..PLME..G.E...G.RS.F..K...........VL.GF...NQ.SQRA.LFVQI..MM..R.............FGV..................GDY.D.WK...E......F...............T....ARMK-.....K.TFEE......ID................RYAKLF.LEHIA..E.G...D...-...N.D..SP..TF..................TDG.VPKD....GL....RI....GDV.LVRLATLMLVKKR............V........EAALRN.PGAPLFSE-d.....................................
A0A663FDZ7_AQUCH/1189-1330             .................................................er--SEARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2Y9NGD8_DELLE/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A402FAG6_9SAUR/1383-1522             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........GDTQ--.---------pntpvpvpp.............................
A0A3P7DBX0_WUCBA/791-931               ...............................................efds-----TQQ..GKK.R.HR.D.R.....GD.E..KL.pPLLA..R.V...N.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDTY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEVS.NGEWSMPE-i.....................................
A0A5N5PJA5_PANHP/1423-1564             ................................................erp---EGRRQ..SRR.Q.IR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
A0A0V1BDZ8_TRISP/1507-1588             ...............................................iafr--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
A0A6J3QPZ8_TURTR/1428-1569             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3B6S959_WHEAT/803-937               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A453QYJ6_AEGTS/649-783               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A4D9DVR1_9SAUR/1318-1459             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3PYT8_SALSA/1394-1535             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2R8YE38_HUMAN/131-272               ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5N4C8B8_CAMDR/1421-1578             ...............................................gegs----PRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FKswhdcclttslplyyrAYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A453QYA0_AEGTS/924-1022              ..............................................nvsgr-----KAQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................A--.----....--....--....---.-------------............-........------.---------gicrl.................................
A0A6J3QQP8_TURTR/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A287A0J5_PIG/1369-1510               ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A1S3Q076_SALSA/1393-1534             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2P5FN57_TREOI/949-1021              .........................................ppkdlkqvkv--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................HYGTLF.LTHIT..E.E...I...-...T.D..SP..TF..................SDG.VPKD....GL....RI....QDV.LVRIAVLMLVREK............V........MSALEN.SGAPLFAE-d.....................................
A0A2Y9EL30_PHYMC/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6I8RXQ4_XENTR/1346-1487             .................................................rs--EAARRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
G1QWK1_NOMLE/1435-1576                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWK----enkk..................................
A0A2Y9E125_TRIMA/1251-1392             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNS..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A446Y4P1_TRITD/1010-1080             .............................................qrdlic--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.---H......FT................KYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
L9KQZ1_TUPCH/1171-1312                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A093ET06_GAVST/1341-1482             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
H0WSN5_OTOGA/1387-1528                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A674C0V6_SALTR/1249-1390             ................................................dqg---SSRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A453QY61_AEGTS/164-298               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
H2YQ30_CIOSA/1312-1453                 ..............................................deefd-----NNE..NRR.K.NR.R.E.....KD.R..PL.pPMLA..R.V...G.GN.I..E...........VL.GF...SG.RQRR.TYLNF..VM..R.............YGMp...............ptEHF.Q.SR...W......L...............V....RELRV.....K.SEKE......FR................AYTSLF.MRHLC..E.P...G...S...E.N..SD..SY..................SDG.VPRE....GV....SR....QHV.LTRIGVMALIHKK............V........KEYKSI.NGDWSLPQ-l.....................................
A0A667YTS7_9TELE/1328-1469             .................................................ae--ANARRP..NRK.G.LR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A553R267_9TELE/1347-1488             .................................................ae--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...S.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SERE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..SF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSLP--wm....................................
A0A665VEQ2_ECHNA/1302-1443             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A663FDH6_AQUCH/1353-1494             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3SDD7_SALSA/1433-1574             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2Y9EIY9_PHYMC/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A671VP57_SPAAU/1185-1326             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A672HE88_SALFA/1370-1511             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2R9B2T3_PANPA/1362-1503             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9SYN4_PHYMC/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A453QYV7_AEGTS/637-771               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A2P5FN57_TREOI/864-947               ................................................gta---SLRKT..NRK.K.SR.V.D.....SS.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...D......F...............T....ARMKQ.....K.TYEE......IK................D-----.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------vdevlsdtl.............................
I3MA51_ICTTR/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
G3S4I2_GORGO/1387-1528                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
F7E3M0_XENTR/1246-1387                 ................................................kpe---GGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SN...W......L...............V....RDLRG.....K.TEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEQV.NGKYSTPD-l.....................................
A0A452SHR0_URSAM/1309-1450             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2H3YJE7_PHODC/940-1075              ...............................................nmpg-----RRG..QLS.K.KK.S.Q.....YM.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQT..LM..R.............FGF..................QDY.N.WK...E......F...............L....PRLKG.....K.SPQE......LQ................DYAQLF.MNHLL..E.G...V...-...T.D..SP..TF..................SDG.VPKE....GL....RV....DDV.MVRLARIQNIEEK............V........KFMSEN.PGAGLFSE-d.....................................
A0A0V1PNF3_9BILA/1380-1520             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDCY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
H3AHH7_LATCH/1418-1556                 .................................................eg--KAAGRK..NKN.R.TN.Q.P.....KT.K..PL.pPLSL..S.L...S.--.-..Q...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
A0A446Y4L3_TRITD/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A2P4T1Y9_BAMTH/956-1096              ................................................tvg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-m.....................................
