GenomeNet

Database: Pfam
Entry: DUF2070
LinkDB: DUF2070
Original site: DUF2070 
#=GF ID   DUF2070
#=GF AC   PF09843.9
#=GF DE   Predicted membrane protein (DUF2070)
#=GF AU   COGs;
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   COGs (COG3356)
#=GF GA   30.00 30.00;
#=GF TC   35.10 33.80;
#=GF NC   29.90 29.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR019204;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This is a family of Archaeal 7-TM proteins. There are 6 closely
#=GF CC   assembled TM-regions at the N-terminus followed by a long
#=GF CC   intracellular, from residues 220-590, highly conserved region,
#=GF CC   of unknown function, terminating with one more TM-region. The
#=GF CC   short 25 residue section between TMs 5 and 6 might lie on the
#=GF CC   outer surface of the membrane and be acting as a receptor (from
#=GF CC   TMHMM). 
#=GF SQ   254
#=GS A0A1I2MES5_9EURY/8-630    AC A0A1I2MES5.1
#=GS A0A2I0QN39_9EURY/5-535    AC A0A2I0QN39.1
#=GS U1NPU1_9EURY/1-179        AC U1NPU1.1
#=GS F2L3W8_THEU7/5-528        AC F2L3W8.1
#=GS A0A135VKC1_9ARCH/10-604   AC A0A135VKC1.1
#=GS B1L6A8_KORCO/16-556       AC B1L6A8.1
#=GS A0A1F3BDB8_9ARCH/12-580   AC A0A1F3BDB8.1
#=GS M0FMK9_9EURY/6-553        AC M0FMK9.1
#=GS A0A151BIQ0_9ARCH/1-246    AC A0A151BIQ0.1
#=GS A4WN84_PYRAR/4-532        AC A4WN84.1
#=GS G4RL67_THETK/5-527        AC G4RL67.1
#=GS A0A0W1SJ69_9EURY/8-630    AC A0A0W1SJ69.1
#=GS A0A166FL64_9EURY/7-599    AC A0A166FL64.1
#=GS A0A1Q7MI77_9CREN/16-604   AC A0A1Q7MI77.1
#=GS A0A1Q7MLV1_9CREN/17-605   AC A0A1Q7MLV1.1
#=GS M0CXE7_9EURY/8-637        AC M0CXE7.1
#=GS D5U045_THEAM/10-553       AC D5U045.1
#=GS Q4JA34_SULAC/7-521        AC Q4JA34.1
#=GS T0M368_9EURY/11-569       AC T0M368.1
#=GS B8GH28_METPE/9-570        AC B8GH28.1
#=GS A0A2A3T7N7_9ARCH/11-579   AC A0A2A3T7N7.1
#=GS A0A151BRJ1_9ARCH/20-604   AC A0A151BRJ1.1
#=GS Q0W080_METAR/5-573        AC Q0W080.1
#=GS A0A1D2W537_9EURY/7-598    AC A0A1D2W537.1
#=GS D3RYE6_FERPA/7-525        AC D3RYE6.1
#=GS H1Z3E5_9EURY/9-579        AC H1Z3E5.1
#=GS A0A256HAQ4_9EURY/6-547    AC A0A256HAQ4.1
#=GS A0A256Z5H1_9CREN/7-466    AC A0A256Z5H1.1
#=GS A0A109UUY0_9EURY/7-596    AC A0A109UUY0.1
#=GS A0A2A3T0Q7_9EURY/15-581   AC A0A2A3T0Q7.1
#=GS L0HK23_METFS/9-594        AC L0HK23.1
#=GS S0AMW1_FERAC/25-582       AC S0AMW1.1
#=GS E1RJF9_METP4/9-572        AC E1RJF9.1
#=GS A4YEK3_METS5/7-521        AC A4YEK3.1
#=GS B9LN87_HALLT/6-549        AC B9LN87.1
#=GS A0A1Q7LLE6_9CREN/21-605   AC A0A1Q7LLE6.1
#=GS A0A256YUI0_9ARCH/9-442    AC A0A256YUI0.1
#=GS W7KX36_9CREN/8-503        AC W7KX36.1
#=GS G0QGP0_NANS0/6-548        AC G0QGP0.1
#=GS A0A1D3L2V9_9EURY/7-598    AC A0A1D3L2V9.1
#=GS E1QRT0_VULDI/7-583        AC E1QRT0.1
#=GS A0A1Q9PAG6_9ARCH/15-609   AC A0A1Q9PAG6.1
#=GS A0RX67_CENSY/10-577       AC A0RX67.1
#=GS A0A087S5E3_9ARCH/1-97     AC A0A087S5E3.1
#=GS D7E747_METEZ/6-550        AC D7E747.1
#=GS V4YE44_9ARCH/8-612        AC V4YE44.1
#=GS A0A151BH24_9ARCH/1-362    AC A0A151BH24.1
#=GS A0A0U3EB13_9EURY/7-596    AC A0A0U3EB13.1
#=GS A0A2I0NYP0_9EURY/1-162    AC A0A2I0NYP0.1
#=GS A0A2H9LLV3_9ARCH/1-192    AC A0A2H9LLV3.1
#=GS E3GYX6_METFV/7-595        AC E3GYX6.1
#=GS I7KC43_METBM/9-571        AC I7KC43.1
#=GS K0B386_9ARCH/10-579       AC K0B386.1
#=GS A0A1G9SZB3_9EURY/8-612    AC A0A1G9SZB3.1
#=GS D4GSQ8_HALVD/8-630        AC D4GSQ8.1
#=GS A0A0P7HZD6_9EURY/1-177    AC A0A0P7HZD6.1
#=GS U1PPF5_9EURY/8-176        AC U1PPF5.1
#=GS A0A166SST0_9EURY/8-610    AC A0A166SST0.1
#=GS U1QGA1_9EURY/1-129        AC U1QGA1.1
#=GS Q8TWQ6_METKA/49-593       AC Q8TWQ6.1
#=GS A0A1W6JXX2_9CREN/11-560   AC A0A1W6JXX2.1
#=GS A0A1Q9N6L9_9ARCH/13-607   AC A0A1Q9N6L9.1
#=GS Q2FQP0_METHJ/11-572       AC Q2FQP0.1
#=GS A0A2H1FEJ8_9ARCH/11-578   AC A0A2H1FEJ8.1
#=GS T0LXC4_9EURY/5-560        AC T0LXC4.1
#=GS A0A1V4C5F5_9EURY/8-628    AC A0A1V4C5F5.1
#=GS A0A219AK54_9EURY/7-593    AC A0A219AK54.1
#=GS A0A1I6KKQ0_9EURY/8-610    AC A0A1I6KKQ0.1
#=GS A0A0U5H1C2_9EURY/8-614    AC A0A0U5H1C2.1
#=GS K0IEX4_NITGG/11-582       AC K0IEX4.1
#=GS A0A165ZL16_9EURY/7-597    AC A0A165ZL16.1
#=GS A0A256ZMZ9_9CREN/1-172    AC A0A256ZMZ9.1
#=GS A0A2H9LMA5_9ARCH/17-382   AC A0A2H9LMA5.1
#=GS A0A2H9L2J4_9ARCH/17-598   AC A0A2H9L2J4.1
#=GS A8MBV2_CALMQ/5-581        AC A8MBV2.1
#=GS T0N8Y9_9EURY/8-565        AC T0N8Y9.1
#=GS A0A2I0PQL2_9EURY/9-574    AC A0A2I0PQL2.1
#=GS A0A2H9KZZ3_9ARCH/10-580   AC A0A2H9KZZ3.1
#=GS G0QGJ7_NANS0/6-245        AC G0QGJ7.1
#=GS A0A128A280_9ARCH/11-578   AC A0A128A280.1
#=GS A0A0F7PA47_9EURY/8-612    AC A0A0F7PA47.1
#=GS A1RXM0_THEPD/12-541       AC A1RXM0.1
#=GS A0A256ZLH1_9ARCH/14-610   AC A0A256ZLH1.1
#=GS A0A0M0BQE2_9ARCH/12-598   AC A0A0M0BQE2.1
#=GS A0A1D8S5M7_9EURY/8-613    AC A0A1D8S5M7.1
#=GS E0SQZ1_IGNAA/21-561       AC E0SQZ1.1
#=GS Q18KM9_HALWD/8-628        AC Q18KM9.1
#=GS U1MY28_9EURY/8-612        AC U1MY28.1
#=GS I3D2V5_9ARCH/10-580       AC I3D2V5.1
#=GS F9CVS4_9ARCH/1-519        AC F9CVS4.1
#=GS T0MMW3_9EURY/2-497        AC T0MMW3.1
#=GS A0A256ZBC3_9ARCH/1-89     AC A0A256ZBC3.1
#=GS A0A166B1A7_9EURY/7-598    AC A0A166B1A7.1
#=GS A0A1D2WN61_9EURY/7-597    AC A0A1D2WN61.1
#=GS A2SRZ9_METLZ/7-568        AC A2SRZ9.1
#=GS A0A0P9HXU5_9ARCH/16-601   AC A0A0P9HXU5.1
#=GS U2YST5_9EURY/8-617        AC U2YST5.1
#=GS A0A0A7V0Z7_9ARCH/10-577   AC A0A0A7V0Z7.1
#=GS S5Z778_9CREN/9-539        AC S5Z778.1
#=GS A0A0M0BLK5_9ARCH/3-352    AC A0A0M0BLK5.1
#=GS A0A256IE19_9EURY/8-292    AC A0A256IE19.1
#=GS A0A1Q6DTA7_9EURY/11-583   AC A0A1Q6DTA7.1
#=GS Q6L2E4_PICTO/7-557        AC Q6L2E4.1
#=GS A3DP52_STAMF/10-541       AC A3DP52.1
#=GS A0A1D2RDD2_9EURY/4-518    AC A0A1D2RDD2.1
#=GS A0A256IE19_9EURY/318-662  AC A0A256IE19.1
#=GS A0A133UM11_9EURY/4-535    AC A0A133UM11.1
#=GS A0A1Q9MWP3_9ARCH/2-112    AC A0A1Q9MWP3.1
#=GS A0A256YUI0_9ARCH/439-528  AC A0A256YUI0.1
#=GS M0M0V3_HALMO/8-611        AC M0M0V3.1
#=GS A8AC28_IGNH4/1-283        AC A8AC28.1
#=GS A0A0F7FI79_9CREN/9-544    AC A0A0F7FI79.1
#=GS V6ARL2_9ARCH/11-578       AC V6ARL2.1
#=GS A0A0W1RDB4_9EURY/549-663  AC A0A0W1RDB4.1
#=GS A0A0M0BG67_9ARCH/1-556    AC A0A0M0BG67.1
#=GS A0A256LCP7_9EURY/1-308    AC A0A256LCP7.1
#=GS A3CTU3_METMJ/9-571        AC A3CTU3.1
#=GS E6N3Z7_9ARCH/9-578        AC E6N3Z7.1
#=GS M0CAK5_9EURY/8-615        AC M0CAK5.1
#=GS A0A0W1RDB4_9EURY/8-542    AC A0A0W1RDB4.1
#=GS A0A1G7J2H7_9EURY/8-625    AC A0A1G7J2H7.1
#=GS A0A151BBC5_9ARCH/5-570    AC A0A151BBC5.1
#=GS V4YE16_9ARCH/1-224        AC V4YE16.1
#=GS A0A1F5DF27_9ARCH/1-553    AC A0A1F5DF27.1
#=GS A0A1J4UXA4_9ARCH/13-594   AC A0A1J4UXA4.1
#=GS A0A1D2R469_9EURY/4-576    AC A0A1D2R469.1
#=GS A0A1F5D2F3_9ARCH/1-420    AC A0A1F5D2F3.1
#=GS U1NGT9_9EURY/8-628        AC U1NGT9.1
#=GS A0A1H6HZT7_9EURY/6-546    AC A0A1H6HZT7.1
#=GS F0TAW7_METLA/7-598        AC F0TAW7.1
#=GS A0A1H8PSM1_9EURY/8-656    AC A0A1H8PSM1.1
#=GS N0BBI7_9EURY/7-541        AC N0BBI7.1
#=GS A0A2H1EIX4_9ARCH/11-578   AC A0A2H1EIX4.1
#=GS I3R284_HALMT/8-630        AC I3R284.1
#=GS F4B903_ACIHW/4-499        AC F4B903.1
#=GS A0A256KDL0_9EURY/1-209    AC A0A256KDL0.1
#=GS A0A2I0NMC5_9EURY/9-571    AC A0A2I0NMC5.1
#=GS A0A0U3FPR3_9CREN/3-404    AC A0A0U3FPR3.1
#=GS A0A1M2YI61_9ARCH/10-610   AC A0A1M2YI61.1
#=GS T0LI08_9EURY/9-563        AC T0LI08.1
#=GS M0MLZ7_9EURY/8-610        AC M0MLZ7.1
#=GS A0A1Q9MWV0_9ARCH/18-431   AC A0A1Q9MWV0.1
#=GS Q2NG70_METST/7-598        AC Q2NG70.1
#=GS A5ULA3_METS3/7-597        AC A5ULA3.1
#=GS A0A0F8WCN8_9ARCH/17-618   AC A0A0F8WCN8.1
#=GS V4Y8W8_9ARCH/8-95         AC V4Y8W8.1
#=GS M0GV31_9EURY/8-629        AC M0GV31.1
#=GS A0A1J4UES8_9ARCH/6-570    AC A0A1J4UES8.1
#=GS Q975B3_SULTO/7-520        AC Q975B3.1
#=GS J0S8V4_9EURY/12-574       AC J0S8V4.1
#=GS A0A2I0P8H4_9EURY/9-571    AC A0A2I0P8H4.1
#=GS A0A2I0PQL9_9EURY/9-595    AC A0A2I0PQL9.1
#=GS A0A2G9PSX0_9ARCH/17-598   AC A0A2G9PSX0.1
#=GS A9A387_NITMS/10-579       AC A9A387.1
#=GS A0A151BLV9_9ARCH/1-521    AC A0A151BLV9.1
#=GS B8D2L4_DESA1/10-553       AC B8D2L4.1
#=GS O30029_ARCFU/4-491        AC O30029.1
#=GS F3KI87_9ARCH/10-576       AC F3KI87.1
#=GS A0A256Z9L9_9ARCH/1-205    AC A0A256Z9L9.1
#=GS A0A0M0C0S6_9ARCH/15-598   AC A0A0M0C0S6.1
#=GS R9SKC8_9EURY/7-593        AC R9SKC8.1
#=GS F6D7Z2_METPW/7-602        AC F6D7Z2.1
#=GS A0A1J5J8Y6_9EURY/5-533    AC A0A1J5J8Y6.1
#=GS A0A1J4UPS3_9ARCH/10-596   AC A0A1J4UPS3.1
#=GS A0A0P9AVZ0_9ARCH/10-577   AC A0A0P9AVZ0.1
#=GS A0A135VVQ0_9ARCH/11-611   AC A0A135VVQ0.1
#=GS V4HDJ8_9EURY/8-652        AC V4HDJ8.1
#=GS A0A1I6GBX3_9EURY/8-629    AC A0A1I6GBX3.1
#=GS Q9HSH3_HALSA/8-617        AC Q9HSH3.1
#=GS A0A1V6N3C8_9EURY/7-618    AC A0A1V6N3C8.1
#=GS A0A133UI38_9EURY/4-535    AC A0A133UI38.1
#=GS I3TGE7_THEC1/10-549       AC I3TGE7.1
#=GS A0A218ZT49_9EURY/11-567   AC A0A218ZT49.1
#=GS U1PPF5_9EURY/172-509      AC U1PPF5.1
#=GS Q5V1J9_HALMA/8-611        AC Q5V1J9.1
#=GS F2KNU4_ARCVS/7-542        AC F2KNU4.1
#=GS A0A1F5CVU8_9ARCH/1-408    AC A0A1F5CVU8.1
#=GS G2MHN4_9EURY/8-629        AC G2MHN4.1
#=GS A0A257AK55_9ARCH/1-356    AC A0A257AK55.1
#=GS A0A1C8ZWK6_9CREN/7-520    AC A0A1C8ZWK6.1
#=GS A0A1G9QAR9_9EURY/8-650    AC A0A1G9QAR9.1
#=GS A0A0N8VKN3_9EURY/7-564    AC A0A0N8VKN3.1
#=GS A0A0P9EFP1_9ARCH/15-601   AC A0A0P9EFP1.1
#=GS A0A0M0BM27_9ARCH/11-224   AC A0A0M0BM27.1
#=GS H1Z4F5_9EURY/9-571        AC H1Z4F5.1
#=GS A0A117MHP8_9EURY/9-572    AC A0A117MHP8.1
#=GS U1NLA1_9EURY/8-612        AC U1NLA1.1
#=GS D1YX19_METPS/5-573        AC D1YX19.1
#=GS A0A135VGM8_9ARCH/10-604   AC A0A135VGM8.1
#=GS A0A218NMM5_9ARCH/16-614   AC A0A218NMM5.1
#=GS A0A087RZR4_9ARCH/10-579   AC A0A087RZR4.1
#=GS A0A256KNA9_9EURY/1-364    AC A0A256KNA9.1
#=GS A0A2I0P106_9EURY/13-260   AC A0A2I0P106.1
#=GS A0A2H9L2E1_9ARCH/16-599   AC A0A2H9L2E1.1
#=GS U1N8U3_9EURY/8-412        AC U1N8U3.1
#=GS A0A256XUM2_9CREN/11-556   AC A0A256XUM2.1
#=GS A0A2G1WEM4_9EURY/6-552    AC A0A2G1WEM4.1
#=GS A0A1M5JNR3_9EURY/8-634    AC A0A1M5JNR3.1
#=GS F7PJI2_9EURY/8-611        AC F7PJI2.1
#=GS A0A1H1DGD0_9EURY/8-630    AC A0A1H1DGD0.1
#=GS A0A1I0P0W3_9EURY/8-616    AC A0A1I0P0W3.1
#=GS K0BAD4_9ARCH/10-580       AC K0BAD4.1
#=GS D3E2D0_METRM/7-598        AC D3E2D0.1
#=GS A0A060HFG8_9ARCH/11-594   AC A0A060HFG8.1
#=GS A0A031LS02_9CREN/7-513    AC A0A031LS02.1
#=GS A0A0M0BSN0_9ARCH/11-594   AC A0A0M0BSN0.1
#=GS M0P2F8_9EURY/6-549        AC M0P2F8.1
#=GS D3TAX2_ACIB4/9-557        AC D3TAX2.1
#=GS A0A087S5M6_9ARCH/1-207    AC A0A087S5M6.1
#=GS A0A1J4UIY2_9ARCH/10-604   AC A0A1J4UIY2.1
#=GS A0A256YVS1_9CREN/1-129    AC A0A256YVS1.1
#=GS A0A0N7HBY7_9ARCH/11-590   AC A0A0N7HBY7.1
#=GS A0A0F7IFV4_9EURY/7-532    AC A0A0F7IFV4.1
#=GS V4Y4T7_9ARCH/8-629        AC V4Y4T7.1
#=GS U1QNX8_9EURY/5-284        AC U1QNX8.1
#=GS A0A1H3ISZ2_9EURY/6-546    AC A0A1H3ISZ2.1
#=GS A0A1J4UD57_9ARCH/8-585    AC A0A1J4UD57.1
#=GS A7I4Q8_METB6/9-574        AC A7I4Q8.1
#=GS Q97W82_SULSO/9-526        AC Q97W82.1
#=GS Q9HJC7_THEAC/10-567       AC Q9HJC7.1
#=GS A0A0F8BGK5_9EURY/6-549    AC A0A0F8BGK5.1
#=GS A0A1D2X1U5_9EURY/7-597    AC A0A1D2X1U5.1
#=GS U1PAB2_9EURY/8-628        AC U1PAB2.1
#=GS E4NSM2_HALBP/8-629        AC E4NSM2.1
#=GS A0A1Y3A5Q4_9EURY/6-576    AC A0A1Y3A5Q4.1
#=GS U6EAY7_9EURY/7-595        AC U6EAY7.1
#=GS A0A0M0BUM7_9ARCH/5-589    AC A0A0M0BUM7.1
#=GS I0A137_FERFK/148-528      AC I0A137.1
#=GS A0A0F8VEA1_9ARCH/16-618   AC A0A0F8VEA1.1
#=GS Q8ZYS0_PYRAE/4-532        AC Q8ZYS0.1
#=GS A0A2H9HZD0_9ARCH/23-600   AC A0A2H9HZD0.1
#=GS M0M1I6_9EURY/8-609        AC M0M1I6.1
#=GS G0EC50_PYRF1/3-507        AC G0EC50.1
#=GS A0A135VVL6_9ARCH/10-611   AC A0A135VVL6.1
#=GS A7I8W3_METB6/9-570        AC A7I8W3.1
#=GS A0A257ALI8_9ARCH/55-318   AC A0A257ALI8.1
#=GS A0A1U7ETZ4_NATPD/8-607    AC A0A1U7ETZ4.1
#=GS A0A0N8HZK0_9EURY/8-449    AC A0A0N8HZK0.1
#=GS H2C371_9CREN/7-520        AC H2C371.1
#=GS M1XTR6_NATM8/8-578        AC M1XTR6.1
#=GS A0A1Q1FHF1_9EURY/8-625    AC A0A1Q1FHF1.1
#=GS A0A1N6V0P3_9EURY/8-609    AC A0A1N6V0P3.1
#=GS L0HI55_METFS/9-574        AC L0HI55.1
#=GS O27931_METTH/7-596        AC O27931.1
#=GS D2RDY8_ARCPA/6-495        AC D2RDY8.1
#=GS C7NVR6_HALMD/8-610        AC C7NVR6.1
#=GS A0A2A2FH61_9EURY/6-549    AC A0A2A2FH61.1
#=GS A0A2A2HFR4_9EURY/7-596    AC A0A2A2HFR4.1
#=GS F8DDM0_HALXS/6-546        AC F8DDM0.1
#=GS W0JWF4_9EURY/6-546        AC W0JWF4.1
#=GS A0A165ZH79_9EURY/7-609    AC A0A165ZH79.1
#=GS J3JH89_9EURY/8-655        AC J3JH89.1
#=GS A0A1H3CXE5_9EURY/8-627    AC A0A1H3CXE5.1
#=GS W0K0P5_9EURY/8-614        AC W0K0P5.1
A0A1I2MES5_9EURY/8-630               .............................................LAGLSRFIFR...APSWY...ASLAF..ALL.LA.AMAGVAAFDTGTsvrtwrg.............lfflgkdaWEGIFFIG.IP...TVVAV.F.G.T.TG.VDRFVGGK........LTPNRS...SLLAL..VSEVIMVAIVTAAAIVSVLTp..............lgQRFVFDALVLA...........................LASVF.AFRLLV.I.MA.VSQSSILVAA...........VPASIQSLTAAVLLFIYsgalrflsvggplsnay....ltpylsradhapaafsaISPDHFL..ILGMMCGVYA..F.FVYG.F.......IVVVDRPWRRSL.GVSLLDFLGGFIGHVAEG..SREL...ETFFE..DL..GEEAIVPVTVLSFRE.........P..................D.....G.pE...........KARFV.LPMIHPGPMGEIGGGNFP.ERVARR.SEGL..........................AF.PPHATAGHDFNLVTEREVDTIL....DAADDAH.ENID......YGTEAT..ESV......RTESG..E..A....KMLGQGFGD.DALLVSTYAPGFADDVEYAVGLSAAAEARTT..GLDDVLLVDAHNCNNGLDGPdl.ghVTPG....SRRSFDMITAAALTGERL..GEAER........GDVSLGVAWHRT......S-..WTPM.QG.IGPLGIRVSVTE..VN.E.......................QTTAYVLVDGNNMEP.GLR...DELVSELAG..GESpl...................vdVVEVMTTDTHIVNTVK-.....ADNQVGAAL...D........HDELRALVSDLVEEAKAD..CEPV.EAGVAV..ERAE.VTVFGND...R.T....ETL....ASHA....NAVVS.M.GGAFAASVILAAMAVS............................................
A0A2I0QN39_9EURY/5-535               .........................................akka----TKYIKNv.qFPRL-...TILIA..MDL.LI.PLAFSVG-FSN-............................PMFLILFG.IP...SVIAT.F.-.-.--.----VPGG........IKYRQA...EIINF..ISTILECIIFAFGILISKEYg...............iSNIVYISLAVA...........................ISFTF.AARIVI.Y.RT.L-KMSLQKAI...........VRSSIRLLITFFFFSFF.....................................kLEDVRFMgeRLVLIVSMFT..L.IVIT.F.......IYLLSKPFEKTI.GINPFDMVFAFANDWVHG..TNTV...ELSLM..KG..SEDGRVVVHIINFTD.........K..................H.....G.nL...........KANFI.VPYIHPGPFGNVGSANMP.KIFHES.IEH-..........................SF.TFHGSCTHELNLIKNSDVYAIM....NDIKEEI.SHLT......GRDNET..GLT......EGEYG..K..FisgeKISVLQIDSaEPKKVIFCDGDG--DIDVGIGLACGD-----..-----VFIDLHSSGNDEEI-.....ISAS....TKRGMEIINKAKNLKTTL..KEIES........RKMKLGIAEGTV......QD..----.--.---CDVRVAFFD..LN.E.......................-KFALLLFDSNNMQN.R--...-EILNILRQ.kFNF.......................PIFICTTDSHQRDN---.....GKFMIEI--...-........AKDDVNEVSNLIEKAMND..ASNV.RVKFGK..IERD.VSVMGKE...-.-....YEM....LQAA....NFMTV.L.LKFLLPFLIFITVFF-v...........................................
