GenomeNet

Database: Pfam
Entry: DUF1497
LinkDB: DUF1497
Original site: DUF1497 
#=GF ID   DUF1497
#=GF AC   PF07384.11
#=GF DE   Protein of unknown function (DUF1497)
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_20585 (release 10.0)
#=GF GA   20.00 20.00;
#=GF TC   20.00 20.00;
#=GF NC   19.90 19.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR009972;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of several phage and bacterial proteins of
#=GF CC   around 59 residues in length. Members of this family seem to be
#=GF CC   found exclusively in Lactococcus lactis and the bacteriophages
#=GF CC   that infect this organism. The function of this family is
#=GF CC   unknown.
#=GF SQ   19
#=GS T0TKS3_LACLC/1-50         AC T0TKS3.1
#=GS Q9CFQ1_LACLA/1-59         AC Q9CFQ1.1
#=GS A0A1P8BKF9_9CAUD/1-59     AC A0A1P8BKF9.1
#=GS A0A1P8BK92_9CAUD/4-61     AC A0A1P8BK92.1
#=GS B5SP12_9CAUD/1-59         AC B5SP12.1
#=GS Q38103_BPR1T/1-59         AC Q38103.1
#=GS A0A1P8BKJ3_9CAUD/4-62     AC A0A1P8BKJ3.1
#=GS A0A1P8BKT2_9CAUD/1-59     AC A0A1P8BKT2.1
#=GS T0THH7_LACLC/1-58         AC T0THH7.1
#=GS T0SEU2_LACLC/1-58         AC T0SEU2.1
#=GS R9QM24_9CAUD/1-59         AC R9QM24.1
#=GS R9QNB4_9CAUD/1-59         AC R9QNB4.1
#=GS Q77MW8_9CAUD/1-59         AC Q77MW8.1
#=GS A0A1P8BMJ6_9CAUD/1-59     AC A0A1P8BMJ6.1
#=GS A0A1P8BME0_9CAUD/4-62     AC A0A1P8BME0.1
#=GS Q77JM2_9CAUD/1-59         AC Q77JM2.1
#=GS A0A1R4L8E9_9SPHI/241-286  AC A0A1R4L8E9.1
#=GS Q77RZ5_BPTU2/1-59         AC Q77RZ5.1
#=GS Q9AYU3_9CAUD/1-59         AC Q9AYU3.1
T0TKS3_LACLC/1-50                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSEFNQEMQAEFHEKI---------.....
Q9CFQ1_LACLA/1-59                    ..MGYYDTRNEARRISKLASQNISSEQTKKEFELDRQSKFNQEMQAEFHEKIKKLGEKNGS.....
A0A1P8BKF9_9CAUD/1-59                ..MGYYDTRNEARRISKLASQNISSEQTKKEFELDGQSKFNQEMQAEFHERIKKLGGKNGS.....
A0A1P8BK92_9CAUD/4-61                ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHERIKKLGEK---kw...
B5SP12_9CAUD/1-59                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHERIKKLGGKNGS.....
Q38103_BPR1T/1-59                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHERIKKLGEKNGS.....
A0A1P8BKJ3_9CAUD/4-62                ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHERIKKLGEKNGS.....
A0A1P8BKT2_9CAUD/1-59                ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHERIKKLGEKNGS.....
T0THH7_LACLC/1-58                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHEKIKKLGEK---mv...
T0SEU2_LACLC/1-58                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSEFNQEMQAEFHEKIKKLGEKN--e....
R9QM24_9CAUD/1-59                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELNSQSKFNQEMQAEFHERIKKLGEKNGS.....
R9QNB4_9CAUD/1-59                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELNSQSKFNQEMQAEFHERIKKLGEKNGS.....
Q77MW8_9CAUD/1-59                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHEKIKKLGEKN--ky...
A0A1P8BMJ6_9CAUD/1-59                ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHERIKKLGEKNGS.....
A0A1P8BME0_9CAUD/4-62                ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHERIKKLGEKNGS.....
Q77JM2_9CAUD/1-59                    ..MGYYDTRNEARRISKLASQNISSEQTKKEFELDRQSKFNQEMQAEFHEKIKKLGEKNGS.....
A0A1R4L8E9_9SPHI/241-286             lk----------KHVSNLNSKSVASEQLQKEFYLAYDSRFFQN--TELYNKIK--------fwetk
Q77RZ5_BPTU2/1-59                    ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHERIKKLGEKNGS.....
Q9AYU3_9CAUD/1-59                    ..MGYYDTRNEARRISKLASQNISSEQTKKEFELDRQSKFNQEMQAEFHEKIKKLGEKNGS.....
#=GC seq_cons                        ..MGYYDTKNEARRISKLASQNISSEQNKKEFELDSQSKFNQEMQAEFHE+IKKLGEKNGS.....
//
DBGET integrated database retrieval system