A0A2K5ZQK8_MANLE/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9RRS8_TRIMA/1379-1520             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3Q0KLA5_SCHMA/1437-1558             ............................................itwhrde--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.L..F...........IY.NF...GP.NDRQ.LFNNA..VM..R.............FGLpp..............pgIVP.P.QD...W......L...............P....PALYY.....K.SQFH......LF................GYVCLY.MKHLY..D.D...P...NrldE.S..EE..SW..................SDG.LPKE....HL....CV....PAV.LSRIAVMALIRNK............V........LQYEDV.NGPTSIS--td....................................
A0A673Y9N0_SALTR/1130-1271             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6J3QCK3_TURTR/1446-1587             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A341ADT5_NEOAA/1398-1539             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A669CQK8_ORENI/1232-1373             ................................................erp---EGRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
G7J9W2_MEDTR/932-1069                  .................................................gt--TTTRRP..YKK.K.AR.TaD.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SS..TF..................TDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........RFASEH.PQTPLFSD-d.....................................
A0A673U4V6_SURSU/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
G3TQH4_LOXAF/1363-1504                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K6MJ23_RHIBE/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A059BBD2_EUCGR/932-1068              .................................................gi--QTGRRP..YRK.R.SR.V.D.....ST.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....PRLKQ.....K.TYEE......IK................EYGRLF.LSHIA..E.E...I...-...T.D..LP..TF..................ADG.VPKE....GL....RI....QDV.LVRIAQLMLVKEK............V........LSASEN.VGAPLFPE-e.....................................
A0A674F7A2_SALTR/1305-1446             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4W6EIQ8_LATCA/1283-1424             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A0V1N729_9BILA/1360-1500             ............................................dekvegv--------..PRR.R.RR.E.G.....KD.E..KL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NV.RQRR.AFYNA..IM..R.............WGMp...............paDAY.N.SQ...W......L...............V....RDLKG.....K.SEKA......FK................AYVSLF.FRHLC..E.P...G...N...E.A..ND..AY..................SDG.VPRE....GV....SR....QHV.LTRIGIMSLLRKK............V........QEFEII.NGPYSTP--la....................................
H2UMY3_TAKRU/1410-1551                 ................................................drp---EGRRQ..SRR.Q.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDTF.A.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A060VNP1_ONCMY/1388-1529             ...............................................eggc----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A0R3SUW1_HYMDI/1430-1576             .............................................adgsqi--------..-GR.R.LR.R.E.....RE.G..KM.pPILS..R.V...N.GQ.I..E...........VL.GF...NF.RQRK.AFVNS..VL..R.............FGLpppp..........gaskTGL.G.AA...W......H...............S....RDLRG.....K.PEKV......FR................AYVAHF.LRHLC..E.P...DsmnQ...D.N..NP..NY..................PDG.TPRD....GI....LH....QPI.LTRIGIMSLVRKK............V........QEFEQV.NGLYSMPE-h.....................................
A0A3Q2WYX4_HAPBU/1278-1419             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W4EKE9_ELEEL/1291-1432             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A183K443_9TREM/1-78                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......M...............V....RDLRC.....K.PDRV......FR................AYICLF.MRHLC..E.P...E...T...E.N..SD..SF..................SDG.VPRE....GL....ST....QHV.LSRIGIMVLVRKK............V........QEFEKI.NGHWSMPD-l.....................................
A0A2Y9Q060_DELLE/1374-1515             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A665VGI5_ECHNA/1201-1342             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A397YDC2_BRACM/900-1036              ..................................................g-NQTGRRP..YRR.K.GR.-.D.....NS.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............FGV..................GNY.D.WK...E......F...............V....PRLKQ.....K.TYDE......IK................EYGVLF.LKHIA..E.D...I...D...E.N..SS..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLMLVQEK............V........KLVEDH.PGKPVFPN-r.....................................
A0A383Z599_BALAS/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
H2YQ33_CIOSA/1279-1420                 ..............................................snlrg-----KLK..NRR.K.NR.R.E.....KD.R..PL.pPMLA..R.V...G.GN.I..E...........VL.GF...SG.RQRR.TYLNF..VM..R.............YGMp...............ptEHF.Q.SR...W......L...............V....RELRV.....K.SEKE......FR................AYTSLF.MRHLC..E.P...G...S...E.N..SD..SY..................SDG.VPRE....GV....SR....QHV.LTRIGVMALIHKK............V........KEYKSI.NGDWSLPQ-l.....................................
W4Z592_STRPU/1432-1572                 .............................................ddkndn-----IRR..SRR.A.DR.-.D.....RE.K..LP..PLLA..R.V...G.GQ.I..E...........VL.GF...SA.RQRK.AFLNA..IM..R.............WGMp...............pqDPY.N.SQ...W......L...............V....RDLRG.....K.PERH......FR................AYVSLF.MRHLC..E.P...G...S...D.G..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........LEFEPI.NGSVSLPE-l.....................................
A0A2P5WA70_GOSBA/805-881               ............................................efilvcf--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....K.LFTS......ID................RYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSEK............V........KDASEK.PGTRLFTD-d.....................................
A0A3Q0JJ82_DIACI/1-93                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..-M..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..NF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-v.....................................