U1NPU1_9EURY/1-179                   .............................................----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------MMNAASHLGLQL..RDADQ........YPLDVGTAWDRT......P-..WDPA.DG.IGPLGVRVAVFS..VN.E.......................QETGYILIDGNNMEP.GLR...DTIRHRIVE.qGHI......................dQAEIMTTDTHIVNTVE-.....ADNQVGSAI...E........DEQLICLIEELVEKARAD..CEPV.KAGIAV..ERAA.VTVFGND...R.T....ETL....ASHA....NAVVA.M.GGAFAVSVTMAAVAVS............................................
F2L3W8_THEU7/5-528                   ........................................feevy-----SNVFN..eAPSIL...SYILF..TVI.LI.TIIIK---RN--............................--------.AL...YIISF.L.L.F.YL.FFFFVGRR........L-WTRA...-----..GVFKVTSFALGLGALFDLIL.................EKPPLHYLLIS...........................-----.------.-.-S.VVASSMSMSLrc.......kdR-VYLVPMVLTPLYYLY......................................---LHDY..ALATVAAAYA..V.SMPL.L.......KRYLAGRIK---.GGDALCMLNSFLYSSVSA..EGMF...DHVFK..PL..GVRDRGKIHLYLI--.........E..................G.....G..R...........RHLIV.VSDFHPGPFRNVGGGILVeKLVARG.LRSGy........................dVV.FIHGVGSHERDPVSSDDVEKIV....GEIFRVA.SSMRa....eDALRGV..RPQ......RLEVG..D..V....RLTTYSLGVgPPLAIISRVSSASDDVPLDVAQKVDA-----..--KGYVIVDAQNKFDGPLKW.....S---....DEDVSSLQKALDIV-A--..KPESC........REFKVGIGRADS......SL..VDPLrLE.LGAGGVAAVVAE..CD.G.......................QKSLLLIFDGNNMDG.SFY...RELQDRFGK.aYA-.......................LVEAITTDTHASTGMGVg..gsGYRVVGSGI...R........REELFRLVNKAVAAAESS..LGAK.RVAYRE..VEVE.ADVFGPN...-.F....AKI....RSVV....ESYKR.L.GVLMVAYLILAPLLF-a...........................................
A0A135VKC1_9ARCH/10-604              ...........................................tv--RLYSRVWQ...LPSYR...QIVLR..MVL.LV.LTGSLILSVTKGlll......................evfMNYLIILG.IP...VFVGS.G.L.L.YM.IATEEGSP........LDGRRT...AGLVL..FGLIFWISLSAIGGIIDSLRs...............sNVFEIRFSMLG...........................VSIAY.MAFAFL.V.NG.LSDHHPARNT...........TAALMPPVLWIIVELLFapln.............................aalptLPPLWYI..SVSASFIIAS..I.VVHY.I.......YRAVSVPFERDL.GINGPQLLRAFGHDYLAD.nPKPF...EDILT..KI..ATIQDIPVEILLFRD.........D..................A.....G..P...........VACGV.IQYVHPGPFRDIGSSDLP.SVIIEH.IKKKhg......................ipAF.VMHGSCTHQQNLTTKEDYPIVL....AEIDRLI.EATG......VHEFIS..GPH......WYDGG..K..F....KVWSLFVGN.DVLTISTSSPEFTDDISLDVGYDVANMIRERlpQIEGVAVVDAHNCIDDLAVS.....VNPG....DTDAGEYVGAVSGAVFST..INNEK........SRLQIGMHQIIP......DD..ISQS.EG.LGPGGVTATVLN..LS.E.......................REMALISIDGNNMEP.GFR...ENVQSLLKA.qGFD.......................ESEIITTDTHVVNAISLs..srGYPPIGRNK...-........PDETMEHILAASVKARER..IQPV.SAGLGF..GMARnLRTFGER...G.F....DIL....TQDV....AEAAG.I.AKR-------------mgiragsgsillyill............................
B1L6A8_KORCO/16-556                  ...........................................ak--RRSKDLFS...LPGRK...EAIIF..TIA.VI.LLSTFLAYLFKGpl.......................lshKYLILSTI.VP...-LLSF.V.M.T.NG.DADY----........LDSRRS...LWISA..FISLPLVIDSILGSIGI---.................-----------...........................AAFSM.SYTIVF.L.AS.LITWSLGATI...........RSKALPFLLSALFLLIE......................................----PSM..RILLSVLTSF..I.SIYL.F.......KRVLDAITEHAI.GLRGFEAVRALAEIVLAG.rGRII...EEALE..RR..SEEGKVSFDLIVL--.........-..................-.....-..G...........DRSII.ALDVHPGPF-KFGSYDLP.FKVVER.FDKRs........................dTL.FLRRSCSHERNLPSGGVVERLL....DQISLDF.ERAK......-ECCIG..KLF......YERSE..H..F....EVTAQRVCDtILFTVSGHLLRSFEDIPREF-EDILSRIL--..-GEDVSIVDRHDSLLDDWYI....rALPG....TELGDELLDLLIKAGRKA.lSSDCY........SEVSVGFSKSNP......RW..----.RS.LGRGGVRALSIS..LG.G.......................ETVTYLSIDCNNMVP.ELR...SFLDFNSVE..GT-.......................KLIVSTTDTHEALAVRV.....TYNPLGSEC...Egr...idcLMEIADQLKRIVRESMAE..MRKV.KVKYYR..GCLK.LPLIGEE...N.T....ISL....VSLM....GLSSM.A.KGLLALSLIPQILI--ff..........................................
A0A1F3BDB8_9ARCH/12-580              ..........................................tka---YYNLIRRv.aFPRS-...--TGI..IVV.AS.FLFATFGIGISFviaqraa..............fsflmggFWGIIILV.IP...SFASD.A.V.L.YV.TV--MR-Kd.....plFYFRRC...IAFSL..FTITIWVLVFILSSVLALAVp...............gFVFPDFAVIVG...........................LFAVM.PLRSIA.V.FS.MSKTNFAERT...........LFTVLEPSLTAFLVVLFf...................................dlSLGRVMV..AWVLSSVLGL..T.LAFA.L.......ISVIEVQGRKVI.GFSPIRMFRAFLTDWLEA.kNGDL...ESYLN..EL..GVETEIDVAAFSFRR.........I..................S.....DrnV...........KAVML.VSNLHPGPFLNIGSSVLP.FLFHAI.VQRKla......................avGV.VPHGVSGHEFNLVSQEQNARVI....AWVLAKL.DSCD......YIGKAT..PVR......RAVNE..I..A....TATSQVFDG.CALVTMTTSPYDMEDVPSEVANRLTGFTQGK..-FQHVAFIDAHNCLTGPTTM.....S---....PEKIGALEDAALSTLGAA..SQDEG........GPLKVGVARIVP......RE..FTLK.DG.FGPGGIAVIAVE..VN.G.......................HRFAYITIDGNNMVK.GLR...EDILEAAKQ.vGYE.......................DAEVMTTDTHMVNGIVSa..plGYHLIGEVV...P........KDMLLKEIADVCRRAMAD..LEPG.EVGVVS..GQIP.VTTLGSK...S.L....RRV....MKLV....-----.-.----------------yr..........................................
M0FMK9_9EURY/6-553                   ..........................................vda---FQRLVFS...VPGLR...VQAAA..LVV.LS.AVYGVGTFGALWlftpfa...............pdpsrivPVAVLVFL.IP...FVAAA.E.L.F.PR.VLDG----........YPRSWS...YFLAL..TNQFVLSVYALVLSGANDV-.................GNAWSIIWLSF...........................ITLYL.INILVL.V.VS.TGIDRSDRIL...........LVSLTEPGLLIAAFYALggs................................efgFSTYRHV..FAFASLLIAA..G.FLVL.V.......LVVVDYLIKSNT.DVSAFALTSGLL----RN.dRESL...-----..DL..GVEARPFVETLAVDN.........G..................-.....-..D...........RLTLA.APWVHPGPLGGFGGGQLSgNLIDAL.NDGDd........................aGF.FLHVPCTHKEDLSDPADAERIL....DAVAEPD.----......PTDRAS..RLVtadygdREGYG..D..I....RFRGRRIGD.--KEVIVLHGEGIDDYDTGVFMRDVDH----..--DEVLLIDQHRHDIQNGPDv...eIQYG....SERADRLKRAFDDFRGRL..AEAPL........SEYAAGFALADS......D-..----.--.---QHALAFVEE..VD.G.......................EETLWIGVDTNGLTP.DVRataDEYREEFD-..---.......................AVIPFSTDTHASIH-E-.....------LAN...A........RESDVDAIERAVDRAVDD..LAPA.TVGLAS..RRTEpVKLLKND...-.Y....NGL....VFSV....NILIR.L.TIIALVALYALLVL--wl..........................................
A0A151BIQ0_9ARCH/1-246               ..........................................fgg----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....--------K.CALLTLTLAPETMEDLPLELDEAIMEEANAV..GLKSAVSIDAHNSIDGPFD-.....V---....SEASRLLKKAAKDALLEA..SRREA........HPFKVGASKVIP......SE..FGIM.EG.MGPGGITAIVVE..VD.G.......................KRAAYITIDGNNMIS.NLR...ERILSRLRG.mGVE.......................YGEVMTTDTHMVNGVVMv..drGYHPIGEVM...D........HERLFQYIEDSVRDALDN..MEPA.EVFWCV..EVIPgVKVIGER...Q.I....EDL....SAVV....DAVSQ.R.TKRSAAVIVPFLAA--ilt.........................................
A4WN84_PYRAR/4-532                   .............................................FEKGYSILFG..rSPR-R...VALYA..TAL.LA.FLAALKALSAQR............................-----APL.LY...ALFGG.V.I.L.LI.LLSADRAV........INPRRS...YYVAV..ISTLVVSFFDLLFQKAPL--.................----------T...........................FALVGaVITAVV.L.QS.LKCRS-FWYI...........APLVAVSAIYYAVGELY......................................-------..-LFAISLLYI..S.VLQL.T.......RFVINKMVR---.GLDAMCMFSSFIYSVFAE..DDVL...EDAFR..EL..GRLERVPLHVFII--.........-..................-.....G..G...........RHVVV.VSDFHPGPFRHIGGGMLV.DELQKA.VEGMg.......................ysFT.FLHGVGSHERDPVDGESLRRIV....NAVKTVL.AYGRn....gAPPRGI..YPQ......SHIVG..D..V....KVVGLSLGApPYLAVVSRVNSASDDIPTWV-SRLVD-----..-TGAYILIDAQNKFDGAVQW.....R---....EVDVASLSKGLKAL-Q--..EAPQC........RVFKIGVGKVSA......HH..LDVLgYE.IGPAGISAIVGE..CD.G.......................ARSLLVVFDGNNLHS.ELY...NKIVDTFES.rGYK.......................LVEVVTTDTHRATGIGIg...kGYRIVGERI...D........HGQILKAVEEAVSIAERS..LGDH.NVDYKR..VEVE.AYVLGEE...G.F....RKI....QDAV....RMYKK.V.GVLIAAVVFALPILL-i...........................................
G4RL67_THETK/5-527                   .............................................FEKAYSDLFR..eAPKLL..sYILAV..LIL.LA.MVAKKAP-----............................--------.-V...YLLAF.A.A.L.YA.FYFWTGHKvw....skVGVFQA...TSFSL..GITALFDLLTQRPPLHYV--.................-----------...........................LVAAV.LASSVS.M.AL.RCDSKLYLIP...........IPAV-------SLYYFL......................................---QNDY..ALAGASLAYA..M.ATPL.V.......KTYLSSRVK---.GSDALCMLNSFLYSSVSV..EGMF...DHIFK..PL..GVKDTGKMHLYLMEN.........N..................-.....V..D...........KYLVV.VSEFHPGPFRGIGGGTLV.ERLVTRgLHEGl........................nVL.FMHGVGGHERDPVSNEDVDKIV....EGVFTAA.SSAEv....rPVSEGY..KPK......KIEIN..D..V....KLTSFSLGIgPPLAIISRVRSASDDIPLEVAKRVETN----..---GHVLVDAQNKFEGELRW.....T---....EEDVASLQEALLRA----..SLDSC........SHFAIGFGRHDT......TY..VDPLrLE.LGAGGIGAIISE..CD.G.......................IRSLLIIVDGNNIVS.RLY...EKIVEKYKG.tFD-.......................VVEVVTTDTHASTRAGIg...gGYKAVGSNI...K........HDDILKLIDRAVSSALRN..MGKW.RGTYRS..VEVS.VNVFGEN...-.F....KRI....RSLV....ESYRK.L.SIIMVIYLFVLPLAIS............................................
A0A0W1SJ69_9EURY/8-630               .............................................LAGLSRFIFR...APNWY...TSLGF..ALL.VA.AMAGIAAFDSGDlesswrg.............ifflgrdaWEGIFFIG.IP...TVVAA.F.G.T.TG.VDRFVGGK........LTHNRS...SLLAL..AGEVIIVTFVTVAAIVSVFTg..............lgQRFVFDALVVA...........................LASVF.AFRLLI.I.MA.VSRSSLLIAA...........VPASIQTLTAAALLFVYsgtlrffevggpilday....lmpylarpdrappelsaIALTHFQ..LLAITCVIYS..L.GVYA.F.......LRVVDRPWRRSL.GVSVLDFIRGFIGHVAEG..TREL...EDFFE..QL..GQEAIVPVTVLSFRR.........D..................D.....G.tE...........KARFV.LPMIHPGPMGEIGGGNFP.ERVARR.AEGL..........................AF.PPHATAGHDFNLVTEREVDVVL....DAADAAY.EDIE......YTAEAT..ESV......RVESG..D..A....KMLGQGFGD.DAVLVSTYAPMFADDVEYAVGLSAAAEARTT..GLENVLLVDAHNCNNGLQGAdl.ghVTPG....SKRSFDMISAAGLAGEHL..GTSSR........GTLTLGTAWDQT......E-..WVPR.EG.IGPLGIRVAVTE..VN.D.......................QVTAYVLVDGNNMEP.GLR...DYIVDTLTD.gPDAl....................adVAEVMTTDTHIVNTVE-.....AENQVGAAI...D........HDELLATVTDLVETAVAD..QEPV.TAGMAT..QRAE.VTIFGND...R.T....ETL....ASHA....NAVVS.M.GGALALAVILASMAVS............................................
A0A166FL64_9EURY/7-599               .............................................VAGLSKYIRT...FPKTG...ISIFS..MIF.IS.FIAGTLIFLINHmgnltlf..............ekilyggAFGFGVFG.IS...SISSG.A.L.M.QQ.FINSMKGI.......nLKTKHS...MLLSL..ISMIIIVIISIIGSLISTIF................kLDLFVNSVVFG...........................CVLIF.ALLIFV.L.WS.TSSIGLIKSA...........IVSSIQPLLVISMLIVVnvlgsa..........................eqafefGIISLFI..KLITANLIFL..L.AIYS.F.......VKVIESPLKRNL.GVGLLELLSLFISHLGDG..SSSL...EHIFE..DI..GEPIDTLVGTVSFKS.........M..................K.....DdtI...........KALFI.SPCVHPGPIGEIGGSNMP.TILADR.FDTF..........................TM.VAHGPSTHDFNPVSQKEIDKVE....LAVNKGL.ADMN......YDNKAS..KFV......RYCEE..N..A....KVGVQFFND.GMVLLNTFAPNGSDDIEFGVGLSLMTQSKKH.cNVNNSIVIDCHNSFNEEKGR.....VLPG....NPEVFQILDAIDKI-K--..CVKAE........ETVKIGCNYDPM......ET..LDKS.NG.IGESGLKSMVIE..VE.N.......................QKTAYVLLDSNNMEI.GFR...ERIFKEVEN..LNI......................dEIEVMTTDTHSVNTLSN.....GYNPVGVTN...-........KEEIIEYIIKSINNAIDD..LEPV.KVGCSV..NRIEgLNTFGPN...N.S....VEL....VSTI....SSIVA.V.SRIVAPLIFILAILL-v...........................................
A0A1Q7MI77_9CREN/16-604              .....................................fnfirrvg----------...FPSTP...EVLSV..LLT.LA.VLASILALPLAGigl.....................qaalLFPLIVVV.IP...SILGE.A.A.N.ST.VLLHGEKV........LNFRRL...IGLEI..LSWFLIIMVLPLGAFAGTIVs...............iTTLWAAGFFVV...........................LIVSL.PIRFLT.I.AS.VSSVSPGRKF...........AASALTPSLVILSFSGIgfgagl..........................sgisstVMIRGIA..AFAVGVVLSA..V.GVSM.I.......IRNVERSGTPEV.RDSPLTLFRAFLQHWLRS.dPEPL...ENRLG..PL..GTQGTIEGSILAFSG.........S..................K.....G..A...........LGCVV.ASNFHPGPYRDLGSAGLP.SLLKAS.LERSkg......................giVQ.VPHGISNHQLNIVSQQDVQRVI....EKVVAEY.PVGN......PVHDAS..AMV......RSAVD..E..A....KASGQLFGD.VAFLTLTLSPTEMEDLPSEVARDIEREAHAR..-GLTALVADAHNSLSNQTSI.....T---....SEQARKLVEASVKVLDQL..ALARK........SSFKVGSAADPL......EE..FRLE.DG.IGPGGLSSLVVR..SG.N.......................QIVAYLTIDGNNMHS.GMR...EAILKDLEI.vGIS.......................DGEVMTTDTHLVTGLVRs..tlGYYPVGAHL...D........VGLLTRKVRETVQRALST..MEDS.TAGFSR..FSIE.VRVLGSE...T.F....HTI....TGFV....GRIAR.R.IARQFYILEAL-----tlvatl......................................
A0A1Q7MLV1_9CREN/17-605              .............................nfirrvgfpstpevls----------...-----...VFLTL..TVL.AS.VLALPLA----Gvsl.....................qaaiLFPLIGVV.IP...TLVGE.A.L.T.SA.LILRGDKV........LNFRRL...VGMEL..LSWFLLVVALPLGAVTGMVFs...............nPGLWVYGFFTV...........................LIVSL.PIRFLA.I.GS.ISSVQSWRKS...........LASALPPILAIISFLVFgssvg...........................lsnapsILVRGII..AFVVGMVLSA..V.GVSG.I.......IRNVEHSGTPEV.RDSPLTLFRAFLQHWLKS.dPEPL...EKRLG..EL..GTQGTIEGSILGFSG.........T..................K.....G..A...........VGCIV.VSNFHPGPYRDLGSGGLP.SRLKAS.IERSkg......................giAQ.VPHGISNHQLNIVSQVDVQRVI....ERALEEY.PAAT......SIQDSS..AMV......RSTVD..E..A....KASGQVFGN.VAFLTLTLSPTEMEDLPSEVAVEIERAAQAR..-GLTAIVADAHNSLSNQTSI.....T---....SEQAQKLVEASVKVLDQL..VLARK........SPFEAGSAADTL......EE..FRLE.DG.IGPGGLSSLVVR..NG.N.......................QIVAYLTIDGNNMHT.GVR...DAILEDLET.iGVA.......................DGEIMTTDTHLVTGLVRs..tlGYHPVGAHM...D........VGLLKQKVRETVQRAILS..MEES.TAGFSK..FSIE.VRVLGSE...T.F....QTI....TSFV....GRIAR.R.IGRQFF----------rlealtlvatlii...............................
M0CXE7_9EURY/8-637                   .............................................LAGLSRYIFR...APSWY...TSLAF..ALL.IA.AMAGVAAFDSGAsvgtwrg.............lfflgkdaWEGIFFIG.VP...TVIAA.F.G.T.SG.VDRFVGGT........LTPNRS...SLLAL..VCEILIVAIVMLAAIVSVFTg..............lgQRFIFDALVVA...........................LASTF.AFRLLV.I.MA.VSRSSLLVAA...........VPASLQTAAAAVLLFIYsgtltflsvggpilday....llpylsradqapaalsyIGPNHFL..LLGLTCAIYA..L.GVYV.F.......VAVVDRPWRRSL.GVSMLDFLRGFIGHIAEG..SREL...EEFFE..QL..GEEAIVPVTVLSFRT.........A..................D.....E..E...........KARFI.LPMIHPGPMGEIGGGNFP.ERVAAR.SEGL..........................AF.PPHATAGHDFNLVTEREVDTIL....EAADAAH.DRIE......YGSEAT..QSV......HTSSG..E..A....KMLGQAFGD.DAVLVSTYAPSFADDVDYAVGLSASAEARTT..GLDDVLLVDAHNSNDGLSGPdl.ghVTPG....SKRSFDMITAAGRAGETL..ADAPR........DDLSMGVAWEAT......P-..WTPA.EG.IGPLGIRVAVTE..VD.G.......................QATAYVLVDGNNMEP.GLR...DAIVSDLTE.aGESdsalg............ddslldVAEAMTTDTHIVNTVK-.....ADNQVGAAL...D........KTELRERIVALTREALAD..VEPV.EAGMAV..ERVE.VTVFGND...R.T....ETL....ASHA....NAVVA.M.GGAFAASIILAAMAVS............................................
D5U045_THEAM/10-553                  ............................................v-GRYYSVLFS...LPHWK..vLASAI..IAI.LF.LAVAFLRYESVP............................--------.--...FIVNT.V.V.T.IT.ILEIYRRVvrn..tvfHKLKRR...VGLAF..TTLVYSLI------------.................YYVIFGDWRVS...........................IISTA.IMLTIV.I.QG.LDGTRWWRYI...........-VAIIPPLLTLLFIDEV.....................................aFEFPSTY..ILLLSLCFLL..I.VLLD.L.......AIFIVIGRHRIN.GFKAPDLGSLFLRNWLNA..DREI...ERVFD..GL..GVYQNVTSYVFRT--.........-..................-.....-..N...........NFALI.YTDLHYGPFSNTGSSQLP.MIIRSI.YSKLg.......................ldVY.LLHGFGSHDRNIASSKYVKDYL....TRLETNIfDDCR......EQLKYH..GSF......KVSSR..S.yW....EITGIVFDK.LSLLIVSRPVKGIDDLPYELQVEYALKAKEL..SIGELILIDAHNWEKQD---.....----....EMDFEELRRTLEESLVLI.kKLRSR........TPEKPLVKHHCF......KT..----.SA.PGLIEGEACLLQ..IW.Ss....................nyEKVVLLLLRGNNMEP.GLR...EDLAGLLRK.sLGEe.....................vIVEVLTNDEHSETGIRAn...iTYIPVHNSE...S........FKKDLEAQL----ERFKT..IDPVeKLCVSK..MNLN.VKLLGDS...A.F....QLE....QLVR....KSYVE.S.ALLLIAYAFLTPILL-k...........................................
Q4JA34_SULAC/7-521                   ............................................a-RKYYSKLKR...LPSFR..iVFSIF..AIE.FA.LL----------............................LVRSLEFG.IL...YIIPF.L.I.Y.LL.CVLLI--V........REIKLS...IFLGL..LTEFVYLIFSLFTSQTV---.................-----------...........................FAFGI.LAPFFG.Y.LM.LGKLSELKST...........LSVFVTSFLPSLISGLN......................................------Y..YVLLYSLIIA..V.VFHF.Y.......IHIVNVKGERIT.GFKSLTLLRPFLMSVMRN.dNKLV...EKFLD..GV..GTKIVTNVGMFKI--.........-..................-.....-..G...........NHHFI.IPKIHYGLNGEIGSSKFI.YQLESI.IPN-..........................VI.VFHGPGDHELDLVTSSESRRVA....DFIGNEI.KDGK......WLSQKF..YGI......HVWYN..C.gF....RGVTLVFSD.STLTFLERPGLGIDDLPVKLWENSVKY----..---NDYIIDCHNEYLQEELP.....----....LNSRECIMQGINYAKNVL.rERRVE........RALKIAIEERTI......SN..--P-.EG.LCSNKIKVAALS..DG.N.......................TTVGIVYLYANNADP.SLT...KSLRESLGK.yVN-.......................IPLLITPDDHSCTGSE-.....----LGNLY...Tpa....qfSPELPSLAEKTLNDALNK..LQDC.EVGFNR..LDLKgVKVIGK-...I.I....SSF....VVAL....EEIGG.Y.VMKTFWIPLVLPLFL-a...........................................