A0A2Y9H478_NEOSC/1408-1549             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K5KMM4_CERAT/1360-1501             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
F6Q5E6_HORSE/1388-1529                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
W9QJP0_9ROSA/1984-2120                 ...............................................gnap----IRKA..GRK.K.SR.V.D.....ST.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEF.D.WQ...E......F...............T....SRMKQ.....K.TYDE......IK................DYGMLF.LSHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLMLIREK............V........KFASDY.PGVQLFAD-d.....................................
A0A2K5UJW0_MACFA/83-214                ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....S-....---.-----LMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A341AG30_NEOAA/1405-1546             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A671EPI7_RHIFE/1386-1527             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A067KBL4_JATCU/933-1069              .................................................gt--QPGRKP..YRR.R.SR.V.D.....NM.E..PI..PLME..G.E...G.RA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GEY.D.WK...E......F...............A....PRMKQ.....K.TYEE......IR................DYGVLF.LSHIV..E.D...I...-...T.D..SP..NF..................ADG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFASEK.PGTSLFTD-d.....................................
A0A3Q0FFZ2_VIGRR/47-148                .......................................etptptrrgkki--------..---.-.-C.S.G.....IP.E..PL..PLME..G.Q...G.KS.L..K...........VL.GF...SQ.NQRA.DFLQI..LM..R.............FGV..................GDY.D.WK...Q......F...............A....PRIKH.....K.SYEE......IT................EYGKLL.LSHIA..E.D...I...-...T.D..SP..TF..................T--.----....--....--....---.-------------............-........------.---------glepmdis..............................
G1TM73_RABIT/1343-1484                 ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A183NE85_9TREM/1-78                  ...................................................--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......M...............V....RDLRC.....K.PDRV......FR................AYICLF.MRHLC..E.P...E...T...E.N..SD..SF..................SDG.VPRE....GL....ST....QHV.LSRIGIMVLVRKK............V........QEFEKI.NGHWSMPN-l.....................................
A0A2G5EYX5_AQUCA/933-1070              .............................................gtaagr------KPqiSKK.K.SR.V.D.....GV.E..PL..PLLE..G.E...G.KS.L..K...........VL.GF...SQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WS...E......F...............T....PRLKQ.....K.TFEE......IR................EYGTLF.LSHIA..E.D...I...-...T.E..SP..SF..................SDG.VPKE....GL....RI....HDV.LVRIAVLLLFREK............K........------.---------lqsvkpgtllfded........................
A0A2Y9R054_TRIMA/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A6J3QQQ3_TURTR/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A674MQU9_TAKRU/1389-1530             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4X2MDW2_VOMUR/1353-1494             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGRYSTPD-l.....................................
A0A4W3I3I4_CALMI/905-1039              ..................................................k-SEAGRRN..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..FM..R.............WGMp...............pqDSF.S.SH...W......L...............V....RDLRG.....K.SQKE......FR................AYVSLF.MRHLC..E.P...G...-...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........SK----.---------nrvgsal...............................
A0A2K5WDX2_MACFA/1377-1518             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A670J3Q4_PODMU/1292-1433             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEPV.NGKYSTPD-l.....................................
A0A132A2D7_SARSC/384-528               .............................................legrgn------QK..SSR.N.KV.V.V.....KE.K..MP..PLISvpG.T...T.TT.T..E...........IL.GF...TP.KQRK.IFLDL..VM..R.............FGLpn.............ldyNLT.E.SQ...Y......F...............V....RELKN.....K.SEKN......LR................AYTSLF.ITHLC..E.P...G...D...P.S..LL..TF..................EDG.VPKE....GL....NK....DQV.LSRIGIISLIKRK............V........HEFEST.NGIISMK--tk....................................
G3GUN0_CRIGR/1382-1523                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A672Z3N5_9TELE/1309-1450             ...............................................rpeg----GRRQ..SRR.Q.LK.S.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A673Y8E0_SALTR/1186-1327             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A4S2L899_9HYME/1374-1515             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
G3SY08_LOXAF/1362-1503                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNS..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A226PF01_COLVI/1384-1525             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-m.....................................
A0A1D6NTR5_MAIZE/139-274               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............FGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYAELV.MAHLV..E.E...I...-...N.D..SD..YF..................SDG.VPKE....MM....RV....DDV.LVRIANISLIEEK............M........AATG--.---------pgkitnifpny...........................
A0A2I4BV99_9TELE/1412-1553             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............cqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QLV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSIPE-l.....................................
A0A653CKA6_CALMS/1366-1508             ..............................................dgdln-----RRS..RRK.MeRR.D.E.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGEYSMPE-v.....................................
A0A5N4C6S1_CAMDR/1397-1561             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..Evsf....flpqVL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FKswhdcclttslplyyrAYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A183T3J7_SCHSO/1394-1515             ..............................................vtwtd--------..---.-.--.-.-.....--.-..--..----..-.-...D.RR.M..L...........VY.GF...NA.HDRQ.MFLDS..VM..R.............FGLp...............prGILpP.QE...W......L...............P....MALRS.....K.PPVH......LF................AYTALF.MRHLY..D.DplvA...D...D.N..AP..EW..................CDG.LPKE....GV....SG....LTV.LSRIAMMSLIRNK............V........IQFEDY.NAV------prkhr.................................
A0A384BGQ1_URSMA/1364-1505             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
M4D4A6_BRARP/519-586                   .................................................rt--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......LE................SYGILF.LKHIV..E.D...K...D...V.N..SP..TF..................SDG.VPKE....GL....IC....HDL.LAKIALMMLIQKK............V........KLMKNH.PTIPVFSD-g.....................................
A0A446X4T4_TRITD/38-172                .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A1D6NTQ8_MAIZE/921-985               ............................................nisgkrg-------Q..YSK.-.RK.S.R.....NV.D..SI..PLME..G.E...G.RT.L..R...........VL.GF...NH.AQRA.MFLQT..LN..R.............L--..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------vtdmplepvwsasey.......................
V4LVQ6_EUTSA/919-1055                  ..................................................g-NQTGRRP..YRR.R.GR.-.D.....NS.E..PT..PLME..G.E...G.RS.F..R...........VL.GF...NQ.SQRA.IFVQT..LM..R.............YGV..................GNY.D.WK...E......F...............V....PRLKQ.....K.TYDE......IK................DYGVLF.LKHIA..E.D...I...D...E.N..SP..TF..................SDG.VPKE....GL....RI....EDV.LVRIAVLMLVQEK............V........KYVEDH.PAKPVFPN-r.....................................
A0A446X4W9_TRITD/897-1031              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A0R4IJ89_DANRE/1361-1502             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...S.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKFSTPD-r.....................................
A0A5D2U685_GOSMU/934-1070              ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIS..E.D...I...-...T.E..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSNK............V........KTASEH.PGTRLFTD-d.....................................
A0A2Y9T071_PHYMC/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A672TX66_STRHB/1306-1447             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6J3QCL0_TURTR/1388-1529             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2R9B0U4_PANPA/1354-1495             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A026X2N4_OOCBI/1370-1511             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
B8B3I5_ORYSI/884-1017                  .............................................lagrrg-------P..YSK.K.KQ.-.R.....NV.D..SL..PFME..G.E...G.RA.L..R...........VY.GF...NQ.IQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......F...............T....PRLKG.....K.SVEE......IQ................RYAELV.MIHLL..E.D...I...-...N.D..SG..YY..................ADG.VPKE....-M....RT....DET.LVRLANISLVEEK............V........AAMEQG.KITKLFPS-y.....................................
A0A3Q0GVG2_ALLSI/1262-1403             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
L7N2M1_XENTR/1147-1288                 ................................................der---SEGKA..FQK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1X7U6C2_AMPQE/842-982               ...............................................fstv-----SRR..KAR.T.AF.K.S.....KS.E..VV.pPLLA..K.M...N.NT.I..H...........VY.GF...NP.RQRK.AFLNS..IL..R.............YGMp...............pdNAL.S.SS...W......L...............P....KELRN.....K.NEAT......FN................AYVSMF.MRHLC..E.P...D...T...P.N..SV..TH..................TDG.VPKM....SV....PR....QNI.LTRIGVMKLIKNK............I........DQYNEL.NGNSSMP--ge....................................
A0A6Q2YUL2_ESOLU/1292-1435             ................................................svg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVITLL---............-........------.---------yglelkklteslssdpntpvqs................
A0A665VEU5_ECHNA/1278-1419             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4S2M0Q1_OPIFE/1423-1556             ...............................................llam--------..-AR.R.TR.R.E.....RE.G..RL.pPLLS..R.V...S.GQ.I..E...........VL.GF...NV.RQRR.SFLNA..IM..R.............YGL..................PSL.E.LL...S......T...............V....RDLRC.....K.PDRV......LR................AYISLF.LRHLC..E.P...E...T...T.T..SD..TF..................SDG.VPRE....GI....AP....QHV.LSRIGIMALVAKK............V........KEFERI.NGRWSIPE-l.....................................
A0A6H5GLE0_9HEMI/1273-1408             ...............................................ddgt----MKKK..RRP.E.RR.D.E.....KD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKH......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..SF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........------.---------fysnflaqf.............................
U4UMR7_DENPD/1031-1173                 ..............................................egdin-----RRS..RRR.M.ERkD.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..SD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGDYSMPE-l.....................................
B4L0W7_DROMO/1374-1515                 .................................................de--QNGERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A6D2JNX4_9BRAS/855-1000              .................................................gs--QMRRKP..YKR.R.VR.G.SnlligNS.E..PI..PLTE..A.G...K.REpL..I...........VR.GL...NK.GQRK.TFLQT..FM..R.............YGV..................SNY.D.WK...K......Y...............V....QHFKT.....T.TYDQ......IK................EYGTLF.LKHIS..E.D...T...T...D.DniSP..AF..................SDG.LYKE....GL....KK....DDV.LLRVALLMEVEAK............V........KRAEEE.PTKPIFPD-r.....................................
A0A0D2KBA6_9CHLO/121-232               ...................................aamaaaaarrrafeag--------..---.-.--.-.-.....--.-..-L.pPLIE..N.MhagV.QG.M..R...........VY.GL...NA.QERA.GLLDA..FL..A.............FGLrpa............asgDPA.DvFK...H......M...............S....DAAPG.....K.NLKH......IA................HYVNLL.LRHTS..V.P...V...V...A.G..TD..TF..................PDG.VPR-....--....--....---.-------------............-........------.---------aatl..................................