T0M368_9EURY/11-569                  .............................................FSDLSKFVKR...SPRWY...-TIIW..LTV.VI.LAFDYFLLRNI-............................YLVIIGVL.GS...YLLVI.G.I.D.ML.FVKIAQVY........FPARRI...LFLDF..LSLLIASIFFWAVYFSRIFS.................--NPEIMLMVS...........................ISSAT.LLRVLI.F.YT.YYSDRPLKFI...........PPTLNYTFAAMVALSII.....................................fREWLTII..PFVVSSVIYI..A.CGVI.F.......VKSSTRGFAREY.GESPARIIKMFLNYNNEE.vSQEV..gNNFFG..RL.yRHVRRVPVKVMDIRR.........V..................A.....DgsR...........LTTLV.FPYVHPGPFGTLGSSDLP.KRLQTR.LSDLg.......................tdLM.VFHTTTTNSNNCSGDDDIDEIA....TAIRTSL.QDMD......YVRLMS..RFK......KINVG..K..Y....VIGMQRFGD.FGLGAIIPEREPFDDVKLKEGLKIIHHVERS..TLKEFAAIDAQNFFTEKALE.....----....LDACDGMEKAFERELK--..RLESK........YPSRIGYYRIYE......PL..----.PE.LGSMGVQALVTE..IQ.G.......................KYQATVLTDSNNVTR.EVI...EAARKRTAD.rIA-.......................SLEIYTTDNHYVNASNL.....DVNPLGKDG...N........IDDIVGLIAHTVEKAMES..VTDV.EVGMKT..VNVK.VRMGDEN...T.Y....QRL....IDSV....FDSLR.R.AKYTIIITIPSSIIA-s...........................................
B8GH28_METPE/9-570                   .............................................IARLTKYLFT...APSWR...RSLFI..IVL.LG.LIVDGASIRLGAh.........................gqFLGTLAFT.LP...ALVAT.L.L.T.KP.LINRLGKQ........ITWNRS...ALLAM..ACTVFCVIITLCSALAS---.................FNLVPLLFACG...........................LGFIF.AIRLLV.L.VA.IADYRVPRMV...........VPALIQPAVGVIVGTLW......................................FSQPFFL..FSVVLVLVFG..L.GCVA.L.......IWLIERPLYKAF.HIKGLNFINAFIAHNTDG..SRSM...EDFFR..EI..GEEVYVPQVSLFFKR.........N..................E.....K..N...........GVIMT.VPNVHPGPMGEIGGGNLP.KVMTRS.FTET..........................VL.VPHGCATHDFNLVSESEVSKLV....DAVKATQ.AGLE......YEGRAS..IAY......RVTFG..S..V....DLMYQRFGE.TILIVSTRSPAKTEDLDFPLGLAIMAEGRRV..-YKHVVFIDGHNCMTEITSP.....VMAG....SLIATEYLRAVRTAVEAA..AKVPQ........RMVKVGVAEVPI......P-..FTRE.QG.FGDLGVQVLVVE..VD.D.......................QQTAYVLLDGNNIEA.GVR...EVIRDAVLE.iVD-.......................EAEVMTTDSHVVNTIT-.....GKNPIGLNV...P........VAEFLPFILRGVDEAIAD..LSTA.EVAAST..ACCEqVVVFGSN...R.I....AQL....ACTV....NAMLV.Y.IAPLSFAILLLAFLLS............................................
A0A2A3T7N7_9ARCH/11-579              ........................hnrfsltlvnpsshyfslvgs----------...-----...LSVAL..VIV.LS.TYLGYLNNLS--............................-INEMLFR.IP...AVIGVlV.V.L.QL.LDKRFSKK........KEYSKS...LHSSL..FGNMLWVLTLLLGLLASVVL................sKEISVFFITFG...........................MILFA.SFRIGI.Y.TT.VLGASLKKAL...........AICFIQPLVMFLVLIPQd...................................mwFSMLTDP..IALGYGISFL..I.IACS.W.......SLVTDRAGRPGM.-KSTHKTIQAYLASQGND..FDDA...EKLME..ER..SSETSVTTSQLRLSS.........P..................N.....G.eK...........EFRMV.LPEIHPGPYHPVGGSNIP.YLIYKN.YSSS..........................AM.VMHSISDHALNLPSRNEVKNYL....KNLENST.IKEE......-GLKCT..EPV......IVQIN..K..A....RVTGVLFGN.NPLLLLSLSPHGMEDIPNYMKTEIKQYGKNR..NYARMMIVDCHNAMGEEIS-.....----....KEDGEDMLKAVKSCLDTL..ITKDS........FPIEFGYENSDD......MD..VWA-.ED.LGMGGIGVVCLK..IN.E.......................KKYFLGWADANNMEN.GIR...EKIISNFSK.eGYQ.......................LLEICTSDTHYAAVKPRn..rnGYYQLGLIT...N........ADKLSKWFLEIAKKXETT..TTSA.KFEILE..NETT.VKVMGKG...I.Y....EDY....SKAL....DKSLK.I.TKIFVLGCVLLFV---ssl.........................................
A0A151BRJ1_9ARCH/20-604              ...........................................vs---RYSSLFT...LPSAA...KNYVL..LSI.QC.MMTGLLIYAFYLpspq...................glmigVGSGIILL.IV...TLLSN.Y.V.S.C-.-------RwilrgdliLDFRRT...SFLSL..ISNSIMSAYIFLDLIIYGAYk...............tPHVEFKATTIG...........................VFCSL.ALRTLV.F.QS.VSFLSPWRIG...........ASILLQPSLFLASLFAPqlip..............................heplG--DVLV..RLSISSIAAF..L.SIHL.L.......FRALNSIGLRTV.GIPSLKLLRAFLANWTEG.iVEPI...EEAFQ..RL..SEKRDVKVSMVAFRC.........K..................S.....G..M...........KAIIV.VPSIHPGPFKNVGSSCIP.SMIQEA.LEKKyg......................cvVS.VPHGISGHEMDLASQSENMKVL....NGILKAD.-FSE......FNDQAS..PLL......RIMRD..G..V....SVNCQRFGD.SAIVILTLAPNTMEDLPYELRGMIEKAAEEE..GLAPVLAVDAHNSISGYFDA.....----....ERVKEPALNAAISALKRI..SKASR........FKFEVGAAKVVP......SE..FRIQ.DG.MGPGGIGVIVVG..VK.D.......................QKAAYITIDGNNMVS.GLR...EKILSEIRA.lGVD.......................EGEVMTTDTHAVNAVVMn..dmGYHPVGEAI...S........HEDLIRHIKEGVKEALRG..MEPA.EASYCE..MTIPdVKIVGEA...Q.I....DNL....CMIV....DEVSR.S.AKRTSAILFPVFIAL-l...........................................
Q0W080_METAR/5-573                   .............................................LASYADYIFE...APDWK...LSFAA..IVL.LA.VIVGAVSFPGSWka........................dvFQGIVLLG.VP...AVLAA.I.V.T.KP.ISEVFGRN........MTYNRS...MLIAL..ISLVVVCVASLIMGLYSYVT................sTPYNYTGLALS...........................MSLIF.ALRILI.L.LG.ISINSLPKVL...........IPASIQTLLGGVLLVYY.....................................vKDFEVAF..DLMVSSVIFV..S.AAVV.F.......VKYVDYPMVKSF.GVSSFDFVQDFIAHITEG..SQDM...EDFFE..KI..GESIDAPVSVVAFKR.........A..................D.....G.tN...........KAIII.TPYVHPGPMGEIGGGNLP.AVIAAA.FPGN.........................vVL.VPHGTASHDFNPVTTEESVKVI....DAAKKAL.ARIT......YTETAT..KSI......RKSVG..D..C....NVLGQRFGD.SVFLVSTRAPMTTDDIEFSVGFTAMAEARVA..GSRYATIIDAHNCMEPLATP.....IEPG....TRDSYNIIRAAANTSKHL..LSSNV........DKLRVGVASSPP......I-..CTRL.EG.MGDLGICVAIVE..TQ.G.......................QRTAYIVIDGNNMIT.GLR...EKIIEKLP-..VD-.......................EAEVMTTDTHVVNTLS-.....GVNYVGQNL...D........CDVLIAKIAELVDKAISD..LEPV.SVGMEI..EIAEdIRVFGSH...K.I....AKL....ASTA....NAMVA.M.AGAFAAAVIVAALSL-t...........................................
A0A1D2W537_9EURY/7-598               ...........................................lv--SLTKYIMT...LPPTR...ISLFS..MVF.LS.FIIGCIAFLLAPsandsil..............ysivyggSTGFLIFG.LM...SIMGG.G.L.T.QP.MVNSFKGR.......hMKMKQS...MFLAL..ASMMIVGVIYLIGSVVSVFT................vNNYVLNALIFG...........................CVIAF.AFRTLV.I.WG.TSNISLLKSV...........VISVVQPALILSMLVVIsfltsv.........................ttnmgdfSIIAIVV..KIVIASVILV..I.AIYS.F.......VTVIESPMRKNL.GVGGLELLSLALAHITEG..SPAM...ETLFE..DI..GEPIDTLTGILSFKG.........K..................N.....G..I...........KSIFL.SPCVHPGPLGNIGGGNMP.TILSSK.FDTF..........................TM.VSHGPSTHDFNPVASKEINKIE....KVVKEAL.EDMD......YSESAS..KFF......RVENE..G..A....VIGAQYFDK.GLLMLATFAPDGFDDIDFGVGLALMNLAKAS.cDAQNVVLVDCHNSFKGEGGR.....VLPG....NKEVFELMGAVEKL-K--..SPEQE........NGIKVGCSSDPL......DN..ISKE.DG.VGQSGVKVMVIE..VG.S.......................QKTAYILLDANNMVI.GFR...GVILEKVKS.lGLD.......................HAEVMTTDTHFVNTMSG.....GHNPLGTKM...-........QDEIINGILKCTKEALND..LEDV.SVGCKV..ANIKdIKTFGPL...N.A....TEL....VTTI....SSIVA.V.SRIFAPLVFLLALLF-v...........................................
D3RYE6_FERPA/7-525                   .............................................LEKFYTKVFS...VPRKR...ITVSI..ALV.TI.VIASYLNGTSSKi.........................ffVERYFFVG.LS...ILISL.M.L.V.SR.FLVSA---........FNSRRL...FFLAL..FFLIFTEFFDFLAVQTG---.................---NEEIIVVA...........................PASSA.FIISTV.L.FF.TSKRFSF-FA...........PLAILLLVYPAAFLFSY......................................QANHRFL..AYLITSLAGI..G.MSFL.F.......LKYLDKKFGR--.-VEILPLLKKFLWYWLTN.eEDEL...EREFE..KY..SKEFEGKYAKVKI--.........-..................-.....-..G...........DVVLH.AANVHPGPLRNLGGSKLV.KKVMTK.K--K..........................NV.FLHAASMHSENPISVKELEKLV....D-----K.ENYE......-EVKAK..KPY......RIEGK..R..F....WVKVYPFSD.-FSLVIVHGKNYMDDLPFEL--QAVA---EK..VYGNCVLIDSHSCYGKELG-.....----....VEDILEIEELFKA-----..KESEE........AELSYHYDELFV......ET..----.ES.ICS-KVAVLLLN..YS.G.......................EKHAIVVFDSNNVSC.HVR...NEVLKIFEE.rGY-.......................DADVLSTDNHEKTGVSPr...kSYKAVGEEE...-........-KFLLEFFKKVLEEA--S..FEKA.HPQVMV..EKFR.VKVMGRE...F.F....EDL....ERAF....KEIGE.K.AMYLFFFLMFLNPL--la..........................................
H1Z3E5_9EURY/9-579                   .............................................LEGLSRLIVT...PQDWK...KSVLF..IVL.AG.ICIDLLGYAGIFtmkse..................nfvlpFFGIACFT.LP...GIFSV.F.M.T.NF.LLSSYGRK........ISRDWS...ALLSA..LCVGVSIIFSFLPLTIF---.................WDDLEFFFAIS...........................IAAVF.SLRIIT.L.LV.LADSRFSHVF...........FPAFSQSLFAGFTGTIF......................................FPDEFFI..FTFLLQLFFG..G.GMFL.I.......VWLIERPLKINF.GVSALGMANAFMAHVNDG..SKAL...DAIFT..EL..GEEVFVPQVTLFFKR.........E..................G.....K..D...........EIIFT.VPNVHPGPLGEIGGSNLP.FQLNAL.LGRD..........................TL.VPHGAATHDFNPVSPDEILKIA....DAVESTR.KDLV......FSGKAS..RMV......HFDEK..P..V....HATAQVFGD.SLLIIASRSPEVTDDLDFSVGLAIMEGGRRY..-FKNTAFVDGHNSMKDIAPA.....VHSG....SRKAIEYMRTAEVASGSM..HGMDT........FSFETGIFTVKL......P-..FGRE.RG.FGDLGVQAFAVR..SG.G.......................EISVYLLFDGNNMVS.GLR...ERIIDLVVG.eTDA......................gACEVMTTDTHVVNIIS-.....GKNPVGGAV...P........LEDFSDYILDAVRGATDD..LAPS.EVAVST..AWCDgVRVFGSH...K.I....SQL....ASSA....GAMIG.L.LIPVAVIILFLSLLT-t...........................................
A0A256HAQ4_9EURY/6-547               .........................................vdvf----QRLVFS...VPPLK...VQIPA..LVG.LS.GVYSLLAFVAFSmftpls...............papssvlPVAVLLFL.LP...FLFAG.E.L.F.HR.LLPS----........YPRSWS...FFLAA..VNQFVLFVYSLVLSGANDV-.................GNVWSIVWLLF...........................ITIYL.INILAL.V.VS.TGIDRYKRIL...........LVSLAEPAALIAAFYAFagg................................dlgFSTYRHV..FAFASLLIAA..A.FLVS.V.......LALVDYLIRSNT.DVSAFALTSGIL----RN.dRESL...-----..DL..GVEAEPVVETLAIDN.........G..................-.....-..R...........RLTLA.APWVHPGPLGGFGGGQLSgNVIEAL.NEGEs........................hGF.FLHVPCTHKEDLSNPTDARKIL....DAVADPD.----......GVGRAS..RLV......HEDYG..E..V....EFYGRRIGD.--KQVVYLHSEGIDDYDTGVFMRDVDE----..--SEVLLVDLHKHDIQDGPTk...eVQYG....SSEADRLKDRFDDFRERL..AEESL........HGYAAGFAVERT......--..----.--.--DQDMIAVVET..VD.G.......................QDVLTIGIDTNGVTP.DIR...E-MEDRYGE.aFD-.......................EVLVFSTDTHASIY-E-.....------LAN...M........KQSNVDALEAAIERALDD..VSPA.TVGLES..RKTDpLKLLKND...-.Y....NGL....VFSV....NILIR.L.TVIALLTLYALLVL--wl..........................................
A0A256Z5H1_9CREN/7-466               ............................................t-RKYYRRLHI...LPRTN...VLIIT..YAL.LI.IILSLINSDNIL...........................sLNSVIANL.FN...YSIIG.L.L.L.PI.LYSILAVSr......lFNLRRV...IGLSL..AVMIASLPAEIVFYRLIG--.................----LRGTGIV...........................AISGF.IFIILS.V.FI.NPIVAVPLAT...........LPTLAVFYVINELIMES......................................FRGDLVL..TALTIQMISI..T.VGLT.Y.......IVFLENLGKD-Y.GYSPIRIMRAFINTWLTG.nPLRL...ENEFG..KY..TMIDDLKVKVIMIER.........E..................G.....A..E...........DIALI.FPTLHYGPFRNVGSARFI.YHLQSL.LEPRi........................kPF.IFHTPGSHEHNLVSSDDSERIA....KLIHNAI.NDTYk...yeCKLNMC..KPY......RVKLS..N.gW....ESFTLNGPT.FIALFLVNKRIGNDDLPYELWNLIESTGGDK.kELLIKAIADSHSFKGPK---.....----....VSDVSEVKNLIFEVMRNH..SCSKG........EEFYVGYGEGIA......S-..ISEC.RG.LCDGLVRALTIK..FN.D......................gSRYALVYIYGNNMDG.KFR...RKLEK----..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------liw.........................................
A0A109UUY0_9EURY/7-596               .............................................VAGLSKYITT...LPETK...YSIIG..MSI.LS.FLIGSTIYLIDLnpigil...............eeifyggIYGFLVLG.IT...SIMSG.A.L.N.QQ.VISSLHGI.......nLKIKHS...MFLSG..LSMTILGIIIILGCVITQIF................kFDIYLNSILFG...........................CVIIY.GFNTLV.F.WA.TSKVRFTIAA...........TAGLIQPALILAMLTLItflfid.........................tsfigseI-LQITF..KAIVAAIIFV..M.AIYA.F.......IKIIASPFSKNL.GIGVLDLLSLFIAHMNEG..SNSL...EGLFE..NM..SEAIDTIVTFVSFKT.........E..................N.....G..I...........KALFI.SPSVHPGPLGDLGGSNMP.TILANK.FDHF..........................TM.VAHGPSTHDFNPIAVSEIDKIE....QSVRNGL.EQVE......YSPIAS..RFV......RYNSE..K..A....NIGVQFFND.GMVILSTFAPEAVDDIEFGVGLTMMAQSRSK.cNVENSIIVDCHNSFTPESGE.....VLPG....NSEVFQLIDVIDTI-N--..PNQDK........FDIKVGCYEDNM......KT..LGKH.EG.IGESGLKTMVIE..VG.N.......................QRTAYVLFDSNNMEI.GFR...QQIIDSVND..LDI......................dEIEVMTTDTHTVNTLSR.....GYNPIGIAK...-........RPEIIEYVRLSIVEAIKD..LEKV.EVGTGT..EKIKnLNTFGPK...N.S....TEL....ISTI....SSVVA.V.SKIIAPVLLITALLI-v...........................................
A0A2A3T0Q7_9EURY/15-581              ............................................a--RLTGFLYH...TPDVM...PSLLL..FLA.TT.MLLVYSGLKTLDraea...................pidfgIFAIITFS.IP...VILVS.Y.L.V.SH.ISWIWDGR........YPVRYG...LQAGA..TGSLLMLITIAIGDYFG---.................E--PSKGLAFG...........................FGCMG.GLWYLT.L.RT.HGSAPARIAF...........PLSLISPFISVYYFWYG......................................ESMSEFN..FGLLATIALA..F.ASHF.F.......LFLIDSPYKKAV.GVSGTRHMSAFIDHFSTG.nGRRL...TEAIR..EI..CQTFETKNGWISIRK.........K..................G.....E..T...........VAFLA.IPGIHPGPLGELGGSNLP.VKIDPV.LPGL..........................GF.AFHGATTNDHNPLRDEDITRIG....KVMVNAS.ESGD......YSDYSS..-AM......VMEGD..T..P....SAYAIGIGN.--GTIIFVKPGDSDDILPELAARLERPSSNP..-EGVRLMVDLHNQEGWGRSP.....LAAG....TKEGAMLEISAFKALKLS..QSLTK........GKLMVGISNMPG......ED..LG--.RG.IGPGGLRVLVIE..IA.Sssd................tqqgQRTAIMLWDANGFAP.GMN...KELQDGLKG.mAD-.......................SILLASTDNHYVNVKPG.....GYNPLS---...D........SEGILPSAKQALEEAIAD..ISPA.EAAMGT..EYVDgVEILGQG...N.Q....DTI....KAAA....NAVVE.V.ARFSWLPIY-------ssatmic.....................................
L0HK23_METFS/9-594                   ............................................l-GQLTKYIFT...APTWQ...RSLIL..IIL.LG.LIIDGANARAWLslpssgiiafpvp.dllsdlfplpekflFSGTIAFT.IP...AIAAF.V.L.T.KP.IIEWSGKT........MTWNRS...ALLAL..ACTVFAVIITLASIAVS---.................ITHLPLFYAIS...........................LGFIF.GLRLFV.L.VA.IADYRVPWMV...........LPAITQSGIGILAGMLL......................................FSSSFAI..FALVLHLVFG..L.GFAI.L.......IWMIERPLKKAF.KIRGLAFINAFIAHMTDG..SKGM...EDFFR..EI..GEEIFVPQVSFFFRR.........G..................K.....K..K...........SVMFT.VPNLHPGPMGEIGGGNLP.KILHES.MEDE..........................TL.VAHGCATHDFNLVSESESNKVI....AALKESR.TNLA......YSAGTG..RSA......IVTVG..T..V....TVLCQKFGD.SVLLVTTRFPHRTEDVDFSIGSTIMAEGHRW..-FPHVAVVDAHNCMTDLSSP.....VLLA....TLTAQEYQKAAMDAMEVC..RAAPL........HPFRIGVSQVTV......P-..YTRE.QG.FGDLGIQVMLVE..AD.G.......................QKTAYILIDGNNMAA.GVR...EVILKEVRT.lVD-.......................NAEVMTTDSHVVNTIT-.....GKNPIGLNV...Q........VEEFLPHIMQAVRVAIDD..LTPA.ESAAAT..AHCEhIVVFGSN...R.I....SQL....ASTV....NAMLV.F.VAPLSLAMLLLAFLLS............................................
S0AMW1_FERAC/25-582                  .............................................LAGLSRYIKK...SPKW-...YYFLI..PII.AI.FLIDGIILRNL-............................DALSFMSI.LP...FIFFL.L.L.D.AL.TIKLTNKK........FNNNRI...MYLDF..ISLTLVTLFFWIGVLLYPVI.................RMPLYYILALA...........................IAFPA.FLRFLV.L.YI.YYPSNIYLAA...........TLSMNYTFSYIIIALIFyd.................................iskIAIKFII..PLIAATVIYV..L.FSYI.F.......LVFTTIGFTRKY.KSRPSELIDFFL--NRDN..DGAI..gEKFFT..HV.yNKKRQIPVITTNIRK.........E..................N.....R..D...........LVTLV.FPYVHPGPFGNLCTSNLP.VKISSE.MGRD.........................nIM.VFHTATTNSNNCSGKNDIKNIA....ESVKDSI.KKMK......YSDTVS..DFV......KFNVD..G..Y....DVSLQKFGN.SGISAVIPFKKQFDDISIDAGLKVVAALKKN..GAENFALLDAQNSFTRDAKE.....----....LDNCDMIINPLIEKFK--..ATGST........YPAIIGYARNYE......KI..----.DG.LASMGVQVLAIK..IN.D.......................YYNVIVLTDSNNIGR.EVI...KMARSGVDK.rVK-.......................NMDIYTTDNHVVNVSEL.....DINPLGMHC...E........PQVVADLINRTVLQAIED..ASPA.TAGTYT..ENIT.VTMGEEN...A.F....HNL....MEIV....IASLR.K.AKYSIAFILLISILVS............................................
E1RJF9_METP4/9-572                   .............................................IEGLSRYLFI...APSWQ...RSLLF..IFI.MA.FAIDAVSFLKSHe.........................iqLFGFFGYF.LP...ALLAF.I.L.T.IP.LVAIWGKR........ITLNRS...ALLAL..ACTVFSILVSLFPILLIF--.................EGIFPLLYSVS...........................LGLIF.AIRLIV.L.VA.IADYRISRML...........LPASVQSLAAMAAGTYY......................................FGTDFLL..FAIFIHILFG..I.SVFL.F.......LWLIERPLKKNF.HISALNFINAFIAHNTDG..SKAL...EDFFR..DI..GEEVFVPQTSFFFSR.........E..................G.....K..K...........DVMVT.IPNLHPGPMGEIGGGNLP.KILCHS.FDED..........................TM.VPHGCATHDFNLVSEDEIKKIV....SAVNKTR.DEID......YSPYAG..KSQ......RYEYK..S..V....QVLAQQFGD.SILLVTTRSPEMTEDLDYSIGLSIMSEGHRL..-FQDVGFIDGHNCMVDVTSP.....IMPA....SRLAYEYINASVTAMEET.kKENHM........LEFEIGYCHYEM......P-..FSRE.EG.FGDLGMQVLAVR..TD.N.......................QTTAYILFDGNNIEK.GVR...EKIRNRILD.iVD-.......................ECELMTTDTHVVNTMS-.....GKNPVGYRI...N........AEEILPHVLSAVEAAIED..LSPA.RAGATT..AWCEgVVVFGSQ...R.I....SQL....ASTV....NTMLT.F.IAPLGATIVVLAFIFS............................................
A4YEK3_METS5/7-521                   ............................................t-RNYYSKLIR...LPSTE..aLSIWV..GAE.VG.LS----------............................FLRSLSDG.FT...YLTGF.L.V.Y.LS.LSLIS---........LHRRVR...TFLAMagMFGIIYLIISFFPLVIP---.................-----------...........................LSFGL.FIPLMT.Y.VM.LIDYGDFTSP...........GLTTLIGLISALSTFPR......................................----NIE..LVIAFYLIVG..L.FSYL.Y.......LILVNRKGKSVT.GIPSLNIVRPFLKAMSYR.rDEEV...ENFLE..KI..STEFHSSTLVLKL--.........-..................-.....-..G...........DVLLV.LPRIHFGMYGKVGSSLFP.YQLEEL.VNNK..........................VM.VFHGPGSHEIDLASSKESRKLA....QIISSKI.REGN......WKELRF..EGI......KFLSE..D.rF....RMTSLVFDH.ITLNFSERPGYGIDDLPGGLWDESLKTGN--..-----FLVDCHNESLKEEI-.....---G....HRDERALREFVSKK---I..PATEE........RPLLVGYGESEI......NS..--TC.EG.ICSRKVKALIVG..DG.D.......................KKIVIAYVFANNANE.ETG...KLLREKFGN.lYE-.......................KVILVTPDDHSCTGTSF.....-----GNLY...Tpa....epCPQILEALEKAIKNAEAN..LKKV.EASYMI..VDAK.VKVIGK-...F.I....SLM....VEGL....EQVGS.F.AMRTFWIPVIFPYV--al..........................................
B9LN87_HALLT/6-549                   .........................................vdvf----QRLVFS...VPPLS...RQLPA..MVI.LA.VAYSVLAFAAFSaftpls...............pelstllPIAVLLFL.LP...FLFAG.E.L.F.HR.VLPE----........YPRTWS...FFLAL..LNQFVLFVHALVLSGANDV-.................GNAWSIVWLLF...........................ITIYL.INILVL.V.VS.TGIDRYKRIL...........LVALAEPAALIVAFYAFagg................................dlgFTTYRHV..FAFASLLIAA..A.FLVL.V.......LAIVDYLIRSNT.DVSAFELTSGIL----QN.dRASL...-----..DL..GIEAEPAVETLAIDN.........G..................-.....-..D...........QLTLA.APWVHPGPLGGFGGGQLSgNVIDAL.NDGDeg......................dsGF.FLHVPCTHKEDLSNPGDAETIL....DAVADPG.----......RVDRAS..RLV......SHDYG..E..I....EFHGRRIGD.--KQVIFLHGEGIDDYDTGVFMSDVDE----..--SEVLLVDLHKHDLQNGPEk...eVLYG....SSEADLLKRHFDDFRDLL..DDAPL........YDYAAGFAVRRT......--..----.--.--DQDVAAIVES..VD.G.......................QEVLLMGIDTNGITP.DVR...ELA-ADYRE.sFD-.......................EVLVFSTDTHASIH-E-.....------LAN...T........TRSDTESLTEAIEHATDA..VAPA.TIGLTS..RTTRpLKLLKND...-.Y....NGL....VFSV....NILIR.L.TVISLAMLYALLVI--wl..........................................
A0A1Q7LLE6_9CREN/21-605              .....................irrisfpttaqlvsmfctevflpa----------...-----...-----..--A.IA.LPLSGLELATTF............................IIPATVII.LP...SLVGE.L.L.N.AK.VFLRSDAV........LDFRRL...MGVEL..LCWAPLLVLLPLASAAASIFk...............sSVLWTDGLLMT...........................VAISL.PVRFLT.M.FS.MPIAAQWKRF...........TAATLVPALSILAYFYGlsfhh............................iltssALSQTSV..LFLSSVALST..V.GVIG.I.......LRGVDKSGSHRI.GDAPLALFRAFLEHWLEG.eRKPL...ESRLA..LI..GSQANVETSILAFEG.........N..................Q.....T.qS...........RGCII.LSRFHPGPYRNLGSGGLP.SRLKAA.IASYng......................aiAL.IPHSISNHEHNIIAQEDIAQLI....EGTEKAY.PTAV......DVTTAS..RMV......RERVG..D..G....QASAQCFGK.TALITLTLAPRSMEDLPLEVAQSVEATALGK..-GAKTLVIDAHNSLAGPTKI.....S---....QEQAAVLTEVATKDLEVC..MSLPQ........ETFKMGVASDPL......RE..FSLE.DG.IGPGGLSILILQ..VG.D.......................QLAAYVTVDGNNMQT.GFR...EKVLNALKA.lGID.......................DGEVMTTDTHLVTGLVRs..plGYHPVGEQM...R........QELFVERLVATARRAINE..MEPA.SVGYSS..FSLN.LRILGSE...T.F....QSI....TSFV....GGTAR.R.IGRSFLWLEIVVFLA-sl..........................................
A0A256YUI0_9ARCH/9-442               ............................................v-ARRYSSLFT...LPSF-...RSIVS..VFS.VS.CLLGGMSVIPLNptv......................eglILGLLCGA.VL...LASSL.L.V.E.HI.CVGALMRRd.....piFDFRRR...LFLSL..VSSWILLAFTAAASLVAALTr...............dVDVWVKLTSFG...........................FAASS.SLRLLV.L.IS.VSSLKRWRTL...........PPALIQPAALLLVLAAFsvg................................gygLNVRHLL..MAVTSVSVAF..L.GTFL.F.......TFSVDRVGLKSV.GVPSIKLFKAFILNWIKG.iNGPI...ESIFD..SM..SEVKSVKVSVLGFKG.........S..................R.....G..F...........KALIV.VPAIHPGPFKNVGSSAIP.SMIQRV.FEDRfg......................cvVS.VPHGLSGHELDLTSQLENRKVI....EWLLEHV.DLQP......IGSVAT..PFM......QLRRN..G..A....SVGCQIFGGrCALLTLTLAPETMEDLPLELEEAIQEEARKA..GLQSAVPIDAHNSINGDFDV.....----....KRASLILEKAVKDALSEA..LRLEA........YQIRVGAAK---......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------vigvv.......................................
W7KX36_9CREN/8-503                   .............................evlvgvngvewalvva----------...-----...-----..---.--.------------............................--RGIEVG.MD...FALSF.F.A.Y.LF.ALLLV-FR........LKWRTV...AALST..IFSFIYLIFSFFPAYFL---.................-----------...........................YSFGT.FLPLID.Y.PL.LVDYKETKAI...........ILSTSATLFPLLVALTR......................................-----NW..VFYTYVIAVA..L.LTSF.Y.......IYTINRKGLKVI.GISSMNVVRPFIRAINYK.rEAEV...ENFLE..KI..SIPYYVHVYVLKV--.........-..................-.....-..D...........GQKLV.VPEVHYGLYGTVGSSYFP.YDLEEK.VND-..........................ST.AFHGPGSHDIDVPSRKYSLELI....SKVSKAL.DDME......-ENEFY..GIM......FNDFG..S..F....RLTTLSFDK.SSLTFVERPGKGIDDLPTSLWKDMIAS----..---NNFLVDCHNESLVEDFS.....----....KEEISQLKSFVRRR----..REGRR........RPLLFAYSEGSL......DN..--EC.EG.LCSRKVKVFVFG..DG.E.......................KKVAIVYVYGNNASR.ELK...EQVYGKLAG.lVD-.......................RAILVTPDDHSCTGTS-.....----LGNLY...Tps....qpCPSLADLSYKLTLDALSK..IREV.DSSQKV..IKVK.TKVIGK-...I.I....STM....VEGL....EKVGN.Y.TLRTFWIPIASSYV--ll..........................................
G0QGP0_NANS0/6-548                   ............................................l-EIFKKVVFH...LPSFR...KTLGL..SLV.LG.VLYSILTFFFINellida...............isigsipMFAFIFYL.IP...GFSAS.E.V.Y.SL.LLE----D........YPRKWG...YFLSM..VNQLIIFLFTLIVTLSDSFS.................--TSWQIIWFG...........................LITLY.VNNFFVlT.LS.VGPKYIRRIS...........MLSLVQPVMILIGFHFVlgq................................flqISWIAYA..INFLVILGAG..L.VLLL.S.......VYFTEYLVGSNVtNISILNLAAGLL---QNE..QDSL...-----..DL..GRSVRPDVQTLQIKN.........R..................S.....G..-...........VKNFA.LPWIHPGPLEGFGGGKITsSIIDRL.NSEDs........................eGF.FLHVPSNHKMDPSDPDDSAKVI....DALATPD.----......RSSKAS..ELI......SEEYG..D..I....KFYGRRIND.--QMIVYMDHRRFDDYDESIFQERIDK----..--EDIILIDLHNQPKGSRLG....vMRYG....TEEAEKVRKKLDGFLEKL..RNTSV........HDYSAGFS----......--..----.VE.FFDKPVAALVED..VN.G.......................QKTLLFGLEGNDASK.EL-...EELKEEFSD.sFD-.......................ETLLFTTDTHSSIHDLA.....SNR------...-........-QVEKSQVRQTVKNALAD..VSPA.SIGFCS..RKADkMNFLKDD...-.Y....FGL....IYTI....NILIR.L.IPVSLIVIYIALII--wl..........................................
A0A1D3L2V9_9EURY/7-598               ...........................................vv--GLSKYMVS...LPSNN...FSVLS..MLF.IS.FITGAAASLIHPaagdsil..............ysiiyggASGFLMFG.LM...SMMAG.A.M.T.QP.MINALEGR.......hMKMKQS...MFLSL..VSMFIVALIYVVGSLISSFT................vYNYTIDALIFG...........................CAVIF.AIRTIV.L.WS.TSNISLLKSI...........PAAATQPALIISMVIVLvsltsf.........................ttnigyfSIIPLLF..KIIIASLILV..A.AIYS.F.......VTIIESPMKRNL.GVGGLELLSLFLAHTTEG..SKAL...EGIFE..DI..GEAIDTLTGVISFKG.........K..................E.....G..M...........KAVFI.TPGVHPGPVGNIGGGNMP.TEIAES.FDVF..........................TM.VSHGPSTHDFNPVSGREVKKLE....GVVKDSL.KTAS......YAPRAS..KFI......RVQSG..N..A....RIGAQYFND.TLLLLATFAPQGFDDIDFGVGLAVSNLAKAV.tGAENVVLVDCHNSFKGEGGR.....ILPG....NREVFELMEAVEKLP---..KMDKD........QPLRIGCAHNPL......VE..ISKD.DG.VGQSGLKVMVVE..VG.G.......................ERTAYIVLDSNNMKI.GFR...ARIMDALAD..LDV......................qNMEVMTTDTHFVNTLSG.....GHNPVGTHK...-........GDEIIAAIVQCTKDALDD..IEDV.EVASDV..AKIEgIKTMGPL...H.S....TEL....VTTI....SSIVA.V.SRIFAPLMFIFAFLF-a...........................................
E1QRT0_VULDI/7-583                   .............................................FERGYTIVFR..gGDSIK...YSLIL..LII.VIpYLMSLYVRETII...........................vYLKSLVIY.GV...MFLSV.L.I.T.LR.AMVF----........IQSYRGf.gTTLSL..FSTALAVIIDLLITLVTH--.................-KFVVGFGALS...........................--FVL.PLSAMI.M.VL.RGLEHNGNSMk........kyILYPLYTLPSILLIQLIsy..................................flIGTISPM..KYVILDLTFY..V.FSFL.F.......IYYVIFKFEASYgGVDILRLFSSYLYTALFE.ySEPF...ERELS..KR..SVIRDVKVHLFMLNN.........N..................-.....-..N...........NTYPVtIPELHAGPIAKVGGGYLI.SDLVSE.LSRYv.......................npVV.YMHGVGSHELDPATRVDVRRVV....RAVANKV.REYLngqyvsN--ECAgkMPI......QVQSR..N..F....RITHIPLCE.KSIIIISRLVKSSDDIPLNVYEELKKRVKLD..-WDNVILVDAQNYYSDDNTW.....D---....ENDINELASLLSKIGE--..LEDQR........LEIKSCVSHVPK......YA..FGPIqFE.IGDNGLITWGLD..IN.G.......................KKVLLVIFDGNNLRR.ELA...DAIINEFRN.gFD-.......................IVEVLTTDNHQYTGIARftrsrGYKIVGDSI...S........HELIMRNVRRSVKRCLNN..LAMT.RVRYYP..VIVEgIRLIGDS...-.F....NNM....VRAA....ERGVM.D.WKKHFIVLIVLPILT-m...........................................
A0A1Q9PAG6_9ARCH/15-609              ...........................................tv--RLYSKVWQ...LPPYR...QIVLR..MIL.LV.LIGSLILSAVKGl..........................lLDVFLCYL.VI...LGAPV.F.I.G.SG.LLYVIATEen....spLDGRRT...AGLVQ..FGLLFWIALSVVGGIVDSLAg...............sTAFEIRFSILG...........................VAIAY.LAFAFL.V.NG.LSDHHPIRNT...........IAALMPPILWILAELFLaprn.............................aalpvLPTLWFI..PLVTSLTIAS..L.VVHY.I.......YRAVSVPFERDL.GINGPQLLRAFGHDFLAS.nPEPL...EEILT..KI..ATFQDIPVEIIIFRD.........D..................A.....G..P...........VACGV.IQYVHPGPFRDIGSSDLP.SVIIEH.IKEThg......................ipAF.VMHGTCTHQQNLTTKEDYPVVL....AEIDRLI.EETE......VHELIS..GPH......WSDGG..K..F....KVWSLFVGN.DVLTISTSAPDFTDDISLDVGYDLANMIRERlpQVGGVAVVDAHNCIDDSAVS.....VNQG....DPEAGEYVGTVSGAVFST..INNDR........TKVQLGMHQILP......ND..ISQS.EG.MGPGGVIAIALN..LG.E.......................REMALISIDGNNMEP.GFR...EQAQSLLKA.qGFD.......................DAELITTDTHVVNAISLs..srGYPPIGRNK...-........PNETLEHIVTASMKARER..IQPV.KVGLGF..GKATgLRTFGEK...G.F....DIL....TQDV....AEAAD.I.AKR-------------vgiragggsillyill............................
A0RX67_CENSY/10-577                  ...........................................iq--KRYTLTLI...NPSSR..yLSLAF..SVV.VV.AVLTAVATIVYR............................QGDDTAWR.IM...LVMPV.L.L.A.TQ.YIDSLFIR.......nKEISKS...LHMAL..FGNSIWLLTAAAGLGAAYILg...............kPEISYFYIAEG...........................MFLLA.SFRIGI.F.TT.TLGASLRKAW...........LVCFLQPVAIFLAITPAd...................................mwVPALTDP..AALLVGAAFL..V.ITTA.W.......SRWTDRAGMPNV.-KSTHRLIQAYLFSVSRN.dPSEV...ESIIE..EQ..SSPSRVSTTQIRLNT.........G..................G.....D.gR...........DFRIV.LPDIHPGPYHPVGGSNIP.YLIYKN.LDSS..........................AM.VMHSISDHSLNLPSQTEVKNYL....SSLSHGA.VVGE......-GARCA..EPV......TVQVN..K..A....RAAGLLFGK.TAVLCLSLSPHGMEDIPLHIRNEIEQFSKSR..GFDGVLAVDCHNAMGEGLS-.....----....DADSADLLAASKSALDAL..RNREA........HDLEFGYANSDD......MG..LDA-.PD.LALGGIGILCLR..IN.G.......................KKFFLGWADANNMEN.GVR...EEIVKRFSD.sGRE.......................LIEICTSDTHYSTGVRNr...nGYYQLGIVS...K........AAEIAGWYLDVAKRAEAG..IKPA.SFEVLE..HVVS.AKVMGPG...I.F....RDY....SRAV....DRSMV.I.TKIVMAGCAGLFLL--sl..........................................
A0A087S5E3_9ARCH/1-97                ............................................v----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....--IGLLFGK.NPLLFLSLSPHGMEDIPNYMKNDIEQYAKNR..NYSKPLIVDCHNAMGEEIS-.....----....NEDGEDMLKAAKSCLDTL..ITKDS........FPIEFGYANSV-......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------llknl.......................................
D7E747_METEZ/6-550                   .........................................dvfk-----NIIFS...VPSLK...RVVEA..LIV.TG.AIYGVLINLSISylsavp...............lnlyyiiITALFMFI.IP...ALVSG.E.L.Y.YQ.FL------........PEYPRKw.gYFLTL..FNEFVLFVYGMILTFSA--Es...............gFISAWNIFWIA...........................IITIF.LTSLLV.L.VG.TLGYKYIKRI..........sILGMVQPLMIVSAFHLSigk................................sleITVTTYI..ERIGLLFLAG..I.MLLL.T.......FFLAEYLISTNV.NVSAIKLSSGLL----QK..RQEV...----L..NL..GYSSRPDVQTLEIEN.........E..................N.....-..S...........STTIA.VPWIHPGPLEGFGGGRAS.TDLINH.LNENg........................sGF.FFHVPSTHKCDPVNPDDIYKII....KALNKPT.----......KSSTAS..KLV......KESYP..EhkL....TFYGRKLGD.KKLVYME--AENYGDYEISVFRDLID-----..-LENVMIIDLHNHERNKEPDp...qLLYG....TDEAEIFREKLLKFLDKL..EGLKT........SDYQVGYCTNTI......GT..--PK.--.------FALIEN..VD.G.......................QKTLLFGTEGNGISE.K-M...DEVRQNLKD.sYD-.......................EILIFTTDTHSSIH---.....--NMISNKH..vE........TDELY----EVINKASKN..VSNG.SAGFTN..NKSEsMKLLKDD...-.Y....LGL....AYSI....NILVR.L.FPLSLLLLYIVLIL--wi..........................................
V4YE44_9ARCH/8-612                   .............................................LAALSRVIFR...APSWY...SSVLF..TVI.IA.ALAGIASFDSRFil.......................edaWMGIFFIA.VP...TVIAS.G.V.T.PY.IDGRLGGR........LSPDQA...SLLAL..VCELLVVGGLVLVGLLSALVpr.............lgQGFVFDVLFAA...........................LAAVF.GLRLLV.V.MA.VSHRSPLRAS...........IPASVQTVSAGVLLFVYtgtaryleiggpiar........sylsrpedtpeellvIVPSDFL..LLGGMCLLYA..G.AVIG.F.......IKVIDRPWQRSM.EVSVLDFLRGFVGYVADG..TTEL...EEFFE..AI..GQEAVVPVTVLSFRG.........S..................T.....G..E...........KARFV.LPMVHPGPMGEIGGGNLP.AQIASQ.ADGL..........................AF.PPHATAGHDFNLVTSREVETLL....DTAADAM.DDMT......YRSGAT..ESV......RHGEG..E..A....TLLAQAFGD.SAFVTASYAPAFADDVEYAVGLSAAAEARHS..GLETVMLADAHNCSDGLNGEnl.ghVVPG....SKRSFDLIEGAGQVGETL..ADAPR........SPLRMGVAWDRT......S-..WDST.DG.IGPLGVRVAVTE..VG.D.......................QQTAYVLVDGNNMEP.GLR...DTLVDAVQE.hVT-.......................NAEILTTDTHVVNSVD-.....ASNQVGERV...E........MTELRSLVVGLLDDAIAD..LEPV.EAGMVT..NRAE.VTVFGND...R.T....ESL....ASHA....NAMIQ.M.GGALAVASAMAVTAI-s...........................................
A0A151BH24_9ARCH/1-362               ............................................m----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...----D..RM..GEAATLHIDALYLLE.........A..................H.....Q..P...........RAALI.TPYIHPGPFREVGSSVLP.RMISEA.LQRRyg......................clAL.IAHGVSTHDRDLTTREEVKRAV....DALTSTP.LPGE......AAATIS..PPM......RADRN..G..A....SALCQLFGD.TALIILTLSPRSFDDLPEDLRLRIEEEASER..-GLRAVVVDAHNSLGDVDEM.....T---....DEDLGGLYQAAMEAVERA..LAAPR........HPFTFGVHRVVP......RE..WGLE.EG.MGPCGISALALR..LE.G......................gETYVYVVIDGNNMKS.GLR...ERLLEAVGE..LDV......................aEAEVMTSDTHLVNAIGVt..prGYYAVGERM...D........ERRLKEYVVEACRGALSQ..MTPG.AAAYHR..VTLPeMRTLGVK...G.L....EAF....AEIL....EASFS.L.FKKSSLLLLPLSLLS-s...........................................
A0A0U3EB13_9EURY/7-596               .............................................VAGLSKYIKT...LPSTG...KSIIA..ICI.LS.FLTGVIQFLINPqdslsy................nfftegFCTFMILG.VS...SILSG.S.V.N.QY.WVRALKGI.......nLKIKHS...MFLSM..LSMIFISLILIAGAILAQIF................hIYLFVNSLLFA...........................CVLVY.GFNTLV.L.WS.TTKIGFSKSA...........IIGLIQPILVLTMLVLLmflwsdp.......................svfstpeiI--NIIL..KSVVACLIFV..L.TIYA.F.......ITILASPLKKNL.GIGMLDLLSLFIMHMNEG..SNDL...ESTFE..NM..GESIDTVVTFICFKG.........V..................N.....G..I...........KSLFI.SPSVHPGPLGKIGGSNMP.TILANS.FDHF..........................TM.VAHGPSTHDFNPISSKEIDKIE....KSVKDGL.SEVT......FSKKAS..KFK......RYSMN..A..A....NIGVQFFNE.GMVILSTLAPNGSDDIEFGVGLTMMTQSISK.cNVKDSVIVDCHNSFTPESGE.....VLPG....NPEVFDLIDAIDKI-E--..ETEKH........ANIRVGCCEDKM......ET..LDKH.EG.IGESGLKVMVIE..VD.N.......................QRTAYVLFDSNNMEI.GFR...QEIMDATKD..LDI......................dEIEVMTTDTHTVNTLSR.....GYNPVGIEK...-........RPEIIEYIIKCIKIAIDD..LEDV.EVGTGT..KKIKnLNTFGPK...N.S....TEL....ISTI....SSIVA.V.SKIIAPVLLLTALFI-v...........................................
A0A2I0NYP0_9EURY/1-162               ............................................t----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........SELSIGYAHIPL......P-..FGRK.EG.IGDIGLQILICE..VQ.N.......................QKTAYLLLDGNNMAS.GAR...EEIRDQILK.mVD-.......................DAEIMTTDTHVVNTIS-.....GKNPIGLRV...P........PPALMPYIEDGVSQALDD..MSPA.TAAGST..ASCEgVIIFGSD...S.I....AQL....ASIV....NTILV.Y.IIPISAGMLMLAVVLS............................................
A0A2H9LLV3_9ARCH/1-192               ...........................................mq----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....-ESLDELKAVAVACLEKA..VLKER........LPFQVGAATVIP......EE..FTIR.DG.MGPGGITTIVVK..VG.K.......................QKAAYIVIDGNNMVS.GLR...EKVLSALHS.lGID.......................DGEVFTTDTHAVSAVILs..qrGYNAVGEAI...D........HERLIAHIKEATVVAMSK..LEHVkTASCCN..ITVPsVKVIGKK...R.L....ETL....CLLV....DRAIR.K.AKRIVVPIFG------isglfl......................................
E3GYX6_METFV/7-595                   ............................................i-KNLSKYILS...LPDTK...FSFLA..ITI.VS.FVIGILSFIICDtahnpi...............ynilyggTFGFLVFG.VS...AIISG.A.I.T.QP.WVNSLGGR.......rMKMKQS...MFLSF..FAMTISSIIYLLGCCIYAIF................kVDVVLNAFIFT...........................CVLVF.AIRMII.I.WT.TSNINASNSL...........LISSVQPGLIVSMFVILkfldii.........................tmnvgylSVLLLSI..KIIIASAIFL..F.AIYS.F.......VLVVESPLRRNL.GIGALELLSMAIAHLTEE..SPAL...ESVFK..EI..GVPVSTLVGLISFKA.........R..................N.....K..K...........KALFI.TPCVHPGPIGKIGGSNMP.ALLSKR.FNTF..........................TM.VAHGPSTHDFNPVSSKEIYKIE....KAIKQEI.NKIE......YSKHAS..KVF......KVSSK..D..C....KIKGQFFGK.DLLLLITFSPKGSDDIDFGVGLAAMNLAKAK.cNSKNVIIVDCHNSFNETAR-.....ILPG....NKEVFEIMDAIEKI-D--..CNIKK........YPIEVGCSSIKP......ND..ISKE.EG.IGEDGIKTLVTK..VN.N.......................QKFAYILLDSNNMVK.GFR...EEILKKLKN.yVD-.......................DAEIMTTDTHSVNTLSG.....GYNPVGMKN...-........RKKIIEYIIKSVKNAISD..LEPV.EVGCKV..IRIEgLNTFGPT...A.S....TEL....ISTI....SSTVA.V.SKIVAPVIFALAIIF-a...........................................
I7KC43_METBM/9-571                   .............................................VERLTRYLFS...APSWP...RSLGI..IIV.LG.LLIDGAAYRAGNd.........................yfLVGTLGFS.VP...ALVAF.L.L.T.VP.LVRASGRV........ITHNRS...ALLAL..TCTVLSVILSLAPALIFGL-.................-ALFPALYAGA...........................LGLVF.GLRVLV.L.VA.VADYRITRMV...........IPAFIQSGAGIAVGAWI......................................FDPGFVP..YALLLQVVFG..L.VFVF.L.......IWLIERPLKRAF.QISGLNFLNTFIAHLTDG..SKSM...EDFFR..EI..GEEVYVQQASLFFSR.........D..................R.....G..R...........DVLFT.VPNVHPGPMGDVGGGNLP.RVLHDS.FEAE..........................TL.VAHGCATHDFNLVSESEIQKVV....SAVEASR.EGIC......YSTVAS..QPV......RVSSG..S..V....EILCQRFGD.ALLMVSTRSPERTEDLDYAIGMTIMAEGRGS..-FSHVAFVDAHNCMTSVGSP.....VLPA....TRIATEYMKAAREGFRVA..RDLPL........EPLAVGVSHVRV......P-..FSRE.QG.FGSLGVQVLATE..AG.G.......................KRAAYVLIDGNNVDA.GVR...EPLLDVVLK.lVD-.......................EGEIMTTDTHTVNTVS-.....GKNPVGYRV...P........VEEIIPYVEQAVREAVED..LAPA.RVGAAT..ASCEgVVVFGSQ...R.V....SQL....ASTV....NAMLA.F.IAPISFMILVLAFLLS............................................