A0A3P8ZUW0_ESOLU/1311-1435             ...............................................eggc----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVITLL---............-........------.---------yt....................................
A0A1S4BDI8_TOBAC/169-305               ...............................................gapv----VRRP..YRK.R.SR.V.D.....SS.V..TL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVKI..LM..R.............FGV..................GDY.D.WA...E......F...............T....PRLKQ.....K.TYEE......IR................DYGNLF.LSHIA..E.D...I...-...T.E..SP..TF..................TDG.VPKE....GL....RI....QDV.LLRIAVLLLIRDK............V........KASSEE.TNGPLFA--kd....................................
A0A553MTF3_9TELE/1462-1587             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.-------------............-........------.---------qefehvngqwsmp.........................
A0A2K5ETD1_AOTNA/1360-1501             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3JCM3_LINUN/1395-1538             ............................................ekselgr-------G..GRR.RgGV.P.E.....KD.R..PL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.N.SH..cR......L...............V....RDLRG.....K.SEKV......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AD..TF..................ADG.VPRE....GL....SR....QHV.LTRIGIMSLVRKK............V........QEFEAI.NGTESMPY-k.....................................
A0A6J3QQU9_TURTR/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3Q3B9R1_KRYMA/1257-1397             ................................................ddr---PERRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............cqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......F-................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QLV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSMPE-l.....................................
A0A061GHM8_THECC/935-1071              ..................................................g-NQSGRKP..YRK.R.VR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDY.D.FK...E......F...............V....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIV..E.D...M...-...N.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIATLLLIGQK............V........KSASEN.PGTSLFTD-d.....................................
H2MRY1_ORYLA/1302-1443                 ...............................................rpeg----GRRQ..SRR.Q.LK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A665VAZ9_ECHNA/1243-1384             ...............................................rteg----KAQP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4U5V3T5_COLLU/1431-1572             .................................................er--TNARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1R3GU15_COCAP/944-1080              .................................................gn--QPGRRA..YRK.R.AR.T.D.....NT.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GEW.D.WK...E......F...............A....ARLKQ.....K.TYEE......IN................EYGTLF.LRHIA..E.E...M...-...T.D..SL..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLIGNK............V........KSASEN.PGTRLFTD-d.....................................
A0A1D5P5W8_CHICK/98-239                ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A4S4ESG6_CAMSI/386-442               ............................................smdidsq--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...T...S...N.Q..LP..QV..................ING.VPK-....GL....RI....EDV.LGRIAVSLLIRDK............V........KAASEK.PGTPLFPD-d.....................................
A0A3Q2DMN4_CYPVA/1280-1421             .................................................se--ANNRRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A392NGB5_9FABA/69-192                ..............................................nlsak-----SHS..KKK.A.QT.A.D.....DT.N..PL..PLME..G.E...G.NS.L..K...........VL.GF...TL.SQRN.TFLQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....PRIKQ.....K.TWHE......IN................AYGNLF.MSHIA..E.D...I...-...N.D..SP..TF..................SDG.VPKE....GL....QI....EDV.LVRIAVLLSIREK............V........S-----.---------s.....................................
A0A087YGI5_POEFO/1366-1507             ...............................................rpeg----GRRQ..SRR.Q.LK.N.E.....KD.K..PL.pPLLA..R.V...G.GS.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SERE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKLSSPD-l.....................................
A0A1V4KNF0_PATFA/1323-1464             ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A6G0TSE0_APHGL/1376-1517             .............................................geagkk---LKRKP..ERK.-.--.E.E.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..SE..NF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEEI.NGFYSMPE-l.....................................
A0A0Q3LZ70_AMAAE/340-481               ...............................................rpeg----GRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3Q0FH97_VIGRR/62-135                .........................adhsendsnsfetptptrrgkkirgt--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..-Fsh..............vsLDG.VPKE....GL....RI....QDI.LLRIALLTMISDK............A........LDLKEE.EAKAIFEE-l.....................................
A0A091KK42_9GRUI/1331-1472             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4U1FNR1_MONMO/1419-1560             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A674C229_SALTR/1162-1303             ................................................dqg---SSRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A4X2JV30_VOMUR/1407-1548             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A072VDM6_MEDTR/912-1048              .................................................rt--TTSKRP..SKK.T.AP.A.D.....NT.N..PP..ALME..G.E...G.KS.L..K...........VI.GF...TQ.RQRA.AFLQL..LM..R.............FGV..................GDF.D.WK...D......F...............I....PHMKQ.....K.TCEE......IN................EYGALF.LSHIA..E.D...I...-...N.D..SP..AF..................SDG.VPKE....GL....QI....VEV.LVRISVLSLIREK............V........KFASEN.PGTPLFSD-d.....................................
A0A093LUU3_FULGA/1396-1537             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A3Q4A8K7_MOLML/1241-1382             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A446X4X9_TRITD/803-937               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A423SH70_PENVA/384-489               ...............................................nete---GGRRS..RRR.G.DR.G.D.....RD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqEAF.N.SQ...W......L...............V....RDLRG.....K.SEKC......FR................AYTSLF.MRHLC..E.P...G...N...D.N..AE..TF..................ADG.V---....--....--....---.-------------............-........------.---------lv....................................
A0A445KX43_GLYSO/931-1068              .................................................gt--TTARRP..YKK.K.AR.TaD.....ST.E..PH..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..ST..TF..................ADG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KYASQH.PQTPLFSD-d.....................................