K0B386_9ARCH/10-579                  .......................................nihnrf-------SLTl.vNPSSH..yFSLVV..SLG.VS.AIISLATLLGYFg.........................tsLEETWHIV.IA...VMTVL.F.L.T.QL.LDTRFTKK........KEYSKS...LHSSL..FANMLWAATVLLGLLASVVL................sKEPSLFLVTFG...........................MFLFA.SFRIGI.Y.TT.TLGVSIKKAW...........AICFVQPLAMFLVLTPQd...................................qwIPMLSDP..LALGYGVSFM..I.IASV.W.......SILTDRAGRPGM.-ESTHKTIQAYLASQKND..HTEA...EEIME..QR..SSETKVATSQIRLSA.........Q..................N.....G.eK...........EFRMV.LPEIHPGPYHPVGGSNIP.YLIYKN.LSSS..........................AM.VMHSISDHALNLPSKNEVENYL....KNLENSK.IKEE......-GLQCT..EPV......TVQIN..K..A....RVIGLLFGK.NPLLFLSLSPHGMEDIPNYMKNEIEQYAKNR..NYSKPLIVDCHNAMGEEIS-.....----....NEDGEDMLKAAKSCLDTL..ITKDS........FPIEFGYANSDN......MD..VWT-.ED.LGMGGLGIVCLK..IN.E.......................KKYFLGWADANNMEN.GVR...EKIIDLFAR.kDMQ.......................LLEICTSDTHYAPVKARn..rnGYYQLGLIT...S........AEKLASWFLDIANNAESN..TTTA.KFEILE..NETK.VKVMGQG...I.Y....EDY....SKAL....DNSLK.I.TKVFLIGGVGFFI---tsl.........................................
A0A1G9SZB3_9EURY/8-612               .............................................LASLSRYIFR...APQWY...TSLAF..AMV.VA.GVTGVGVFDDGFll.......................ggfTQGIFFIG.VP...TVVAS.L.L.T.GV.VDQRLGGQ........LTAGRS...SLLAL..LCEILVVVFLAVGGVVALVTp..............lgQNFVFDVLYAG...........................LASVF.ALRLLV.I.AA.VSSHSIPRAV...........VPASIQTVAAAVLLFVYsgtsrylevggplvq........aflsraehteiqltpIVPGDFV..ILGVVCLLYG..S.AVWL.F.......LVIIDRPWKRSL.GVSVRDFLGGFIGHIAED..SREL...ETFFE..EL..GEEALVPVTVLGFRR.........E..................D.....G.sE...........KARAV.LPMVHPGPMGEIGGGNLP.ERVARA.TEGM..........................AL.PPHATAGHDFNLVTEREVDTIV....ETAAVAT.DALS......VGGGAT..KSV......RTTSG..D..A....KLLAQAFGD.DILLVNTHSPRFADDVDYAVGLSAIAEARSG..GFDEALLVDAHNCNNGLRGDdl.ghVTPG....SERSFDIMEAARKAAEEL..TDADR........HPFELGVAWEAT......D-..WGPE.DG.IGPLGVRVACVD..VA.G.......................EVTVYVLVDGNNMEP.GVR...ERLIEGLPE.eVA-.......................RAEVMTTDTHVVNRVE-.....SSNQVGEAL...D........IDELVELVGDLTNRALAD..REPV.EAGMAS..ERAR.VTVFGND...R.T....ETL....ASHA....NAMVS.M.GGALAVLLTMAAM---gls.........................................
D4GSQ8_HALVD/8-630                   .............................................LAGLSRFIFR...APSWY...TSLGF..ALL.VA.AMAGIGAFDSGDlagswrg.............iffigrdaWEGIFFIG.IP...TVVAA.F.G.T.TG.VDRFVGGK........LTHNRS...SLLAL..AGEVIIVTFLTGAAIVSVFTg..............lgQTFIFDALVIA...........................LASVF.AFRLLI.V.MA.VSRSSLLIAA...........VPASIQTLTSAALLFVYsgtlrffevggpilday....lmpylarpdrappelsaIALSHFQ..LLAITCVMYA..L.GVYV.F.......LRIIDRPWRRGL.GVSVLDFIRGFIGHIAEG..TREL...EDFFE..QL..GQEAIVPVTVLSFER.........D..................D.....G.tE...........KARFV.LPMIHPGPMGEIGGGNFP.ERVARR.AEGL..........................VF.PPHATAGHDFNLVTEREVDVVL....DAADDAY.ERIE......YSPDVT..ESV......RVQSG..D..A....KMLGQRFGD.DALLVSTYAPQFADDVEYAVGLSASAEARTT..GLRDVLLVDAHNCNNGLQGPdl.ghVTPG....SKRSFDMITAAGLAGEEL..SASSR........GSLSLGTAFDPT......D-..WTPR.EG.IGPLGIRVAATT..VG.D.......................QTTAYVLIDGNNMEP.GLR...DRIVEGLTT.gPNAk....................adVAEVMTTDTHIVNTVE-.....AENQVGAAI...D........HDELRETIDRLVDEALAD..TEPV.VAGMAT..ERAE.VTIFGND...R.T....ETL....ASHA....NVVVS.M.GGALALALILAAMAVS............................................
A0A0P7HZD6_9EURY/1-177               .............................................----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------MINAAEAAGDRL..GDAAE........APVSLGTAWAET......E-..WEPQ.EG.IGPLGIRVAVVA..VD.G.......................QETAYVLADGNNMEP.WLR...DRAVDELLE.tVD-.......................AAEVMTTDTHIVNTVE-.....ADNQIGAEI...D........HSEFIDTVADLVEQARAD..LEPV.EAGMAT..ERAA.VTVFGND...R.T....ETL....ASHA....NAVVS.L.GGAYALAVSLAVIAIS............................................
U1PPF5_9EURY/8-176                   .............................................LAGLSRFVFR...APSWY...RSVFV..ALV.LA.AFAGIAAFDSPEvgrvwrg.............ilfvgrdaWEGVFFVG.IP...TVVAG.L.G.T.AW.VDQYVGGR........LSRDRS...MLLAL..VCEVVLVAVLAVAGTAVYLTp..............lgQRFVFDTLVIA...........................LASVF.ALRLLV.I.VA.ISRSSLLVAT...........VPAGIQTGVAAVLLX--......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------xxxxx.......................................
A0A166SST0_9EURY/8-610               .............................................LASLSRYIFR...APQWY...ASIAF..ALL.IA.AIAGVGAFDSQYil.......................qdaWEGIFFIG.VP...TVIAS.V.F.T.TP.VDRRLSGQ........LTYNRS...SLLAL..TCEIIVVAVLSIAGIIAALTk..............ldQQFVFDVLLFS...........................LASVF.AFRLLI.V.MA.VSRTSFLVSL...........IPAGIQTGTAAVLFFIYsetirvfevggplvq........kflargdkapaalgiITPRDFI..VLGIISGMYA..L.AVYG.F.......LVVIDRPWRRSL.GVSALDFLRGFIGHIAEG..TREL...EDFFE..QM..GQQAVVPVTVLSFRR.........E..................G.....G.sE...........KARFV.LPMIHPGPMGEIGGGNLP.RRVAAQ.SEGL..........................AF.PPHATAGHDFNLVTEREVDTLL....ETAQEAY.ERIE......YSDDAS..RSV......RTQEG..D..A....KLLGQAFGD.DALLVATYSPEYADDVEYAVGLAAAAEARSS..GLDDVMLVDAHNCNNGLQGEdi.ghIYPG....SERSFHMIQAAKGTAKEL..GMTKR........GRPKLGVAWDKT......E-..WLPA.DG.IGPLGVRVAVLD..VA.D.......................QRTAYVLVDGNNMEP.GLR...DRIVETVE-..-AD.......................EVEVMTTDTHIVNMVE-.....SSNQVGGAI...D........HDELIGLVTRLVDDATAD..LEPV.EAGMES..EYAE.VTVFGND...R.T....ETL....ASHA....NAVIA.M.GAALAGAVILAVTA--ia..........................................
U1QGA1_9EURY/1-129                   ...........................................mt----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.D.......................QQTAYVLVDGNNMEP.GLR...DMLVDAVQD.rVT-.......................NAEILTTDTHVVNSVD-.....ASNQVGERV...E........ATELRSLVVELLDDAIAD..LEPV.EAGMVT..NRAE.VTVFGND...R.T....ESL....ASHA....NAMIQ.M.GGALAVASAMAVSA--is..........................................
Q8TWQ6_METKA/49-593                  .............................................LARLMRLSFR...LPSLR...DCVLG..WIL.LL.GISALYS-----............................PHLTVYVT.LP...ALASF.V.I.L.-L.LDRLAKRD........VPPNRW...PFVGL..VYAVPLVLSVPLGTVAVAVT.................-----------...........................KGVMS.TFLTLA.L.LG.TVRSGVLRAV...........-PVLAYLVIDSLALATL......................................-TGVPLP..PLLLASLTGG..V.VGAA.V.......VAVVDTLTLASL.GIRTTDAFGEFLSFKSGR..DHSL...HSLFR..GMetRTRVRVPVRVFAFMT.........K..................N.....G.dV...........KGCFV.IPWIHPGPLGDVGGGDLPgRIVRRL.LKEGi........................vPL.VFHSTTTHDFNPVDRREAGKIV...eETVRLVR.EAAD......REGCSV..GSA......PVRGE..E..T....DSVGQILGD.RLFLVLSKYPEPSDDIDAATGIALERETGGW..------VADCHNCFGDPDRG....rVYAF....SEDFWRLMRDARRISE--..RVEPT........PGLRAGFDHADP......G-..LDPE.TG.LGSGGVSVAAVE..AD.G.......................TRTLYVVFDSNSIVR.ELK...EEVERTLRD.lAE-.......................EVVVCTSDSHEVNP--R.....GYNPLGQIMgrnD........KRRLLKAVRCAAEGAIED..LEEC.EVVPVE..GWVK.VEVTGPG...S.F....QRL....VHSV....ETTRT.V.IGVLLPTAFLGVALLS............................................
A0A1W6JXX2_9CREN/11-560              ikysltiyfllssllkaflyqsffyplyylilvdsekltrkyysd----YSKVLS...IPSLK..vLISIN..AIE.TA.LI----------............................FLRGLEIG.LL...FFYSF.I.I.Y.FA.YVLL----........IFWKRTktsLVMTL..VFSIIYLIFSFLPISYI---.................-----------...........................FAFGA.FIPLIN.Y.PL.LLDHGEKASF...........ILSLFSGLIPSIVLFRI......................................-----TF..LGVIYVLIIG..L.VSLI.Y.......VYEINRKGNKII.GIPSLNVIRPFLRAVSYK.kDEDL...ENFLE..KI..SVPTIINIATFKI--.........-..................-.....-..G...........DMYFV.LPQIHFGMYGNIGSSKFP.YQVEEY.LKN-..........................AI.VFHTPGSHELDLPSSRESRRVV....EEVLKTK.LDKI......---YFT..GIE......SQNIG..D..F....NITSIRFDK.ASISFVQRPNKGIDDLPGGLWRDIALT----..---KNFLVDCHNETLTDEI-.....---G....KREYTQLRDFVRTT----..KIKPK........SDLQLGYSETIV......N-..---C.EG.LCKNLARVVTLI..DK.Ss.....................rQKLSLIYIYANNACH.GLK...DKIYEKLSD.lVD-.......................YPILVTPDDHSCTASN-.....----FGNLY...Qpa....tvCDDLIEKARSLVIESIKN..AKDVsDVEFGM..IKVK.TRVLGK-...I.I....SSM....VEGL....EKVGS.F.TLKTFWIPIIIPYVI-l...........................................
A0A1Q9N6L9_9ARCH/13-607              ...........................................ps---FYSILFQ...FPSFK...KLILI..GFT.SS.VILCVIAELIAPsfnplm................dlyygvLDGIIIFF.IP...ALISA.L.I.S.FF.ILKKDTHM........LNLRRL...IAIST..IETFIWGGLYITGAIIYLFTv...............nSALLVYSFCFG...........................GALVL.TLRLLV.F.LS.ISFSKWWINL...........LLSLLRTILSMGIALILlitpl............................ssfllNSSIWIP..GIITASFIMG..A.SVYM.Y.......KYIVDSKLKKRV.GVKSTAFLKAFMASWLED.dNRHL...ETLFD..SL..GETRDIEIGLLVFKD.........V..................E.....G..K...........KTSFI.IPQIHPGPFRSVGSSNLP.WQLSAK.LEGLlv......................daAL.VFHGPSTHASNLVKSETVNMLV....DVLKERI.GVCP.....nQFNLVS..KFI......RKQNR..Q..F....EVGCQFFGD.-LALVTAFDKTDTEDITPIVVDKLRDRLKVL..GVNSIILIDAHNNKTPGSKR....qPISE....SDEVNRLLDVLEIVVKEA..FAQPK........SGFKIGSNRLVF......DR..DLKA.NG.IGDSGIATTILE..SE.N.......................QRMVYVLIDGNNMVA.GLR...DKIREVVLK.eGYD.......................ECEVMTTDTHSVDGITL....rTSNLVGLHY...P........EKELLKNILESVRMAEKN..LKNA.GGCYSI..FKINdVRVAGPS...-.V....EDI....LKGT....GDAIN.A.ARTTLPPILLSAFLL-i...........................................
Q2FQP0_METHJ/11-572                  .............................................MEKMSKYIFT...APRWP...ASLGI..LII.LG.LLLEILSRRLDPs.........................yeWFGILGFI.VP...GVIAF.L.L.T.RP.LIILLNRQ........MTWNRG...ALLAV..SCTLFSCLITLIGLIFL---.................KDLLDLCYAIS...........................LGFIF.GVRLLV.L.VS.IADYRTSRMI...........IPASIQSIAGWVCVLPI......................................LPDPFPV..LTPVLMIFFG..T.GFAI.L.......IWLIDRPLYRAF.HIRGLKFLNAFIAHLTDG..DKGM...EEFFR..DI..GQEAWIPQVSIFFRR.........E..................G.....K..K...........DLILT.IPNVHPGPMGEIGGGNLP.SILRKR.FDEE..........................MM.VAHGCATHDYNLVSEGEIDKIV....DAVNETK.ASLH......WHESAG..KPG......RIQVG..T..V....SLLYQRIGD.ALLMVSTRSPDKTEDIDFGIGHAIICEGHKI..-TPHIGFIDAHNCLGDEIDV.....ILPG....TRTAHEYFTAATEAMNRW..EVEPL........YPLQAGYAHLPL......P-..YTRE.EG.IGDIGLQVLVTE..TG.G.......................MTAAYILIDGNNMAQ.GVR...EYIRDEVRA.lVD-.......................EAEVMTTDTHVVNTIS-.....GKNPVGLQI...S........PDDLVTHVLEGVELALKD..RSEA.KAAGSS..ATCNgVIIFGSD...S.I....AQL....ASIV....NTILV.Y.VVPISAGMLLLAVVLS............................................
A0A2H1FEJ8_9ARCH/11-578              .....................................ihkrytlt-------TF-...TPTSH..yVSLAI..SIA.VV.CVIAAVSYIDYF...........................kSTDNLFIA.LP...IAVTV.L.V.I.TQ.FIDPKILK........TEYSKS...IHMSA..FGNLLWLVTILCGILAAYVFs...............kPSVLPVYITEG...........................MLLYA.SFRIAI.F.TS.VLGTKLTTAW...........IICLLQPLAVFLAFVPTh...................................lwVPMLSDP..KAIEYGIVFC..V.LGSI.W.......TLLSDRIAGSGK.LSSTHAFLQAYLAAWTND.dPVPM...ESLME..KR..SEQSKVSTFQILFKT.........S..................-.....D..K...........NCRLV.IPDLHPGPFHPIGGSNIP.YLIYKN.LDSS..........................AM.VMHSISDHALNLPSKSQVDLYI....TSLHQNS.-KIR......EGSMCT..KPV......TVQVN..K..A....RTTGLLFDK.TAVLILSLSPYGMEDIPYHIKSDLEQYGMNR..GYERVLIVDSHNAMGKEIE-.....----....KLDADDLLTAAKSTLDTL..ITKET........LPLEVGYANSEN......LH..FQA-.DD.LGPGKVAMMCFK..IG.G.......................ENFFLAWADANNMLN.GLR...EEIANHFSK.nGYN.......................FLEICTSDTHYKARTAKn..khGYFEFGSLS...K........APDVISWFSDLAKKADHA..ARPT.SYELLK..SETQ.VKVMGGN...Q.L....ELY....SKSL....DNAMR.I.TQAFLLITTGFFIY--tm..........................................
T0LXC4_9EURY/5-560                   .............................................FADLSKYVKR...SPPF-...WLLIT..VLL.II.FFLEFLNSRSL-............................LMSFFMIP.VT...AVITI.T.I.D.QI.FSKYFKSH........LNLKKN...LFLFV..LTFFMFFIIYIILDLIFPFF.................---STQNIAIS...........................LSFVS.FFRFLV.F.YV.YLSDNDRINY...........LNSLSLTLSFIPFFLFY......................................VDYTVMA..EAILYSLISA..Y.LSYF.F.......VNRATSTFRSEF.HEEPRQLIKFFLYSATSK.kYYDV..gDRFFK..RM.ySEQRTVPVNFIRVLN.........E..................K.....E.eK...........VVTMV.FPYIHPGPFGLIGTSDLP.GRLQER.LTDLn.......................seFM.VFHTSTTNNNNCSGNEDIDAIA....NAIRNSW.NGIS......QSKMMS..RIV......SLKSS..G..I....ILDGMRFGN.FGFLALNPDKVNFDDILLTEGEKLWNYIEKE..FNLHFSILDGQNNFSKGAKE.....I---....-TDTNPYFRSSSKLVS--..RMNDK........YRGKAGYSRSVL......NL..----.NS.LGKMGIQAIVFD..YG.D.......................KKNAILLTDSNNITG.DLM...KEIREGAKH.mVD-.......................YIAIYTTDNHIVNQGSL.....DMNPLGEKD...D........VERIKNVAIKAIEDAIDH..IQDV.SFVYGH..VDVN.VKMGSED...S.Y....RTL....MNTV....FASLR.K.AKYYAAFSVSLTFL--ip..........................................
A0A1V4C5F5_9EURY/8-628               .............................................LAGLSRFIFR...APNWY...TSLAF..ALL.VA.AVAGIGAFESGDanavfrg.............ilfvgqdaWEGIFFIG.VP...TVVAG.F.A.T.PW.VDRYTGGR........LTYNRA...SLLAL..ICELVIVAVVSVAALVAFLVpa.............lgQSFVFDALMFA...........................LASVF.ALRLLV.V.MA.VSRTSLPVAV...........LPASIQTAVAGALLFVYsgairylaeggpiveaf....ltpfldesaeapgvlttLSPQQFG..LLGVLCVIYA..G.AVWV.F.......LVAVDRPWRRSM.GVSMLDFLRGFIGHVAEG..TREL...EDFFE..QL..GEEAIVPVTVLAFRH.........P..................D.....G.eE...........KARFV.LPMIHPGPMGEIGGGNLP.ERVADT.AEGL..........................AF.PPHATAGHDFNLVTEREVDRLI....DAADRAH.SRIE......YDDAAT..GSV......RTQSG..D..A....KLLGQAFGG.DGLLVNTFSPDFADDVEYGVGLTATEGARTN..GLDDVLLVDAHNCNNGLDGPdl.ghVTPG....SPRSFDMITAAEAAGSEL..GDAPE........APLSLGTAWDET......E-..WVPQ.EG.IGPLGIRVAVTE..VD.G.......................QETAYVLVDGNNMEP.WLR...DRTVDELLD..GDL......................dHAEVMTTDTHIVNTVE-.....ADNQVGAEI...D........HSAFIDTVTDLVGQARDD..LEPV.EAGMAT..ERAE.VTVFGND...R.T....ETL....ASHA....NAVVS.L.GGAFALAVSLAVIAIS............................................
A0A219AK54_9EURY/7-593               .............................................VASLSKYITT...LPNIK...SSIIG..ISL.IS.FLTGIIISLLNPpngnli...............igilgggLFYFITFG.IS...SIISG.Y.V.N.QK.LNHLMHGI.......nLKNKHS...MFLCL..LNCIGICFLTILSVIVK-NN.................PHTYVSAIEFS...........................CILMF.AFSFLV.F.WT.STFINLTKST...........IIALIQPLIILILLSISntgln............................llsinLVIMMFA..KVFIGSIIFL..I.AIYL.F.......IKTSAAPLKKNL.NINMLELISLFVKHMNEG..SHDL...ENALS..DA..GEDIDTNVSIVSFRN.........K..................E.....G.kI...........KSLFI.SLSVHPGPFGNIGGGNMP.TNIANR.FDAF..........................TM.VAHGPSTHDFNPTNIGELDKIE....EAIRNGL.EKIE......YSPKAS..KFV......RYNHK..S..A....NIGVQFFND.GIVLLSTFAPEGSDDIEFSVGLTMMIKASKN.fNTESTIVVDCHNSFTEESGG.....VLPG....NPRVFELLDTIDKI-E--..KKEQY........DDIKVGCSQSLI......ET..LDKN.NG.VGESGVKTMIID..VA.G.......................QKTAYILFDSNNMEI.GFR...QEILDEIKK.lGID.......................EGEVMTTDTHSVNTIAR.....GYNPIGLSE...-........RETIIEYVKKTIKEALDD..LEEV.EVGCTV..EDIKnLRTFGPN...N.A....TEL....ISTL....SSTIQ.I.SKFTAPVTFLLSLFF-t...........................................
A0A1I6KKQ0_9EURY/8-610               .............................................LAGLSRFIFK...APSWH...ASVAF..SLL.LA.AVMGVAAFESQFvy.......................edaWQGIFYVG.IP...TVVAS.A.L.T.PT.VDRALGGH........LTPNRA...SLLAL..FCELVVIVILTFAGLVTFLTg..............fgQRFVIDALLMS...........................LASIF.AFRLLI.V.MA.VSRHSLPVAA...........IPASIQTGAAAVLLSIYsgttgllldnpvlr.........dllsrpeeappellsVGATELG..LLGIMCVIYA..G.AVWL.F.......LVVLDRPWRSSL.GVSVLDFLQGFIGHVAEG..SREL...EDFFE..EL..GEDAIVPVTVLSVRR.........P..................G.....G.eE...........KARFV.LPMIHPGPMGEIGGGNLP.QRVAWE.ADGL..........................AF.PPHATAGHDFNLVTEREVDPIL....SAAETAY.QRLD......YTDQAT..QSI......RVQEG..E..A....TLTGQAFGD.GAFLAATYSPGFADDVDYAVGLSAAAEARSD..DVDEILLADAHNCNDGLEGEdl.ghVVPG....SQRSFDMIYGAGRLGDRL..ASAHQ........DDLRCGVAWDQT......P-..WDPE.DG.IGPLGIRVAVFE..TG.G.......................QTTAYVLVDGNNMEP.GLR...ETIVGAIDS..VD-.......................VVEVMTTDTHIVNTIE-.....AVNQVGGAI...P........DDELLALIDELVDAAIDD..LEPV.EAGMAS..EKAE.VTVFGND...R.T....EML....ASTA....NAVVS.L.GGALAAAFILGVLAVS............................................
A0A0U5H1C2_9EURY/8-614               .............................................LASLSKYIFR...APRWY...TTVAL..SLV.IA.ALAGVAAFDSQYvl.......................edaWQGVFFIG.VP...TVVAS.L.G.T.TP.VDRYFGGQ........LTYSRS...SLLAF..ACEVVVVVVLVAAGVVAAVTgr.............fgQNFVFDALIAA...........................LGLVF.AIRFLV.V.LA.VSRDSPLVAA...........IPASIQTVTAGVLLFVYsgtmnylmtggrlvn.......aylsrpaeappeiqyaFAPRDFV..LLVSLTALYG..V.AAYG.L.......VVAIDRPWKRSL.GVSVLDFVSGFIGHIAEG..TREL...EDFFE..QI..GEEAVVPVTVLAFRN.........L..................D.....DgeE...........KARFV.LPMIHPGPMGEIGGGNLP.QRVAES.ATGL..........................AF.PPHATAGHDFNLVTEREVDTLI....DAAERAH.ASID......YADRAT..PAV......RVQEG..E..A....KLLGQAFGD.DALLVSTFSPEFADDVEYAVGLSATAEARVE..GMDDVLLADAHNCNNGLQGDdl.ghVYPG....SKRSFDMIQAAGEAAQRL..READE........DVLELGVAWDRT......A-..WRPE.DG.IGPLGVRVAVLD..TG.G.......................DRTAYVLVDGNNMEP.GLR...ETIVEALDG..VD-.......................HAEVMTTDTHIVNTVE-.....STNQVGGAI...D........WDELVDLVVGLTEEAVAD..LEPV.EAGMAS..ERAE.VTVFGND...R.T....ETL....ASHA....NAVIA.M.GGAIAGLAVLATVAIS............................................
K0IEX4_NITGG/11-582                  ..........................................nih----RRWSFTt.iGPSSS..kVSYAI..WLG.CA.IAIVVVSHLYHLq..........................aDTEGLAVY.LP...LGIVA.L.V.G.SH.FLDYMALHgt....pvNKLSKV...AHVSA..FANGLWALTVFLGVAADLVFa...............kPPSGMDYIVAG...........................MLLAV.GLRIGI.F.TS.VFGASTGRAT...........AVSFIQPLIFLFAFVPPl...................................yhSLDTFSS..AGVAFGAAFV..A.LGIV.W.......TVLADRAGRPGI.-KSTFGVLQAFIAAWTEN.rVDKM...EEFTE..AK..AHDDVVSTKIIRF--.........-..................-.....G..S...........LAAIV.LPDIHPGPFSMVGGSNLP.YVLYET.FNKS..........................AL.VMHSVSDHSLNIPSKREVDRYV....KELGKRT.-VVE......RGSTCS..VPV......QIKIT..N..S....TCTGIAFGN.TAVVMLSLSPKGMEDIPQSVRTELESFGIGL..GFSDVLVVDCHNAMGKHLD-.....----....DSDRDDLVMSAKQCLDRM..KNQPQ........HEFNIGFAGLGD......IS..HQPDlEGeLGQAGLAVLVIG..VG.G.......................KNYAIGWADSNNMNN.GLR...DRVISKASG.dVTT.......................ILELCSSDTHSTSGKRTr...eGYFALGTTT...N........ADDIAEAYIQLCAKAAER..AAKS.TFELSV..AQST.IKVMGQK...Q.F....EDY....STAL....DRSMN.V.TKIFVAITVATYIAM-l...........................................
A0A165ZL16_9EURY/7-597               .............................................VAGLSKYITT...LPKTE...KSILL..IAI.VS.FISSLIYFSIQPlenmgsl..............enliyggLLGLIVFG.LS...SVMSG.A.I.N.QQ.VISGLHGI.......nLKIKHS...MFLSF..LSMTALCILMIIGGFISKIL................hQTLYINFILFG...........................CVLVY.GFNTLV.F.WT.TAKVRFVKAA...........TTGLVQPLLIIAMFVLVlflttd..........................tifvgsLILQITL..KVIIAGIIFI..A.AIYA.F.......IRIIASPFKKNL.SIGVLDLLSLFIAHINEG..SNSL...EGLFE..NM..SEAIDTIVTFVSFKT.........E..................N.....G..I...........KSLFI.SPSVHPGPLGNLGGSNMP.TILANK.FDNF..........................TM.VAHGPSTHDFNPIAVSEIDKIE....KAIKNGL.EDVE......YSKSAS..KFI......RYSAE..K..A....NIGVQFFNE.GMVILSTFAPEGSDDIEFGVGLTMMTQSRSK.cNIKDSVIVDCHNSFTEESGE.....VLPG....NAEVFHLIDAIDKI-D--..SNQEK........YSIKVGCFEDEM......KT..LDKQ.KG.VGDSGIKTMIIE..VD.N.......................QRTAYVLFDANNMEI.GFR...QEIIDAVKD..--Le....................idEIEVMTTDTHSVNTLSR.....GYNPIGIEK...-........REEIIEYIKISINEAIND..LEEV.EVGTGT..KKIKnLNTFGPT...H.S....TEL....ISTI....SSVVA.V.SKIIAPVLLITALII-v...........................................
A0A256ZMZ9_9CREN/1-172               ...........................................lm----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........YPLELGLGEARD......SR..LLKC.PD.VCSDRIYAIAIK..AG.E.......................EVLMLAVVDGNNALN.AFR...KKVISALKT.sLKV......................sHAELLTTDNHEKTGLITg..khAYVPVGASL...C........NDIILSNIVKAGRRALAD..LGKC.ELRYYR..INFT.SKTLGDSglaF.F....EKI....LSKI....PSIVH.L.LFLFNVIAYVIPII--fl..........................................
A0A2H9LMA5_9ARCH/17-382              ............................................v--KRYSSLFK...LPSYA...RVVVL..LAL.IC.IGGGLISTAALFpsldg..................llsglLLGSSLFL.LN...LVSSY.V.I.S.TL.VLRG-DTI........YDLRRT...VALSL..FCWMMWLAFIIIGVVVATPF................gLSWWVRLCLLG...........................FSAVV.ILRLIV.F.DS.TSRKSYGRRL...........IASVLQPFACAVPFLVFwta...............................iaypLTLYMLL..YFVFSLGISI..A.ASHF.F.......LSTLNRVGQQTL.GVPSISLLKAFLLNWIMD.lNAPL...EELLE..KL..GEEQDIGVSLMKF-G.........S..................S.....K..P...........KAAMV.IPSVHPGPFKNIGSSVLP.SMLKSA.LERKln......................cvVC.VPHGLFGHELDLASQAQNQKLI....DRIVESA.DFEA......AETKAT..SFV......TLSNG..T..A....TACCQIFGK.FVFISFTLAPKTTEDLPQDLGL---------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------............................................
A0A2H9L2J4_9ARCH/17-598              ..........................gdfffklpsqgrlaaylfa----------...-----...-----..---.MC.FGAGVILRLIAGsgald.................alifggTEGILLLA.GP...ALVAA.V.L.A.PP.LFAS---K........RTLKHF...LFIAV..MASAASILVFAAGTLSVRSL.................GMELLNFVLVG...........................DAIVF.LVWFAA.C.FF.GLGLGISRSF...........AVALVHPFLNVAVLFIWarfgff.........................asaldvgSPFLAFV..KILLAAGVFL..S.ALWA.I.......SYVINAPAKKNF.GISTVEAVVLFFSHMVRG..GKGL...EXXXA..EF..GEDVETTVGAVTFRR.........K..................N.....G.sI...........KSVFV.VPYVHFGPFGNLGGSEFP.ALIARD.VEARlg......................apAL.IFHGTVNHDFNPVYSSSESLLA....NAVVGMA.RRER......KAEGRA..--A......FVSDS..S..G....RVAGISFGK.DGFLTLSLAPEGTEDINLAIGYALRYKAEAA..GFGHALLVDRHNSCTDGSL-.....LEIG....SPPYYEFEDAIASMT-PP..AAASQ........KPFKLGIASASL......P-..FTRE.QG.VGAMGLRVAVFE..IG.S.......................KRSCYALVDANNALP.ELR...GRVVSLIRR.hGFD.......................AGDLMTTDTHSVNTLSG.....VTNPLGLHT...E........QAKLLSAVDAAIHRAVED..AEPC.TASFAE..QRIR.LRVFGAN...R.Q....SEL....ITAI....NSTVS.V.AKIVAPFVFIAALAL-a...........................................
A8MBV2_CALMQ/5-581                   .............................................FERGYGILFG...IHAGG..lIRLIG..LVL.MV.ITPPLILSRVGLn..........................pLYALLVST.FY...ILASV.A.L.A.LI.TMRMTSVGs.....frIYYTTVlviMIESI..VIDSVMSIIEGKPVVMAGAL.................AALAPLSLMVS..........................lLKDPV.GSRSTI.G.YL.TDLALLLVIV...........--IIIQLPVYLIIGALT......................................HDTISMP..RVLLLDLVLF..I.ISIL.I.......MLSMIIIHKVKG.TLYYLKMFGAFIYTMITG.dGSFM...EFHLL..RS..SKDSDVRIHVIHVIG.........D..................N.....G..N...........DSFIV.VPYIHAGPLSHVGGADLI.PILVKV.AKSMk.......................trLV.YLHGVGGHEVDPASYDDTINVV....NSIRQAM.IKLRss.nhtEVIRAK..PIM......NVESG..D..I....RLMVLPIANgKNLVLVSRIRKSMDDIPSYVYNSVAEELGDE..-VNRFIIVDSQNSFSSDNSW.....S---....DDDVRDLINGLRKVLN--..TPDVE........GELRLSVIHIPR......SK..VPGSfME.IGDNGIYVLLMN..FN.N.......................TSSALVVIDGNNIKP.DLA...DEIRRRLGE.vGY-.......................LAEVVTTDNHQYTGFFGk...vGYHVVGDWV...S........KDDLIRLILDAVNNP--K..IPVV.KVSYTE..ASSR.IRVVGSD...G.F....YGM....VKAA....SSAVS.L.TPILASLLFIAPIALS............................................
T0N8Y9_9EURY/8-565                   .............................................LAGISRYVRK...SPKW-...YYFLL..PVV.FI.FLIDYIILGNF-............................PALSIISI.MP...FILLL.I.I.D.FG.TIRFTNKK........FNNNRI...MYLDF..VSLCLATLFFWIGILLNPII.................SMPYYYILALA...........................IAFPA.FLRFLV.L.YI.YYPSSMFTAL...........LLSMNYTFSYIIIALVFyn.................................inhIATRFIV..PLIAATVIYV..M.FSYM.F.......LLFTTIGFTKKY.KSRPSELIDFFL--NRDN..DGAI..gEKFFS..HV.yNKKKQIPVVTTNIKK.........G..................N.....E..G...........LVTLV.FPYVHPGPFGNLCTSNLP.IKISSE.LGMD.........................nIM.VFHTATTNSNNCSGKDDIKKIA....ASVKHSL.EKMK......YSDFVS..DFV......KFHVD..G..Y....DVSLQKFGN.SGISAVIPYQKSFDDISLSAGLKVMKALIKN..GAENFALLDAQNSFTRDADE.....----....LDNCDMIINPLIKEFK--..STDSK........YPAFIGYARSYE......KI..----.EG.LASMGIQALVLK..IN.D.......................YYNAIVLTDSNNISR.DII...KMARAGSDK.rVK-.......................NMDIYTTDNHVVNVGEL.....DINPLGMHC...D........PGPVAELINNTVLKAIEN..SGPA.TIGTHT..EYIN.VTMGEEN...A.F....HNL....METV....LLSIR.K.AKYSIAFVLIISMFIS............................................
A0A2I0PQL2_9EURY/9-574               .............................................LEALSKYIVT...SPSWA...RSFVL..ILI.LS.GCVEIMAILGSGdsf.....................ayltLFPVAAYL.LP...ALAAL.A.L.T.PR.LASWFSGK........LDYGWS...GLTAA..IGLIISLFISLSPVLLV---.................SSTFPIFFAVS...........................LSLVF.TFRMLL.L.AA.VVDYRLRRVV...........VPALVHSGLAVVGAAPF......................................LGLEFVQ..LSILLHISFA..I.GVFV.F.......INVIERPMKANF.KVGPLELANAFLAHLSEG..SHKL...DDFFR..SI..GESVVVPQVSLVLQR.........E..................G.....K..E...........EIFLT.VPNVHPGPLGEIGGSNLP.KILHGM.LGNA..........................SM.VFHGSASHDFNPVDEVEVRKVG....DAVLLAR.PLSC......SNTGCT..KSA......RYRCG..S..V....DVLAQAFGD.TIIVVATRSPLVTEDLDFSVGFSIMKSGEKY..-FRHAGFVDAHNCMDALEDG.....VYPA....TELAMEYIGAAEDAFAAT..AQAEQ........VRFSAGYAARAL......P-..FSRQ.EG.FGDLGVQVLVVD..AG.G.......................QKTAYLLFDGNNMQT.GAR...DEIRRRLLT.cVD-.......................ECEVMTTDTHVVNTVS-.....GRNQVGLRI...P........VDSFYPLVKEAVMEALAD..AAPA.RSAGAT..AWCRgIVVFGSQ...R.I....SQI....ASTV....NGMMG.F.MLPVAIIILLGAFLT-t...........................................
A0A2H9KZZ3_9ARCH/10-580              ...........................................gi----TKYFVS...LPSAR...FLLGA..CIF.FS.ILFGAIMGALDErtlg....................lwalIGGAAAAL.IA...VAAPS.I.L.S.GA.ILSFFRHR........VTLGRA...MAISL..LSSLIYLLFFLGAAALGSNP.................--AKESVVFVG...........................FGLAF.LLWLFS.L.KF.AFGL-ERSCW...........IFAFLQMALHALFLVAGtsl................................ydgSIRFLLL..KVILTSLVFV..G.ALYA.V.......LFLASRPLKKNL.GLSSNDVLSMFSSQWLFQ..EKDL...EDAFD..EL..GEEALTWIGACTFST.........R..................N.....-..G...........KMQWI.VPYFHFGPFGNLGGSQFS.SLISKK.LSSAd.......................tcAF.VFHGSATHDLDPVSSSSINYVI....RKCNEAL.SSIK......LQNAHY..SIR......QGKGG..D..S....HCACLEIND.DMLSFFSRAPYSTEDINLSVGWALMERMRRE..-SRESLLIDCHNCETGEVDY.....IESG....SPASFEMADALENALA--..KKKFS........GPLKAGWAFSFP......TH..---I.SG.VASAGIKVACLE..GE.A......................hKAMFFVLLDSNGIIN.SAR...EHIENSIRK.kFPRt.....................sLVQILTTDTHELNSVKG.....VFNPAGVEN...-........IDLLEAQILTLCESSHKL..LSPC.KFGMSK..VRIR.LKVLGAS...Q.S....AEI....VSTL....NAVFS.L.LKFAVPAGLIAAI---ga..........................................
G0QGJ7_NANS0/6-245                   ..........................................lev---FKKVIFH...LPRLK...FTTVL..MFS.LA.LVYSSTTFYLAHtllids...............lkpmsifLFGLLFYL.LP...GIISP.E.F.K.TS.FL------........PEYPRRw.gYFLSL..VNQFIFFIFSGLALASTSFA.................--FGWQIIWFG...........................LITLY.VNNFFV.LtLS.VGPNYIRRIS...........MLSLVQPVMILIGFHFVlgq................................flqISWIAYA..INFLVILGAG..L.VLLL.S.......VYFTEYLVGSNVtNISILNLAAGLL---QNE..QDSL...-----..DL..GRSVRPDVQTLQIKN.........R..................S.....G..V...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------kn..........................................
A0A128A280_9ARCH/11-578              .....................................ihkrytlt-------TF-...TPTSH..yVSLAI..SIA.VA.CVIVAVSYINYF...........................kSPGQLMYA.IP...IAIGV.L.V.V.TQ.LLDPKILK........TEYSKS...IHMSA..FGTLLWLVTILCGILSSYVFs...............kPELLPVYITEG...........................MFLFA.SFRIAI.F.TS.VLGAKLKTAW...........IVCLLQPLAVFLAFVPTn...................................mwVPMLSDP..KAIEYGIVFC..V.LGSI.W.......TLLSDRIAGSGK.LSSTHAFLQAYLAAWTND.dPVPM...ESLME..KR..SEPSKVSTFQILFKT.........T..................N.....-..Q...........DCRLV.IPDLHPGPFHPIGGSNIP.YLIYKN.LDSS..........................AM.VMHSISDHALNLPSKSQVDLYI....TSLQKNL.-KIQ......QGSKST..KPV......TIQVN..K..A....RTTGLLFDK.TAVLILSLSPHGMEDIPYYIKSDLEQYGKNR..GYERVLIVDSHNAMGKEIE-.....----....KLDADDLLNAAKSTLDTL..ITKET........LPLEVGYANSEN......LN..FQA-.DD.LGPGKVAIMCFK..IG.D.......................EKFFLAWADANNMLN.GLR...EEIASHFSK.iGYN.......................FLEICTSDTHYKARTAKn..khGYFEFGSLS...K........APDVTSWFTDLAKKAEQT..TSPT.SYELLE..SETN.VKVMGGN...Q.L....ELY....SKSL....DNAMR.I.TQAFLLITTGFFIY--tm..........................................
A0A0F7PA47_9EURY/8-612               .............................................LAALSKYVFH...APSWR...ATVPF..SLL.IA.AFAGIAAFDSRFll.......................edvWKGIFFIG.VP...TLVSA.A.A.T.TP.IDRVLTGH........LTFTRS...SLLAT..VGEIVIVVLISLAAIVTVFTp..............lgQNFVFDVLIVA...........................LALVF.AIRFLV.I.LA.VSRTPPVLAA...........IPASIQTVTAGVVLFVYsgtmnyfsiggpylr.......avltrsqeappiihqtFVPEDFV..VLFGMSALYG..A.VTYG.F.......VLAVDRPWQRSL.GVSSLDFVQGFIGHIAEG..SREL...EDFFE..QI..GERAIVPVTVLSFRA.........E..................D.....G.nE...........KARFV.LPMIHPGPMGEIGGGNLP.QRVAES.TSGL..........................AF.PPHATAGHDFNLVTEREVGTLL....DAAESAL.QRIE......YHAEAT..PAT......RSVEG..D..A....TVIGQRFGD.GGLLVSTFAPSFADDIDYSVGLTAMSEARIA..GLEDVLLVDAHNCNNGLNGDdl.ghVVPG....SQRSFELMEAASDAAADL..VEAET........KPIELGTAWDRT......H-..WRAE.DG.IGPLGVRVAVLK..VG.E.......................QWTGYVLVDGNNMEP.GLR...DRIMDAVDR..LD-.......................AIEVMTTDTHVVNTVE-.....STNQVGSAI...D........DDALVDLIEGLVDEAIAD..VEPV.EAGMAT..ERAE.VTVFGND...R.T....ETL....ASQA....NAVIS.M.AGWLAAAVTLAAGA--is..........................................
A1RXM0_THEPD/12-541                  .............................................FKSSYKWIIR...LPAT-...-RVLA..PIS.FS.LL--LLS-----............................LGASLLLG.VPpseLLHSL.L.L.G.AA.VPLYLHVCdr....rvFNFRRSl.gVFLLY..LAMLPLVLVLRKPPILATVL.................EGLVGFLLAVGil......................svwKAGAL.AILYFL.W.FS.VAHNDPRALY...........-----------------......................................-------..----ILSAFF..L.ASST.V.......FFVVDRRIRKAA.GVSGVGFLEAFLKYILSG.aRSEV...EEYLE..RI..SVERTLQVHVYSF-T.........A..................D.....R..E...........IGRLV.ISNVHPGPLRDLGSSTLP.QLIAKC.RDTP..........................TL.FLKAPCTHSENLPRLRYSEELA....GAVCSCT.PS--......PAVDRC..GLG......YSSSG..K..V....DVVRLAFGE.IPDLVFLDPQVIMEDLPYRV----SEESH--..AVEGAVAVDLHNMIAPGYLK....iDEDD....EIEIAEIVSAIHEASE--..EVEAE........GEIYAGFARVEY......TD..---G.AS.VGPGGVACAVLQ..IA.G.......................KKLLLLSIDGNNMTP.DFK...ERVLRTFKE.sFE-.......................KVLVATTDTHLYTGLYRn...vDYYPVGALS...-........PEKVLETCMSCVEKALKN..VSKV.RVGYCS..----.VPFRGRF...M.D....GEM....LRRI....SVATK.K.NTRDSLAVVFLAFAVSlall........................................
A0A256ZLH1_9ARCH/14-610              .............................................VEKYHGLLFT...LPTAK...RMMAY..VLL.IS.ASSGLLFGLPLAr.........................sgSPTSILIS.AS...FFTLA.E.L.V.SW.VLDALLLKgd....piMDSRRC...LGFEL..FSLMALAPMSALGGLLAYATs..............sgGPLALRMASVG...........................VSLSI.SARTLT.I.AA.ASLAGITRSS...........ACILIGPLAWLASAYSSill...............................tspmLSRADLV..FSSLCLALGS..L.ASLA.L.......VLSINKASSDLF.STGAMRAARAFFACWITD.yNEPL...ETFLD..EV..GVSADTSASIMLFEG.........L..................D.....G.rP...........IGALV.VPGVHPGPFRDAGSSPLP.GLIQEV.LEERlg......................cpVA.VPHGLSGHDLNLTSKRECEKLI....RALIEDL.AGLK.....gPFDTAS..PMS......RSSGR..R..A....KACCQLFGP.IALTVLTTAPEPSEDFPREIETILRDEAAEM..GLYDVVVVDAHNCINGLTGQ.....----....EGLVEEFSEVASEAIKKA..VSSPG........GPFKAGMARVRP......PE..FTVE.EG.MGPGGISVLALE..VA.G.......................KRYAYVVVDGNNMIK.GLR...EHLLARLAE.lGFE.......................DAEVMTTDTHVVNARLLv..erGYHPVGEAM...DwdlgeamdWDLFSRHVLEAAREALDG..LRPA.VVRWAR..VRTS.VRVFGEE...Q.L....GRL....CELP....VRALGaA.KKAVLSILLPVQV---lll.........................................
A0A0M0BQE2_9ARCH/12-598              ............................................a-AKHYGSLFS...LPSYL...SIISF..TIV.IC.IIGGFSAFTITQtsvyn..................afngfLYGLLVLL.AP...TIIGD.A.V.L.SK.IIFCDT-A.......vLNKRRG...AGLSL..FVCITWAISLLVGAVFQVVLn...............nPSVLRGAVLFA...........................VCLSI.GLRFLV.V.SS.VTYLNGWKAI...........CTILLQPGLYFLSALVFf...................................nlWHPLIII..AVIGATCVLL..V.FSYI.F.......IRVIDKKGIQAV.GIGAIPFFKAFVANWASG.aTEPI...EDCFE..KL..GSNTNLIISLLAFKT.........N..................E.....D..M...........KLVVV.VPTIHPGPFHNVGSSNLP.FYIEKA.LEEKt.......................naVIgVPHGTCNHKANLTSRLQCEKVL....RVLAEAS.VFSN......FKSTAT..RFV......RYEQN..R..I....KASCQIFGD.VAFMTVTCAPANMEDIPLEVGLEIIDRSKKM..GVKDVIVVDAHNSANNSKDL.....STLS....EDSLKDIIAVSEKVLNIA..FDEEK........RPFKIGVAKIHP......EE..FSIK.DG.VGPAGIVAFVVV..VD.D.......................QKIAYIIIDGNNMVS.GLR...EKALHELSD.iIS-.......................DGEIMTTDTHVVNAVVSi..erGYYRVGEAV...D........EMKLIYYFRKCVTLALNN..LGDA.ITTYRI..EDIIdIKTIGEE...-.V....LKI....SALV....DRTIS.L.LKLLTPIIYVPAFIF-a...........................................
A0A1D8S5M7_9EURY/8-613               .............................................LAGLSRYIFR...TPRWY...STMAV..GLL.VA.ALVGVAAFDSRYif.......................edaWLGVFYLG.VP...TVVAS.V.L.T.AP.IDRALGGQ........FTFNRS...TLLAT..VSLLIAVSVLTAAGLLAAVTs..............lgQNFVYDALIGA...........................LALIF.AFRFLV.V.HA.VSRTHPLSAI...........LPASVQTGFAGLFLFVYsgtmnyltlgggpyfq......allsrpshappeityaFVPGDFT..LLIGMSALYT..G.VAYA.F.......LRILDRPWRRSL.DVSSLDFLRGFIGHIAEG..SREL...EDFFE..EI..GEEAVVPVTVLSFRQ.........P..................D.....G.eE...........KARFV.LPMIHPGPMGDIGGGNLP.QRVAES.TTGL..........................AF.PPHATAGHDFNLVTEREVETLI....DAADRAA.EQIE......YGDSGT..RPV......RVDVG..E..A....SVLGQRFGD.DALFVSTFAPGFADDIAYAVGLAAGAEARVE..GMDDVLVADAHNSNNGLQGEdl.ghVVPG....SRRSFELIQAVSDTAASL..QAEST........GPMELGTAWDPT......N-..WRPE.EG.IGPLGIRVAVLS..VD.G.......................EQVAYVLIDGNNMEP.GLR...DRIIAAIDG..VD-.......................AVEVMTTDTHIVNTVR-.....SSNQVGGAL...D........QDQLIDRVVELVDRARED..REPV.EAGMAT..EMAS.VTVFGND...R.T....ESL....ASQA....NAVIS.M.GGGLAAAVIVATAAV-t...........................................
E0SQZ1_IGNAA/21-561                  ................................srisrhvkwiypv----------...-----...-----..TIV.TV.IGIELLILFGKGv..........................aLKNIINLV.ML...HIILS.S.L.L.PI.IIKLMVSY........INLRQA...LNTSF..FLILLGVLLEIIGVF-----.................------AKIYG...........................VMYVA.IPLLGV.L.IL.KGMSNDNKNI...........FVLIIYSILAEIIFTIIv....................................dFSLIQRI..ARICLLLFSI..S.VSIF.F.......ILTLSKRGK---.DIDVFRFSSAWAKFILTG.fENDM...EDVFE..SF..GTEREIDIRMLLFQR.........D..................-.....K..D...........NIAIV.IPGIHFGPFRTIGSTLAP.YLIEEE.LKKYn.......................ikSI.IFHGAGSHERNLVSKKEINKIV....NAIRDLL.QKPM......EKTFLY..EPF......RVFNG..Y..H....EALVLPSSM.-VLIAISTPTVGGDDIPYGVQELAEKYSKVY..GYEDAVIVDCHNLEGPM---.....----....IRDLSRYKDIVIAAISK-..QSRQC........SRVRIGYSEDEV......RG..YV--.RG.LCSNTIKAMAIE..CD.G.......................NVYSLLYLYGNNADI.GVR...EALRRLALS.lGYK.......................DAEVFTLDDHTCSGVAFd...sPYYSVRI--...-........NASLLRSAEKVLREALTD..LKEA.TISFTK..HSIK.VRTMGEK...-.I....YEL....LELA....KVIGR.D.VLNYL-----------kttllllyssviil..............................