A0A4X2JYN2_VOMUR/1427-1568             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A151I735_9HYME/1344-1495             ..............................................dllsr------RS..RRRlE.RR.D.E.....KD.R..PL.pPLLA..R.V...N.GN.I..E...........VS.LFiiyNIfVHAF.IYINA..IM..R.............YGMp...............pqDAF.N.SQ...WqvngnlL...............V....RDLRG.....K.SEKN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-m.....................................
A0A2U3ZDU7_ODORO/1375-1516             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2I4CIX5_9TELE/1406-1547             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
F5GWX5_HUMAN/1373-1514                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A6A1Q6E0_BALPH/1424-1565             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A667Z340_9TELE/1172-1313             ................................................dqg---RGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A674C120_SALTR/1248-1389             ................................................dqg---SSRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...A.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A453QYW3_AEGTS/924-1058              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
M3Y6W4_MUSPF/1371-1512                 ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A3P8S7N0_AMPPE/1412-1553             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A1D1V5T4_RAMVA/1439-1578             .............................................pkefah--------..-GR.K.GR.K.K.....DE.G..PL.pPLLT..K.I..pG.GG.F..D...........VL.GF...NT.RQRK.SFLNG..VL..R.............YGIp...............seDDQ.S.WQ...W......N...............I....RDLRS.....K.SERH......FR................AYASMF.MRHLC..E.P...G...L...D.N..AE..TF..................SDG.VPRE....GL....SR....HHI.LSRVGINSLIRKK............V........KEFEMV.NGKHSQPE-i.....................................
A0A1S3PYS1_SALSA/1398-1539             ................................................gaa---NSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A1S3P3D0_SALSA/1380-1521             ...............................................rpeg----GRRH..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A430QK29_SCHBO/1396-1517             ............................................itwhrde--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.L..F...........IY.NF...GP.NDRQ.LFNNA..VM..R.............FGLpp..............pgIVP.P.QD...W......L...............P....PALYY.....K.SQFQ......LF................GYVCLY.MKHLY..D.D...PnglD...E.S..EE..SW..................SDG.LPKE....HL....CV....PAV.LSRIAVMALIRNK............V........LQYEDV.NGPTSIS--td....................................
T1ED10_HELRO/995-1136                  ..............................................eegkk-----EGK..KKR.Y.AG.G.D.....RD.R..TL.pPLLA..R.V...N.GQ.I..E...........VL.GF...NT.RQRK.AFLNL..IM..R.............YGMp...............phDPN.N.TP...W......L...............T....RDLKG.....K.SVRE......FK................AYVSLF.MRHLC..E.P...G...A...E.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHI.NNP------hqwmss................................
A0A0N4V906_ENTVE/1213-1352             ..............................................fdstg-----DRR..RRH.R.ER.-.-.....GD.E..KL.pPLLA..R.V...S.GQ.L..E...........VL.GF...NP.RQRR.AFYNA..VM..R.............WGMp...............pqDAY.Q.SQ...W......L...............V....RDLKG.....K.SERA......FK................AYTSLF.MRHLC..E.P...G...A...D.S..QE..SF..................NDG.VPRE....GL....NR....QHV.LTRIGIMSLIRKK............V........QEFEIS.NGEWSMPE-v.....................................
A0A3S2M9X8_CHISP/1381-1522             ..............................................dllsr------RS..KRRlE.RR.E.E.....RD.R..PL.pPLLA..R.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A5A9N269_9TELE/1276-1417             ................................................sev---NSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A670J1S6_PODMU/1262-1344             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................YWV---.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------sg....................................
E3LUG3_CAERE/1268-1408                 ............................................ddddyde--------..RRK.R.RR.D.E.....NS.E..KM.pPLMA..K.V...N.GQ.V..E...........IL.GF...NP.RQRK.AFYGG..VM..R.............WGMp...............pqDSH.Q.SQ...W......F...............V....RDLRN.....K.SEKV......FR................AYASLF.MRHLC..E.P...G...A...D.G..HD..TF..................NDG.VPRE....GL....NR....QHV.LGRIGLLSLVRRK............V........QEFEPY.NGEWSMPE-v.....................................
A0A669C703_ORENI/1297-1438             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A2Y9QU03_TRIMA/1208-1349             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3B6REL0_WHEAT/897-1031              .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A674GAE3_TAEGU/1263-1404             ..................................................e-GQSGRRQ..SRR.Q.LK.T.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A446Y4N5_TRITD/803-937               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
G3U9I3_LOXAF/1350-1491                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2R8YFD8_HUMAN/1372-1513             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A452GSA9_9SAUR/1270-1411             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTAD-l.....................................
A0A3R7DC78_CLOSI/1423-1556             ...............................................llam--------..-AR.R.TR.R.E.....RE.G..RL.pPLLS..R.V...S.GQ.I..E...........VL.GF...NV.RQRR.SFLNA..IM..R.............YGL..................PSL.E.LL...S......T...............V....RDLRC.....K.PDRV......LR................AYISLF.LRHLC..E.P...E...T...T.T..SD..TF..................SDG.VPRE....GI....AP....QHV.LSRIGIMALVAKK............V........KEFERI.NGRWSIPE-l.....................................
A0A2Y9Q050_DELLE/1373-1514             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A3P8RTJ5_AMPPE/1305-1446             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A200QDZ7_9MAGN/939-1075              ............................................tasgrkl-------H..SKK.K.AR.V.D.....GN.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SHRA.TFVQI..LM..R.............FGL..................GDF.D.WR...E......F...............I....PRMKQ.....K.TFEE......IK................EYGILF.LSHIA..E.D...I...-...T.E..SP..SF..................SDG.VPKE....GL....RI....QDV.LIRIAVLLLIKDK............V........KLLQER.PGTPLFPE-d.....................................
A0A4W3HKS7_CALMI/939-1079              ..................................................k-SEAGRRN..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..FM..R.............WGMp...............pqDSF.S.SH...W......L...............V....RDLRG.....K.SQKE......FR................AYVSLF.MRHLC..E.P...G...-...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEYI.NGRYSIPE-l.....................................
A0A1S3M275_SALSA/1392-1533             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A267F0V9_9PLAT/1379-1517             ...........................................egegqagg--------..--R.R.-R.R.D.....RD.V..KM.pPLLS..K.L...N.NQ.I..E...........VF.GF...NP.RQRR.AFLNA..IM..R.............YGLp...............psEVY.N.SP...W......M...............S....RDLRS.....K.PEKV......FR................AYTALF.MRHLC..E.P...D...S...D.V..TD..TF..................SDG.VPRE....GI....NR....QHV.LTRIGTMALLRKK............V........QEFEKV.NGEYSMPS-m.....................................
E9QAS5_MOUSE/1380-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A671Y8N3_SPAAU/1176-1317             .................................................se--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
X1WBL0_DANRE/1272-1413                 ................................................erp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..IM..R.............WGMp...............aqDAF.S.SQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGKWSMPE-l.....................................
A0A6Q2WSR7_ESOLU/1199-1340             ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSLPE-l.....................................
A0A444V4R4_ACIRT/4-114                 ................................................clc--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..Q...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKD......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............Q........------.---------vpsssesspssek.........................
M9PIA6_DROME/1366-1507                 ...............................................dqng----AERK..AKR.R.LE.R.R.....DD.R..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......L...............V....RDLRG.....K.SERN......FK................AYVSLF.MRHLC..E.P...G...A...D.N..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHI.NGYYSMPE-l.....................................
A0A6J3QR89_TURTR/1434-1575             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A2K5JI17_COLAP/1194-1348             ...............................................cprw-----RRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A2K6P1K6_RHIRO/1376-1517             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A4C1YP13_EUMVA/47-110                ..............................................dllsr------RS..KRRiE.RR.E.E.....RD.R..PL..PPYL..P.V...G.GN.M..E...........VL.GF...NA.RQRK.SFLNA..IM..R.............YGMp...............pqDAF.N.SQ...W......I...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------......................................
A0A091MTL5_9PASS/1350-1491             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A2K6P1K4_RHIRO/1376-1531             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SL....MSL.VKKKVSVFLSPKK............-........------.---------strsgvrrrrlelpvqefehingrwsmpel........
A0A1U8I6V8_GOSHI/756-892               .................................................vn--QPGRKP..YKK.R.IR.V.D.....NT.E..PL..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....SRLKQ.....K.SYDE......IK................DYGTLF.LTHIA..E.D...I...-...T.D..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSEK............V........KDASEK.PGTRLFTD-d.....................................
A0A1S3WBR1_ERIEU/1214-1355             ................................................erp---EGRRQ..SKR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..SE..TF..................ADG.VPRE....GL....SR....QQV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSMPE-l.....................................
A0A060XAS3_ONCMY/333-474               ...............................................rpeg----SRRQ..SRR.Q.MR.N.E.....RD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............aqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A0D2PU84_GOSRA/934-1070              ..................................................g-TQSGRRP..YRK.R.NR.V.D.....ST.E..PI..PLME..G.E...G.KS.F..R...........VL.GF...NQ.SQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............A....PRLKQ.....K.TYEE......IK................DYGVLF.LSHIS..E.D...I...-...T.E..SP..TF..................SDG.VPKE....GL....RI....QDV.LVRIAVLLLVSNK............V........KTASEH.PGTRLFTD-d.....................................
A0A672HF85_SALFA/1290-1431             .................................................te--ANARRP..NRK.G.LR.N.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.NQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
H2NG88_PONAB/1379-1521                 ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PIclPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPEK....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3PYS9_SALSA/1391-1532             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A151TT78_CAJCA/931-1067              .................................................gt--TTAKRP..YKK.K.AR.T.D.....ST.E..PL..PLME..G.E...G.KA.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....FRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SS..TF..................TDG.VPKE....GL....RI....QDV.LVRIAVLLLIRDK............V........KFALQH.PQTPLFSD-d.....................................
G7K1B2_MEDTR/9-58                      ...............................................kmni---TGRRP..SKK.K.AH.-.-.....NT.D..PP..PLIE..C.D...G.RS.L..K...........VL.GY...TQ.SQTA.SFLQI..L-..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................------.-----..-.-...-...-...-.-..--..--..................---.----....--....--....---.-------------............-........------.---------chl...................................