Q18KM9_HALWD/8-628                   .............................................LANLSRYIFR...APRWY...VSLTF..AIV.VA.AAVGVAAFDSGAyattwrg.............lfifgrdaWEGVFFIG.IP...TVVAA.F.A.T.TG.VDRFVGGK........LTANRS...SLLAL..ISELILVTIVVTAAVISVITg..............lgQRFIFDALVVA...........................LASIF.AFRLLI.V.MA.VSRSSLVIAA...........LPASIQTLVAAVLLFVYsgtlryisfggpllday....mmpylarperapaelsaISMEHFA..LLGITSVLYA..L.AVYG.F.......IIVVDRPWRRSL.NVSMLDFLRGFIGHIAEG..SREL...EEFFQ..QL..GEEALIPVSVLSFKT.........L..................D.....D.vE...........KARFV.LPMIHPGPMGEIGGGNLP.ERVATA.ANGL..........................AF.PPHATAGHDFNLVTEREVDTII....DAVETAA.NRIE......YATEAT..RSV......RTHSG..E..S....SMLGQCIGN.NGLLISTYAPGFADDIAYGVGLSASAEARTT..GLSNVMLVDAHNSNNGLSGPtl.ghVTPG....SARAFDMISAARQCGDRL..STAEQ........YPMELGTAWAET......P-..WDPT.DG.IGPLGVRVAVLK..VA.D.......................NETAYVLVDGNNMEP.GLR...GQIIEAIVD.eGPV......................dAAEIMTTDTHIVNTVE-.....ANNQVGSAI...D........NDIFINTLSELTTEARRD..YETV.TGGMAV..ERVS.VTVFGSD...R.T....ETL....ASHA....NAVVS.I.GGAFAVTVALAAIAVS............................................
U1MY28_9EURY/8-612                   .............................................LAGLSRFVLR...APRWY...SSLAL..ALA.VA.AITGIAAFDSEYll.......................ddaWRGIFYIG.FP...TVVAA.L.S.T.AT.VDRWVGGR........LTQDQA...SLLAL..ASEFIVITVLLLAAAPVFVLg..............vsRQFVFNGLLVA...........................LAAIF.AFRLFV.T.VT.VSRHSIFRAI...........VPASIQTVVATVMLFVYsgtlnslrvsgplie.......tyfarsqeapeaiqssVLPFDFV..LLAIICLIHI..V.AVWG.F.......ITAVDRPWKSSL.GVSVVSFLGGFIGHITTG..SREL...ESFFE..EI..GEEALVPVTVLVFRR.........P..................D.....A.gE...........KARFV.LPMVHPGPMGDIGGGNLP.AHIAHE.ADGL..........................AF.VPHATASHDFNLVTEREIGAIH....DAVDQAC.AEIE......YSDTGT..TSR......QITEG..D..A....TLTGHRFGD.DALMIASFWPEYADDIEYAVGLSAIAEAHAA..GLDDVLFADAHNCNNGLAGPdt.nhIVPG....SKRSFELMKGARQLGDRL..GDTKQ........HQLRLGTAWDET......E-..WTPE.DG.IGPLGVRVAVIE..AG.D.......................ETTAYVLADGNNMQS.ELR...ELVVNSVDA..VD-.......................TVEVLTTDTHITNTVS-.....ADNQVGGGL...D........SNAFAALVDSLVDQALDD..LEPV.EAGMES..KTVE.VTVFGND...R.T....ETL....ASHA....NAMIP.M.ATALATAFVFALLSV-s...........................................
I3D2V5_9ARCH/10-580                  .....................................nihnrfsl---------Tl.vNPSSH..yFSLVV..SLI.VA.SVTVLATYFGYLs.........................slGFEENWYR.LP...LVLGV.LvL.T.QL.LDTRFTKK........KEYSKS...LHSSL..FGNMLWTVTLLMGILSSVVL................sKDIELFFITFG...........................MFLFA.SFRIGI.Y.TT.TLGVSLKKAW...........AICFIQPLAMFFVLIPQn...................................mwVSVLSEP..IGLGYGISFL..I.IASV.W.......SILTDRAGRPGM.-ESTHKTIQAYLASQGND..FEDA...EKLME..QR..SKETKVSTSQIKLSS.........Q..................M.....N.gK...........EFRMV.LPEIHPGPYHPVGGSNIP.YLIYKN.LSSS..........................AM.VMHSISDHSLNLPSRNEVENYL....KNLEKSE.VKEE......-GVQCT..EPV......TVQIN..K..A....RVTGLLFGN.NPLLFLSLSPHGMEDIPSYMKNEIEQYAKNR..NYSRTMIVDCHNAMGEEIS-.....----....NEDGQDMLKAAKSCLDTL..ITKDN........FPIEFGYANSDD......MD..VWT-.ED.LGMGGLGIVCLK..IN.D.......................KKYFLGWADANNMEN.GVR...EKIIDNFAK.nNYQ.......................LLEICTSDTHYAPVKARn..rnGYYQLGLIT...G........ADKLSKWFLEIAKKAETT..ITTA.KFEILE..NQSE.VKVMGQS...I.Y....EDY....SKAL....DNSLK.I.TKGFVIGSLGLFI---tsl.........................................
F9CVS4_9ARCH/1-519                   .........................................mvig----------...-----...-----..---.--.------------............................--------.--...---VL.A.L.S.QL.IDTRFTRK........KEYSKS...LHASL..FGNMLWIAVILMGLLASVVL................aKETSLFFVTYG...........................MFLFA.SFRIGI.F.TT.TLGASIKKAW...........AICMVQPLAMFLIMIPSd...................................mwYSTLTNP..LAIGFGAIFL..I.IASV.W.......SVLTDRAGRPGM.-ESTHKTIQAYLASQGND..FTEA...EAIIE..QR..SFKTKVSTSQIRLSA.........S..................D.....G.nM...........KFRMV.LPEIHPGPYHPVGGSNIP.YLMYKN.LESS..........................AM.IMHSISDHSLNLPSKNEVENYL....KNLDSSI.VKEE......-GLMCT..EPV......TVQIN..K..A....RVTGLLFGN.NPLLFLSLSPHGMEDIPNYMKKEIEQYAKNR..NYVRTLIVDCHNAMGEEIS-.....----....KEDGEDMLKAAKSCLDSL..ITKDS........YPIEFGYANSDS......MD..VWT-.ED.LAMGGLGVVCLK..IN.G.......................KKFFLGWADANNMEN.GVR...EKIVENFAK.qGRQ.......................LLEICTSDTHYAPVKARn..rnGYYQLGLIT...G........ADKLTKWFLQIAYEAESK..VSSA.KFEILE..NEAD.VKVMGQG...I.Y....EDY....SKAL....DKSLK.L.TKGFMIGSVTLFIIT-l...........................................
T0MMW3_9EURY/2-497                   ......................................vwdiisp----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--RILKFK........FPVPRA...LFLNL..VSLYIAIVFYFILIALHFLQ.................---PPVALLLS...........................ITTVP.FLRAMV.Y.VA.FAGKSPVVVH...........LLAISFSLFFSLFVVIIs....................................pRYDIFVA..PLILSSIVYS..L.ASNL.F.......VKLSVSGFVKEF.STDPMKILREFVNTVTSD.iSYNVi.lKNFFE..DM.yTTLAPREVSLVRFKS.........A..................-.....D..H...........GFTMV.FPYVHPGPLGDLGSSNIT.AKLQRR.HSDQ.........................nLL.VFHTTTTHDDNCAGDSEIEKIS....KVLDENG.KKYS......YS----..--Y......EPFFG..K..-....YLTFLPIGD.GGIFFLSPDDPRFDDVKISEGRKIVRKAKSS..GLKWAVTVDQHDNNMDEPME.....----....LKDVSYLLEEVEQAVK--..GRKNK........RTLMVAQSNASV......DA..----.KD.IGPGGISFVSIS..VG.A.......................KKLAIVLVDGNNMRL.DIR...QKIEGSLPG..YD-.......................RVLVCTTDNHVVNTNGL.....NVNPVGTFS...H........HDEIVKIVKELESKNQQQ..-KEA.GTEYVK..REIW.LKVAGEN...Q.W....EKL....NAVI....RSSVN.K.AKVLSVASILVSIALS............................................
A0A256ZBC3_9ARCH/1-89                .......................................mvnaiv----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................------------VT-ER.....GYHPLGEII...N........HQKLIKHIKDAVKQALEN..LEPA.EVSWSR..TTIRnVKVIGDH...Q.I....NRL....SVLV....NEVVE.R.AKRASVIVFPV-----igg.........................................
A0A166B1A7_9EURY/7-598               .............................................VAGLSKYITT...LPTVG...ISIFT..MIF.IS.FISGTIDFLINPnnplsil..............ekivyggSFGFGVFG.IS...SILSG.V.I.V.EQ.WVSSMKGI.......nLKLKHS...MFLSL..SNMVFLSFILIIGSASSLLF................hGDFRINTILFG...........................CVLIY.AFSILV.L.WS.TTSIGFLKSA...........LISCFQPLLVICMLVVTvflnna.........................anlpqleF-LTLLI..KIVVANLIFI..L.AIYS.F.......IKVIESPLKKNL.GVGLLDLLSLFIAHINEG..SFSL...EQLFE..KM..GEPITTLIGILSFRR.........L..................D.....G.tI...........KALFL.SPCVHPGPIGKIGGANMP.TILSKR.FNAF..........................TL.VAHGPSTHDFNPVSIKEIDKIE....DAVKNGL.EKIH......YSNYGS..KFI......RYEEK..K..S....KIGVQFFGD.DALLLSTFAPYGSDDIEFGVGLSVLNESKNN.pAIRDSIIVDCHNSFDEDSGR.....VLPG....NPEVFQLLDTVSKIK---..KTIKE........KGIRIGCGNHLM......ED..LDKN.QG.IGDSGVKVLVVD..AG.G.......................EKTAYILYDSNNMKR.GFR...EKILNSLKT.eGIN.......................SVEVMTTDTHSVNTLSK.....GYNPIGLSE...-........EDKIINYTKIAVKKAIED..LEDI.EAGIKN..ERIIdIKTFGPN...N.S....TEL....ISTI....SSIVS.V.SKIIAPLIFVLAILF-v...........................................
A0A1D2WN61_9EURY/7-597               .............................................VAGLSKYIKT...LPKTK...FSIIG..MLI.IS.FLIGSIYYLIDLnptmgil..............edfiaggLFGLIVFG.IS...SIMSG.A.L.N.QQ.TISVVHGI.......nLKIKHS...MFLSV..LSMTILGIIIIIGCIISQIL................kIDLFLNSMLFG...........................CVLIY.GFGTLV.F.WA.TSKVRFVTAA...........ITGLIQPLLILAMYTLItflfid..........................tsfigpAILQITL..KAIVAAIIFV..M.AIYA.F.......IKVIASPFKKNL.GIGVLDLLSLFIAHMNEG..SNSL...EGLFE..NM..SEAIDTIVTFVSFKT.........E..................N.....G..I...........KALFI.SPSVHPGPLGDLGGSNMP.TLLANK.FDHF..........................TM.VAHGPSTHDFNPIAVSEIDKIE....ESVRNGL.KTVE......YSSNAS..RFI......RYNVE..K..A....NIGVQLFNK.GMVILSTFAPDAVDDIEFGVGLTMMAQSRSR.cNVEDSIIVDCHNSFTPESGE.....ILPG....NSEVFQLIDVIDTI-N--..PKQGR........YDVKVGCYEDNL......ES..LDKH.DG.VGDSGIKTMIVE..VG.N.......................QRTAYVLFDANNMEI.GFR...QEIIDAVSD..--Le....................idEIEVMTTDTHTVNTLSR.....GYNPIGIAK...-........RPEIIEYVRISIEEAIKD..LEKV.EVGTGT..EKIEnLNTFGPK...N.S....TEL....ISTI....SSVVA.V.SKIIAPVLLITALLI-a...........................................
A2SRZ9_METLZ/7-568                   ............................................t-ESLTKYLFD...APKWG...LSLGL..IIL.LG.LIADGVGFLFTGk.........................iwWFG-FAFS.IP...GVAAL.I.L.T.KP.FVSATARQ.......eFTWNRS...GLLAL..ASEVFMLLWMITALFLG---.................---VGFAYVFG...........................VGFIL.AIRLVV.L.AA.VADYRFGRMY...........APAAIQTFAGAIVGVWY......................................FGPGFII..PVVVSIVVFS..V.GVIV.F.......LLLFDLPMKRTS.GVGAMHFVNAFLAHLTNG..SNDM...EEYFH..HI..SEYVSVPETTFFFKR.........A..................G.....K..P...........DVWFV.IPNLHPGPMAEIGGSNFP.KILHDV.FADDa........................vVL.VSHGCASHDLNLISNRETKSIT....KAIRESL.DSVT......YTGLAS..RPV......RTSFG..T..V....SILSQRFGD.SLLMITTRSPEMTEDMDYSIGRIVMGESKGR..-YENIGFVDAHNCMTAVTNI.....IYPS....TKTGNEFISGADEAMNKM..LDAEM........LPFCVGAAQVIP......P-..FGRG.EG.FADMGIIAMVTE..VG.G.......................VKTAYVLFDGNNVHL.GVR...EILQNAVLG.lGID.......................EVEILTTDSHVVNSVS-.....GRNPIGDAV...S........PSEIIPYVAEAVLKAVED..LSTA.SGGAAT..NMCEeVEVFGPS...R.I....VQL....TSTV....NAIVT.N.LLPLSTLLLTTAFLL-i...........................................
A0A0P9HXU5_9ARCH/16-601              ...........................................vr---RYSSLFT...LPSYG...KIILL..LFI.SC.LLGGVLAVLPVHps.......................yygVASGMDLG.AS...VLFIT.L.L.S.DF.IIHYSGMRrd....pvLNRRRR...LALSI..FSNLVWFCFIFIGGVIGVFLk...............nPEIWAKGFLLG...........................FCAAL.LLRLLV.V.LA.TSFVDRGRAF...........LFAFLQPASCIIPLFLMetv...............................igyrLGANAFI..FLSVSTPVAM..L.TVFI.F.......IYLVDRIGTKTL.GIASLPLFKAFVANWTEN.lNEPL...ESLFE..GL..GDEQSIKISMLAFRA.........N..................K.....K..M...........KALLV.VPMFHPGPFKNVGSSTLP.QMIQEA.LENKlq......................cvVS.VPHGLSGHGLDLPSQLQNGKVM....EGILKSV.NFST......FASDAT..PFT......RVQNN..-..A....SSSCQIFGD.CALLTLTVAPKTMEDLPQELDLTIVNEAEKR..GLSTAIVIDAHNSIEGPFNL.....----....SEAVKGLRKAAVNSLEEA..MVCQR........SSFDIGAAKVIP......KE..FSVK.EG.IAPGGISVIAIK..VG.D.......................RKAAYITIDGNNMIS.KLR...ERVLSMLQE.iS-V......................vDGEVLTTDTHVVNGIVLt..arGYYPIGEAL...D........QNKLIGYIKEATLNALGN..META.EASWCI..ETISgVKVIGEK...Q.I....GTL....CLLA....ERAAK.Q.AKRIAISLFSII----gill........................................
U2YST5_9EURY/8-617                   .............................................LAALSRFIFR...APNWY...ASLAF..SLL.VA.ALAGVAAFTASYpl.......................edvWQGVFYVG.IP...TVAAS.L.L.T.TP.VDRWLDGQ........LTYNRS...SLLAL..CCELLVVALLAVASVIAVLTr..............lgQNFVFDVLIAA...........................LALVF.ALRLLI.V.LA.VSRNSLLLAA...........VPASIQTVTAGVLLFVYsgtmryltidvplln........aylsrpqsapsrlllVTPDDLL..LLVGMSVLYA..L.VAYG.F.......IRTIDRPWRQSL.GVSGLDFLRGFIGHIAEG..TREL...EDFFE..QI..GEDAIVPVTVLSFRR.........P..................D.....G.dE...........KARFV.LPMIHPGPMGEIGGGNLP.QRVAET.ADGL..........................AF.PPHATAGHDFNLVTEQEVDTLV....DAAERAA.ANVE......YGRDAT..PSV......RTTHG..D..A....SLLGQGFGDdGALLAATFAPAFADDVEYAVGLAAAAEARRA..GLNDVLLADAHNSNNGLQGEdl.ghVVPG....SRRSFNLIEGAGDLGGRL..ADTER........APLSLGVAWDRT......V-..WTPQ.EG.IGPLGVRVAVTE..VD.G.......................QRTCYVLVDGNNMEP.GLR...GDLVGDLVD..--Ahgf.................ardAVEIMTTDTHIVNTVK-.....SENQVGDVL...D........EAELRDLVGDLAGDAIAD..LEPV.EAGVAT..EHTE.VTVFGND...R.T....ETL....ASHA....NAVIA.L.GSVLGAVVVAVTVLIS............................................
A0A0A7V0Z7_9ARCH/10-577              .........................................ihdk----YTLSLI...NPSSH..yISLAA..SIA.IA.GLIGAFTASTYL...........................gSTE-LIFP.TL...AVIAA.L.V.G.TQ.FLDILFAK.......hREYSKS...LHVSL..FGNGLFFVSTLIGYGAMGLFe...............kDGLDLFYVTMG...........................MVVFA.SFRIGI.F.TT.ILGASLKKAW...........AVAFIQPMAMYLVLVPSd...................................mwISSLTNP..WIILFGGAFL..G.LATA.W.......SYLTDKAGRPGL.-KSTHELIQAYVTSMSRK.dPAPL...EEIIE..KS..STESTVSTSQLKFQS.........T..................D.....K.dN...........DFRIV.LPDIHPGPFHPIGGSNIT.GLIYKE.MDST..........................AM.VMHSISNHDLNLPTQKEVQNYL....QSLQQSK.SKQN......-GAVCT..EPV......SVTMN..K..A....RASGLLFDR.TALLFLSLSPHGMEDLPPNVRSEIEQFAENR..NFEQVLIVDTHNAMGKEIS-.....----....KEDSEDLLLAAKSTLDTL..KTKES........HSFKFGFENSEK......MN..LNQ-.ND.IAEGRIATLCLE..IN.N.......................KNYFLGWADANNMEN.GVR...EQIVTHFAN.nGYE.......................LIEICTSDTHYTASGARn..rnGYFQLGMVS...K........PNDLANWYLELAKNAESK..IKEG.TFEVLE..HQTN.VKVMGPT...I.F....SDY....SKVM....DKTMS.I.TKWCLL----------adaglfams...................................
S5Z778_9CREN/9-539                   .............................................FRSSYRWLIR...LPKTL...HLVVF..AVI.MA.TFSLALSWIMH-............................-ISTLELT.K-...SLVYA.L.F.P.PA.FLYLVNRR.......vFNFRRS...LGVFL..IYLVFLPIVILLGKSPV---.................-----------...........................YGAVF.EVLLGL.L.LA.VAVYSVHLGA...........LYSALNLVLICFLGFDT......................................-------..KLLYATLIFY..V.FSLI.I.......FTIIDSRIRRIA.GVSSLGFLEAFLRYILSG.dHIDV...EKYLE..KI..STERTLPIHIYSFHS.........R..................G.....Q..E...........IGRLV.VSNVHPGPLRTLGSSTLP.QLVKQC.SKVP..........................VL.FLKAPVAHSENLATVEATSRVA....SAICGAQ.VQPR......ASSGW-..-AG......EYTTS..L..L....RITVLGFGD.IPRLAFLDPIVIMEDLPYRVSELSLEEL---..---GTVTVDNHNMIADGFLK.....IENE...qEDEIAKIIAAVRTATE--..NKITE........GKIQAGFSSIDY......TD..---N.IT.IGPAGIACAAIS..IG.G.......................KRFLVASFDGNNMEP.DFK...ARLVSRLGN.mAD-.......................TVIVTTTDTHIYTGLYQg...rDYYPVGSVN...-........PEQVLEKAVKCAQDALAS..LQEA.EVGYTV..LSVR.DKFMDGE...K.L....DKI....SVAT....RKNTR.D.GLLLVFLALAISVL--ll..........................................
A0A0M0BLK5_9ARCH/3-352               ......................................sliyrde----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........S..................S.....G..C...........KAALV.VPYIHPGPFRNVGSSALP.NTLSME.LGKRlg......................ceVL.VPHGISTHERDLTSSDETARVA....RVVASNL.PIGE......GAKAAS..PFV......RVVRH..G..A....KASCQMFGD.VALVTLTLSPKSHDDLPEELSDRIMEASS-T..MGVTAAVVDSHNSLLQRDEL.....D---....DSDVENLFQAAVEAIKRA..KEGGL........YGFSVGVARAVP......SE..WGLD.DG.MGPDGVAALAVR..LD.N......................nQTCVYVIVDGNNMRS.GLR...ERIVDALRS.hGID.......................EVEVLTTDTHVVNAIGAt..srGYYPIGERM...D........EGKFMEYVVNAAESALLR..LGEC.SASHAR..VMVHgLTVLGAV...G.L....ELL....NNVL....ESAFD.L.FKRTALAVTPPSL---lla.........................................
A0A256IE19_9EURY/8-292               .............................................LAGLSKFIFR...APRWP...RTLAF..AVL.LG.GLTGIAVFDSAStmgstyp.............vllvgqdaWQGIVFLG.AP...TVVAA.L.T.T.TT.VDRALGGS........LTYNRS...ALLAL..LCELFVVVVLVVAGVFAAVLg..............lsQRFVFDALVVA...........................LASIF.ALRLLA.V.LA.VSRVSVPAAS...........VPALVQTAVAAALLFVYggtarllidggsayea.....yvvflsrtdhgppvfdaVTLDHFL..LLGALCLLYA..V.AVWG.F.......LVAVERPWRRAL.DVSVLDFIRGFIGYAAEE..SRDL...EEFFE..RL..GQEAVVPVSALSFRV.........I..................E.....G..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------ddag........................................
A0A1Q6DTA7_9EURY/11-583              ............................................s-ESLTKYLFK...APYWP...LSLAI..SVG.FS.LIVGAGVLRTGSsfsl...................ildgvYRGFLLIG.LP...AILSS.L.L.T.PY.VAEALGGN........MTINRS...ALLSL..FSSLIIGLFMVFALFLQYFG.................YQLIYDSFVMS...........................LGVVF.ALRFLV.L.VA.ISDRRVINSS...........VPAFLMSFFGAIFLFLF.....................................vKELQYYL..ELLISSIIFG..S.AFYL.I.......TFYMDAPLRKAF.GINGLDFLKGFINYQNSG..VKEL...EKIFD..EI..GEEVKAPIGTIAFKK.........G..................E.....E..I...........KAVIV.SPSIHPGPVGELGGGNLP.YTLARE.IENKfn......................ctAL.IAHGAATHDFNLVSSKETSKIL....DAVYGSI.ESME......-FGGGS..ESI......REKEG..D..V....KILSQRFEG.GLLNISTLAPNPSEDIAFPIGYSTILNARLK..GAGDLVFMDAHNCYWEELKG.....VYPG....SPTSFDLIDASAKATDKA..LEKEL........DGVKVGVSTSKL......D-..FSWE.EG.FGDLGIRVVLVE..VK.D.......................QLTAYVFMDGNNMEK.GLR...ERILNVLP-..VD-.......................HGEVLTTDNHVVNM-K-.....GDNPVGRNV...E........FDEIVREVEFLFKEAKED..LEPV.EAGVDT..RMAEdIEVFGSD...M.A....AQL....ASTA....NAIIA.M.GGGLALAFIVSALALS............................................
Q6L2E4_PICTO/7-557                   .............................................LAGLSKYIRH...SPEW-...YYFIV..PAF.IL.LLIDYLILGNA-............................YFVAIVLL.PS...YILLN.F.L.D.YI.FIKISRSQ........FPVYRL...IYFDF..ASFFISNLFFYAAYLLNFVI.................GINILYMTMLA...........................ISFAA.FFRFLI.L.YI.YFPNRTLSLV...........ISSMSYTFSFIIISLIFyy..................................kyLKVVYFI..PFIISSLIYV..A.FAIF.F.......IRFSTSNFYKRY.KSKPAELINFFISRSQIG..AVA-...DNFFS..KV.yNKIREIPVKTVDIRS.........N..................G.....K..T...........KVLMV.FPYVHPGPYGNLCSSNLP.YKLSAE.LGLE.........................nIM.VFHTATTNSNNCCGKEDIKNIA....GAVKSSL.KKIN......YSSKIS..KIE......KLRID..G..Y....SMSMFRFGN.YGLSAIIPDEKKFDDISLKEGLKLIKAMKNV..-SEDFAVIDAQNCFTRNAPE.....----....LNDLSMFLNSAQRLFK--..SMETK........YDAMIGFASVKS......NI..----.ES.LGPLGIQAITLK..TD.N.......................-YQSIVLTDSNNITE.EAM...NLVRSKFD-..--F.......................DVEIYTTDNHLANASNL.....DVNPLGAKD...-........PQQVADAIAEAVKKSIND..IEPV.EMGMGT..SYVK.VRMGEEN...S.F....QIL....INTV....ISSLK.R.AKYSIAVVLLLSIITS............................................