A0A3Q1GCX9_9TELE/1250-1391             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A672J0R0_SALFA/1236-1377             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
W5ML03_LEPOC/1340-1481                 ................................................aev---NSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W2EH10_BOBOX/1221-1362             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A5N4DAA7_CAMDR/1399-1540             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A672J2W9_SALFA/1277-1418             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GS.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.TEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............I........QEFEHI.NGRWSLPE-l.....................................
A0A2K6R2W6_RHIRO/1373-1514             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A2Y9NJM5_DELLE/1380-1521             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A178UZA8_ARATH/855-991               ..................................................k-PRTVTRP..YRK.R.AR.-.D.....NS.E..EI..PLME..G.E...G.RY.L..M...........VL.GF...NE.TERD.IFLRT..FK..R.............YGA..................GNF.D.WK...E......F...............V....NPLYM.....K.TYDE......IN................KYGILF.LKHIA..E.N...P...T...D.N..ST..NF..................KDG.VPKE....GI....SS....DEL.LVSMTFMMLVKEK............C........QFLDNH.PTAPVFSN-y.....................................
A0A2K5ET78_AOTNA/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1V4KNI5_PATFA/1325-1466             ..................................................e-GQSGRRQ..SRR.Q.LK.S.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............WGMp...............pqDAF.N.SH...W......L...............V....RDLRG.....K.SEKE......FR................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEHV.NGKYSTPD-l.....................................
A0A446X4V7_TRITD/1010-1080             .............................................qrdlic--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.---H......FT................KYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........AAMEQG.KITKLFPN-y.....................................
A0A4W4EIH4_ELEEL/1380-1521             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A6A5ME68_LUPAL/982-1117              .................................................gt--TSARRP..YRK.K.AR.-.D.....ST.E..PL..PLME..G.E...G.RS.F..R...........VL.GF...NQ.NQRA.AFVQI..LM..R.............FGV..................GDF.D.WK...E......F...............T....SRMKQ.....K.TYEE......IK................DYGTLF.LSHIA..E.D...I...-...T.D..SS..TF..................ADG.VPKE....GL....RI....QDV.LVRIAILLLIKDK............V........KFASEN.PRIALFSD-d.....................................
A0A5F4CQZ0_CANLF/1313-1454             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A4W5NR79_9TELE/1309-1450             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.AEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A674HUL9_TAEGU/1378-1519             .................................................rs--EAARRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3WHF4_ERIEU/1373-1514             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A1S3Q081_SALSA/1386-1527             .................................................ae--ANSRRP..NRK.G.MR.G.D.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NV.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A3Q3GS44_KRYMA/1366-1434             ..............................................vassl--------..---.-.--.-.-.....--.-..--..----..-.-...-.--.-..-...........--.--...--.----.-----..--..-.............---..................---.-.--...-......-...............-....-----.....-.----......--................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
W5KTJ0_ASTMX/1279-1420                 .................................................se--ANNRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A4W4DYK4_ELEEL/1193-1334             ................................................erp---EGRRQ..SRR.Q.IR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.CQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...V...A...D.G..SE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........QEFEHI.NGRWSIPE-l.....................................
A0A673BAQ0_9TELE/1270-1411             ................................................drp---EGRRQ..SRR.Q.LR.N.E.....KD.K..PL.pPLLA..R.V...G.GN.L..E...........VL.GF...NT.RQRK.AFLNA..VM..R.............WGMp...............sqDAF.S.SQ...W......L...............V....RDLRG.....K.NREG......FK................AYVSLF.MRHLC..E.P...V...A...D.G..AE..TF..................ADG.VPRE....GL....CR....QPV.LTRIGVMSLVKKK............V........RTSKHI.NGPM-----espel.................................
A0A4W6FLD0_LATCA/1347-1488             .................................................te--ANSRRP..NRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NS.RQRK.AFLNA..VM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGQWSMP--wm....................................
A0A485MEF6_LYNPA/1149-1290             ................................................rse---APRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..IM..R.............YGMp...............pqDAF.T.TQ...W......L...............V....RDLRG.....K.SEKE......FK................AYVSLF.MRHLC..E.P...G...A...D.G..AE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLIRKK............V........QEFEHV.NGRWSMPE-l.....................................
A0A453QYI1_AEGTS/330-462               .............................................nvsgrk------AQ..YSK.K.NS.-.R.....NV.D..SL..PLME..G.E...G.RA.L..K...........VY.GF...NH.VQRT.QFLQT..LM..R.............YGF..................QNY.D.WK...E......Y...............L....PRLKG.....K.SVEE......IQ................RYGELV.MAHLV..E.D...T...-...N.D..SP..TY..................ADG.VPKE....-M....RA....DET.LVRLAKISLVEEK............V........YV----.---------hnimhyvlsft...........................
A0A4W3HKC3_CALMI/853-993               ..................................................k-SEAGRRN..SRR.Q.LK.S.E.....RD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA..FM..R.............WGMp...............pqDSF.S.SH...W......L...............V....RDLRG.....K.SQKE......FR................AYVSLF.MRHLC..E.P...G...-...D.G..SE..TF..................ADG.VPRE....GL....SR....QHV.LTRIGVMSLVRKK............V........QEFEYI.NGRYSIPE-l.....................................
A0A553MTF4_9TELE/1462-1587             .................................................se--ANSRRP..SRK.G.LR.N.D.....KD.K..PL.pPLLA..R.V...G.GN.I..E...........VL.GF...NA.RQRK.AFLNA