A3DP52_STAMF/10-541                  .............................................LSKYYSFIFR...LPGIY..aVLLLI..ISV.NV.LFFIHVGYNIL-............................-----VYI.VY...FILVF.L.I.V.-S.VYGILSNSp......yKRLKRS...LFLAL..ITETYAFIIGFFDIGLG---.................-----------...........................IVSST.VMIILG.I.LG.VDGTSIGKYI...........-LSIIPPLLVLIIFNMY......................................-------..--SYIPLLIV..P.IFLD.Y.......IIYKVMSIHKIG.SYPAPDLGSMFIRNILEK..KRDI...EKVFK..DL..GVEETVHPRIIYN--.........-..................-.....-..N...........NELFIlYSDIHYGPFSNTGSSMLP.TLLYEK.LKHRy.......................gsVV.VLHGMGSHDRNISTFDETIKFV....EYIIENT.DDAN.....sEYIKFY..DYE......RISDG..E..W....DLLILVFNR.LSIIFISR-NEGIDDLPYDLQMEYELKAVHA..GLGDLILVDCHNHELES---.....----....KPNIEALRKLLDKAINKI.sEIKRN........NNEKTLIYRAKT......IK..---A.RS.PGVIGSRITLIQ..LG.Gd....................peKLLTLIYIPGNNMEP.GLR...EKIRSVLSE.kYGVv....................ekRIEVFTSDEHTETGIYSs...tIYIPVQYND...K.......lLTAILKGYKDLLEKEFKK..----.DLKYKK..LSVK.TKLMKNT...A.W....KLL....ELVH....NSFKL.S.FILIWSYVLLTPLIL-f...........................................
A0A1D2RDD2_9EURY/4-518               ............................................a-RKLTKYLVKa.rFPSVG...VMLLL..DLT.IP.LAFAAVIALVLHd..........................nLVDMLAMY.FI...LFSLP.S.I.L.AT.FIPI----........VRRDYS...TAINL..ISLIIEVIVFTGGMLIA---.................EEFWVSALLIG...........................YALSF.TLRYAV.F.MG.LGVSSKR-AF...........TASALRLLLSFCIFYIWdifi..............................adiqMTIKDIA.rRLVAITALLA..A.IALL.F.......IYLISLPVRRVT.GVNPFDLFASFMTDWFQG..TATI...EKYLKstEI..SEKTKVFLDIIIFKNfkesfiknkE..................K.....K.rL...........NAVFI.ISYIHPGPFGSVGSSNMP.HLLSER.VGKEfn......................aaCF.VFHGSCSHDLNLVSRDDLNLVI....DEVVGSV.DEFA......KNPTFC..NIS......RVIED..-..G....DVKAQRVGN.KDIVFVSG---FEGDIDLGVGLASSD-----..-----IFVDCHSSGETVMKS.....IAAS....SEEGMKIIEICRDAREKL.eGCELT........GDISLGIANSKI......EN..----.EA.VGQGGIMAGVLD..IK.G.......................QRIAHILIDSNNMEP.GLR...EKIIDAVKN.eTKA......................dVAEVMTTDTHYVNTISG.....GLNLLK---...D........DPEIIELCVKLVKKV---..----.------..----.-------...-.-....---....----....-----.-.----------------cnl.........................................
A0A256IE19_9EURY/318-662             .......................................dparlg----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....A..E...........KARFV.LPMIHPGPLGEIGGGDLP.RRVALS.AEGI..........................GF.PPHATAGHDFNLVSESEVDCVI....DAADRAL.ADAT......FRREGT..VPL......SVEAG..E..S....SVLAQRFGD.AALAVSTFAPGSADDVDFAVGQSARAEFRSG..GAEDVLLVDGHNCHTGLSGAdl.ghVTPG....SERSYDLYKAAGSAGRAT..ADADR........GRTELGVAWEPT......D-..WTPE.EG.IGPLGVRVAVTR..VA.G.......................VEAAYVLIDGNNMVP.GLR...EDLLAAVRE.aTGI......................dRAEVMTTDNHVVNRTR-.....ADNRVGEEI...D........ADRLAETVASLAVDARED..LEPV.AVGGGT..EHAT.VTVFGND...R.T....ETL....ATQA....NAAIS.L.GAALAAAVTLFAMSV-s...........................................
A0A133UM11_9EURY/4-535               ............................................a-EKFKGILFS...SPSPN...HSLIT..IFA.IG.LVFGFFCSTIGImdfhk.................nflissLGFSLIFI.LP...AVFYG.G.L.T.SY.LIRY----........YYRRRA...LLLAL..LNEVLVFI----GLLFF---.................-KFFEPMLLFF...........................LGFAY.SINVLS.I.AG.ISNRKGPTPL...........LFPLLYFIPILSGLYLG......................................--NVFIL..TIFKVTAFFGigV.ASLS.L.......VYFVDYLFQMNL.QVSASQLFTYFL---NEK..PKNL...-----..GF..GTEKNVLLQGLKFKT.........G..................-.....K..E...........TYILS.LPWLHPGPSRQLGGGSLS.YSLIKN.LNEKg.......................nkGY.FWHVPSSHEEDPCDPRIFEKII....EKPQFEN.--SA......FEGKAT..KLL......KRDND..S..F....EIYGQRFGD.--IYLIFSNVEKIDDFEISIFQKIREQTG--..--KKIVFVDMHHHEPSETGK....iLLKN....EKLTDELSRTVLDLLKDL..ENEGQ........FEVKIGMEVSR-......--..----.--.--DNKFMVLVEE..LN.N.......................ERYLLITMDRNGIPE.KLN...DELENIKRDnrFD-.......................KFLFLTTDTHENFNF--.....----LD---...A........KKEIEFPSSELITKALKK..TSKA.EISLTE..HEIEnVRVLGKK...S.Y....IFE....TAS-....----L.F.AMYLFPALMLLVFLI-ffliii......................................
A0A1Q9MWP3_9ARCH/2-112               ......................................nlleskg----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..FD-.......................RVEVTTSDTHVVARVLSr...rGYNPIGVKT...S........INYLLGKIDHLVDEAVKN..LEPV.EYAAFT..X---.-------...-.-....---....----....-----.-.----------------xxxxxxxxxxqdyfdsiviptiqkclsvsrlmltvgiilpmffs
A0A256YUI0_9ARCH/439-528             .........................................igvv----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-------------MVDR.....GYYPVGEAM...D........RERLFWYIEKAVRDALGN..MEPV.SVLWCV..EVVPeVRVIGEK...Q.I....EDF....SLVI....DAVFQ.R.MKRTAAVIIPSFA---ailt........................................
M0M0V3_HALMO/8-611                   .............................................LAALSRFIFR...APQWY...ASLGF..ALL.VA.AVAGVAAFDSRFil.......................edaWEGIFFIG.VP...TIVAS.V.V.T.PP.VDRALDGQ........LTPNRA...SLLAL..VSELILVAFLVGAGIIAVVTp..............laQRFVFDVLTVG...........................LASVF.ALRLLV.V.LA.VSRKSLFIAA...........IPAGIQTATVALLVFVYsgmmrffevggplvl........sflsrpnrgpaefaaVEPLDFA..LLALLCLLYA..V.GVWA.F.......VTVIDQPWRRSL.GVSVLDFLRGFIGHIADG..TREI...EEFFA..SL..GEEALVPVTVLAARR.........P..................D.....G.tE...........KARFV.LPMIHPGPMGEIGGGDLP.KRVAES.TDGL..........................GF.PPHATAGHDFNLVTEREVDTVL....DAVARAS.ERIE......YTETGS..ASR......RATVG..E..A....TVTGHAVGD.GALFVATYAPNFADDIDYSVGLSAAAEARAH..GLSDAMLVDAHNSNNGLDGPdl.ghVVPG....SQRSFDLIEAVGEVAGDL..TGAPR........EPLSLGVAWDET......P-..WTPA.EG.IGPLGIRVAVFA..AG.D.......................ETTAYVLVDGNNMEP.GLR...EAIVGRLDA..VD-.......................TAEVMTSDTHVVNTLE-.....STNQVGGAI...P........HDELIDRITSLVEEALAD..CEPI.EAGMAT..ERAR.VNVFGND...R.T....ETL....ASHA....NAMVT.M.GGALAGAVTLALFTIS............................................
A8AC28_IGNH4/1-283                   .........................................mntl----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.-LKYYKLL........VTLPRDevaYALAA..LSASALSLRDPLTLLSLIVF................sILFYEERVLNG...........................RRLAF.LIALSS.L.AS.LAGKRPLAALfe.......gvAAALYSPNPLLILLAPN......................................------V..LYLASPEAVI..A.LMPV.I.......LAVVYGKL----.-VGTVDFGIAWLRAWMGD.dYWPL...ERFVH..DR..GRTKEAK--EIRV--.........-..................-.....-..-...........-GPLV.FTDAHFGLMRYSMGSVLP.HLMALN.---G..........................AV.PHRLCGSHENNPASRWEAYALV....RGLKHGR.EGK-......-----A..ELT......KMKGE..G..V....NVYVYSFEG.GCVAVVEH-PSGADDLPC-------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------vewrcevadphnaegp............................
A0A0F7FI79_9CREN/9-544               .............................................FRKSYRWLFS...LPSLW...LVLLY..NIL.LL.LVAIFLGLLKGY...........................eLNSLLVAL.AS...IAIPF.T.V.T.FI.IDRRV---........LTLKRL...LGLYS..IYLVFLFPVILLGKQLL---.................---------LA...........................TIPFV.LLSFLV.F.LA.IARRTALASF...........LA-------AYLSTIYF......................................LQHQFLL..YVIIPVAVYI..T.VAFP.I.......LYNINRRVKLVA.GVGGLKYLRSFLRYTLAG.eKKEV...EECLS..AA..AVKKTVPIHVFELYS.........D..................G.....V..L...........LGRIV.VSGVHPGPLRTLGSSTLP.EAILEK.C-HS..........................AL.FLKAPAGHGENLALSRDVEKVA....EKVCGET.SRAE......QTGSAT..--L......GVADG..K.lV....RSISLRFSN.GVSLCLLDPQVSMEDLPATLREEFEE-----..--DHVVVADLHNMIDDNFIQ.....-LPEd..pQENPELHLDVKQTILESL.rDVRAE........GVLKAGLARVKY......SD..---K.LS.VGKGGISCAVFS..ID.D.......................KKLAIVSVDGNNMDP.VFK...ALVNRELAS.gLD-.......................YLLLATTDTHVMTGLFQg...vDYYPVGSLN...-........KEQILRNIRDCLLEASQN..LKEC.RVSYRV..VPVN.ALFMDGS...K.L....KGL....SRVT....RLNVR.D.GLLLAMLALLSLPI--lll.........................................
V6ARL2_9ARCH/11-578                  ..........................................ihr---RYSLTLL...TPSSH..kVSLII..SII.TA.IITSAIVVAVYL...........................gRADEMAFR.IP...AAIAV.L.I.A.TQ.YVDSRMIK.......nKEYSKA...LHMSF..FGNFLWLGIILCGIAASVVLs...............kESLSLFYLTEG...........................MMIFA.SFRLGL.L.TT.TLGLSLRKAL...........SLCFMQPLGMFLALVPVa....................................mWPESFAP..ATVAMGAVFI..V.VASV.W.......SVITDRAGRPGI.-ESTHKLVQGYLASRSQS.nFHEV...ESILS..SK..AKPSTVITTQIKLQS.........S..................-.....S..R...........DFRMI.LPDIHPGPYYPIGGSNIT.YRIYKT.LNSS..........................AM.VMHSISDHALNLPSQEEVENYL....KGLSVES.-SIG......KGTTCT..EPV......TIQVN..R..A....RVVGLLFEK.TAVLFLSLSPHGMEDVPDYIKKEIEQFANNR..NFQRLFVVDCHNAMGKEIS-.....----....EHDSQDLLKAAKTALETL..ITKQG........GTIEFGYANSEG......MN..LNI-.KD.LGPGGLGVLCLK..IM.G.......................SKYYIAWADGNNMEN.GLR...EKIVEEFAK.nNMT.......................LLEVCTSDTHYSSQIVRt..rdGYYYFGKIT...P........PEQISAWYLEIAKKAERQ..LEPG.KFEILE..QKSN.VNLMGMS...V.F....EDC....SRAL....DRCIN.I.SKAFMAGSVAYFV---vtlf........................................
A0A0W1RDB4_9EURY/549-663             ......................................gadpaka----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...ERVVSDGGG.lVD-.......................TAEVMTTDTHIVNTVK-.....ADNQVGAVI...D........HDELRSLIRRLVSEAAAD..CEPV.EAGMAV..EHAE.VTVFGND...R.T....ETL....ASHA....NVAVS.M.GGAFAAAIACATILVS............................................
A0A0M0BG67_9ARCH/1-556               ....................................mivffinem----------...-----...-----..---.--.---SLLGIIKGM............................YFGAISLS.LS...SLIAD.I.I.S.YN.AFMK--KDt......fFSLRRC...FALSL..LTCVIWLFSILIGFFFKSIN................sFNIPEDSFHLG...........................LFIVL.PIRSIS.I.VS.ISKSNLFGKI...........IYSIFQPLLCVFLTIYIl...................................dmSLYNSLL..IFITSTILSL..I.AACI.F.......LSYIEYKGMKKI.GISPFGAFNAFLLAWRDQ.eSYLL...ESFLE..KI..GVNNKISIAALQFRS.........K..................K.....SknL...........NGLMV.VSNFHPGPFMNVGSSNLP.FLIQKY.FEKRie......................gnVA.VPHGISGHEGNLTSQKENEKVI....NAIEEIL.NSCN......FSNQAS..TMI......DVVKG..H..T....IIKCQRFNE.NLIITLTQSPEDMEDLPKDLGLSISNYGRNF..-FKNIMVIDAHNSISKVREY.....T---....DKEINNFEKAAYEAIEKI..IKSPL........EKIKFGSAKRVI......HN..FTLE.EG.FGPGGLIVHLIE..VK.N.......................KIAAYITIDGNNMVP.ELR...NKILNMLKE.qGIA.......................QGEILTTDSHMVNGFISs..glGYHPIGEAV...D........QEILISHLKKAVKEAKSN..LEET.EVAVGS..TGID.VKSLGSE...M.L....DNL....TSFM....YGIAK.L.VLAFIILLVIGSFIL-g...........................................
A0A256LCP7_9EURY/1-308               ............................................y----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................----L.INILVL.V.IS.TGIDHYKRIL...........FVGLAEPAALIAAFYALggs................................dlgFSTYRHV..FAFASLLIAA..G.FLVL.V.......LLVVDYLIKSNT.DVSAFALTSGLL----RN.dRESL...-----..DL..GVEARPSVETFAVDN.........G..................-.....-..D...........RLTVA.APWVHPGPLGGFGGGQLSgNLIDAL.NDGReadgaergrgeaatdggvgaaadgsaGF.FFHVPCTHKEDLSNPADAERIL....DAVAAPE.RTER......TSRLVT..KSY......GEREGyaD..V....RFHGRRIGD.--KEVIVLHGEGIDDYDTGVFMRDVDN----..--DEVLLIDQHRHDIQNGPDv...eIQYG....SAEADRLKRAFDEFRERL..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------ad..........................................
A3CTU3_METMJ/9-571                   .............................................VERLTRYIFS...APSWP...RSLGI..IVV.LG.LIIDIATYRPGNe.........................lfLVGTLGFT.IP...ALVAF.L.L.T.VP.LVRVSGKQ........ITHNRS...ALLAL..ACTVITVILSLSPVLVFG--.................RELFPTLYAGA...........................LGLIF.GLRLLV.L.VA.IADYRISRMV...........LPAFVQSVVGIAVGAWF......................................FTPGFVP..YALLLQAVFG..L.GFVS.L.......IWLIERPLKRAF.QISGLNFLNTFIAHLTDG..SKKM...EDFFR..EI..GEEVYVPEVSLFFSR.........D..................S.....G..K...........DVLFT.VPNVHPGPMGDVGGGNLP.RILHDT.FPEE..........................TL.VAHGCATHDFNLVSESEIEKIA....RAVEASR.EGLT......FSAVAS..RPV......RVESG..S..V....SILCQRFGD.ALLMVSTRSPERTEDLDYSVGMAIMAEGRCA..-FSEVAFVDAHNCMTSVGSP.....VLPA....TRIATEYIAAAREGFRVA..RDLPL........EPLAIGVSHVRV......P-..FTRE.QG.FGSLGVQALATE..VG.G.......................KRAVYVLIDGNNVAR.GVR...EQLRAVVLD.hAD-.......................EGEIMTTDTHTVNTIS-.....GKNPVGYAV...P........PGEIIPYIEQAVREAFAD..LSGG.RVGSAT..ASCEgITVFGSQ...R.V....SQL....ASTV....NAMLA.F.IAPLSFMILVLAFLLS............................................
E6N3Z7_9ARCH/9-578                   ..........................................iae---RYRLIRGf.yGGAVS..lEALLV..MAS.LS.TVIIYLYSAD--............................VLVAAAVF.AA...FLGST.A.L.L.NR.VVAFFLGIkc....psYTSRRL...DSLSV..VETGVVFAGIMLSALLRWFS.................----LAAAVVV...........................LAASA.ATSVFL.S.YS.VRRA-----I...........-GYRIHPLLAALLSTPPmllntl..........................tlqaflGNWAKAL..QISFTSFLVG..V.VSLE.I.......VRHLIDLSKPIQ.GIRPFRLLQAFLASLLSG.ySREL...EELMM..RL..GNEDRVGCELFVLRR.........V..................G.....K..P...........SVALV.VSDIHPGPFRAVGSSMFP.AILANK.LAEKg.......................fqPL.VLKGLSSHEKNLANIELSEKVA....EKIAEEA.EWLEkn..gaYFSEAR..SPW......RTIFN..G..V....SSLSLNIAD.REVVVLTLNPQPMEDLPPEV-------LPPN..HTGRKIVVDSHNSFSDNLKN.....L--D....NATIEKIRTFLTNSSE-H..KPLPL........SRMRVGYARTVP......SD..VGPS.DG.IGAGGVSCILFE..VN.G.......................VKSSLVVADANNAMP.WVR...GVLQQVARE.nGCV.......................DTELCTTDTHMVNAVSLg..grGYHPLGEAI...S........TERLKTLFDELHKRAASD..LADA.DAAHKS..VTLEnVKVFSD-...-.-....--F....LDVV....SQAVS.F.GVRAYRVAALVAPL--lam.........................................
M0CAK5_9EURY/8-615                   .............................................LASLSRFVFR...APSWY...SSVGF..ALL.IA.AVAGVAAFDSRFvf.......................edaWEGLFYIG.VP...TVVAS.V.F.T.PY.VDRKLGGQ........LSRNQA...SLLAL..ACELITIAVLTAAAFVAFVTp..............lgQEFVVDALLVA...........................LASIF.ALRLFV.I.MA.VSRQRLPVAS...........AAASIQTVSAALLLFVYsgamrymefgggpvara....flfrpdeapariaemqyVDPGKFG..LLALICVVYA..G.CVWL.F.......LTVIDQPWKRSL.GVSVLDFVRGFIGHVAEG..SREL...ETFFE..DI..GEDAIVPVSVLSVRR.........A..................E.....G.gE...........KARFV.LPMLHPGPMGDIGGGNLP.RRIAEQ.ADGL..........................AF.PPHATAGHDFNLVTEREVETVI....DTAETAY.QRIE......YDATAT..KSV......RVEEG..E..A....TLTGQAFGD.SAFLASTFAPGFADDVEYAVGLSAVAEARTG..DLDEVMLADAHNCNNGLAGEdl.ghVVPG....SQRSFDMIDGAGEVGSRL..AAATR........GPFECGVAWDET......D-..WEPE.EG.IGPLGIRVAVFE..ID.D.......................QQTAYVFVDGNNMVP.GLR...ERIVEAVDG..VD-.......................RVEVLTTDTHVVNTME-.....AENQVGDVL...P........EAEIVAAIEDLVERAKAD..LEPV.EAGMET..ESAE.VTVFGND...R.T....EML....ASTA....NAAVS.M.GAPLAGAIITAALSV-s...........................................
A0A0W1RDB4_9EURY/8-542               .............................................LAGLSRFIFR...APSWY...ASLGF..ALL.IA.AIAGVGAFDSGLregtwrg.............lffvgkdaWEGIFFVG.IP...TVVAS.V.A.T.TG.VDRFLGGR........LTPNRS...SLLAL..ACEIVLVGLLTVGAIVAVFAs..............ldQRFVYNVLVVA...........................LASIF.ALRLLV.I.MA.VSRSSILVAS...........IPASIQTVVSALLLFVYsgtlsylevggpilday....lmpyfarseqapdvvsaLTPNHFV..LLGVMCVIYA..T.SVYA.F.......LEVIDRPWRNSL.GVSVLDFIRGFIGHIAEG..SREL...EDFFE..QL..GQEAVVPVTVLAFRD.........E..................N.....G.dE...........KAQFV.LPMIHPGPMGEIGGGNFP.ERVARR.SEGL..........................AF.PPHATAGHDFNLVTEREVDTIL....DAAENAH.ERIE......YSAEAT..KSA......SVDSG..E..A....KLLGQRFGD.DALVVSTFAPNFADDVEYSVGLSAATEARTS..GLGDVLLVDAHNCNNGLEGPdl.ghVTPG....SRRSFDMIRGAGAVGRAL..SDADT........DQLRLGTASDPT......E-..WTPR.EG.IGPLGIRVAVSE..VD.G.......................QRTAYVLVDGNNMEP.GLR...DEIVSDLCE.tVEStt...................peDPEVV------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------sa..........................................
A0A1G7J2H7_9EURY/8-625               .............................................LAGLSRFIFR...APNWY...STMTF..ALV.IA.AVTGVAVFDGRYvl.......................gdaWEGIFFVG.LP...TIAAS.V.L.T.PY.VDGRLGGQ........LTPNRA...SLLAL..TCELVTVAVLMVAGLLVLVTgpvqnlvltepavgalgQQFVFDALLLA...........................LASIF.AIRLFV.I.VA.VSRHSLPVAA...........IPASIQTVAAAVLLFIYsgtlrflevggpimn........sylsrpqaappeltvVIPRDFV..LLGIVCLVYG..G.GVAL.F.......LRAIDSPWRRSL.DVSVLDFVRGFIGHIAEG..TREL...EDFFE..EI..GEEAMVPVTVLVFRT.........E..................N.....G.aE...........KARFV.LPMIHPGPMGDIGGGNLP.ERVARG.AEGL..........................AF.PPHATAGHDFNLVTEREVDTIL....EAADSAI.GEIE......FTDEAT..VSV......RASEG..D..A....KLVGQAFGD.DALTVATYAPEFADDVEYAVGLSAAAEARSA..GLDDVMLVDAHNSNNGLEGEdl.ghVTPG....SRRSFDMITGAGAVGERL..VDAER........GQPNLGVAWDET......P-..WEPE.DG.IGPLGVRVAVLE..VG.D.......................HRTAYVLVDGNNMEP.GLR...GTLVDAIEG..VD-.......................HAEVMTTDTHIVNTVE-.....ADNQVGAAI...D........DDELVAIVTELVDQAADD..LEPV.EAGMAS..ERAA.VTVFGND...R.T....ETL....ASHA....NAMIS.M.GATLAAAVIVAVLAIS............................................
A0A151BBC5_9ARCH/5-570               ...........................................vi--RYYRRLFK...LPGLQ...TILLG..HLS.LG.VLWGLYLGFSLDs..........................vLKGLIAFT.AV...SLASD.A.I.V.YL.LCK----Re.....plLRFRRL...LGLSL..VSNSIVLLAGLTLSPL---Al...............lDISPERVWMAG...........................FPLST.GLRVLV.F.RS.LLFEGVFQIL...........--SVVQPLLCLLVIVYV......................................YGVRLHP..MVFLSMGSAA..L.TSFI.Y.......LQLVSREAKHIL.GLDGLSLFRAFLSSWMEN.lSDPM...EQVME..AV..GVEGSGRLDVLAFKT.........G..................-.....D..R...........ETAIV.VPRIHPGPFRDVGGSSLP.WRIQAL.LERRgf......................daVA.VPHGPSTHKENLVSKKELSKVL....NALNSLN.LEFH......-IQKAS..RPV......RCSSG..Y..A....TALSQVFGD.TALVALTLSPKSMEDIPVEVGSLLEAYGGKL..GFNSVIVVDAHNSILWEKTS.....I--D....DKDISLLIEAGKRALKEA..AEAPL........QRFKLGFSKKNV......EG..YGVR.EG.LGPGGIVVHLFM..FG.D.......................DLYAYVTIDGNNMVS.GLR...EKIVQHLKT.lGVR.......................DCEVLTTDTHVVNATATg...rGYHPVGEAI...D........QEVLLKTISEALKEAYAG..LKPA.SAYHVK..VELNgLKLLGDG...-.L....NKL....LKVL....DMSAK.R.AKRLALRFLT------palaac......................................
V4YE16_9ARCH/1-224                   ............................................m----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------VGLSATGEARQG..GLESVMLADAHNCSDGLNGEnl.ghVVPG....SKRSFDLIEGAGQVGETL..ADAPR........SPLRMGVAWDRT......R-..WDST.DG.IGPLGVRVAVTE..VS.D.......................QQTAYVLVDRNNMEP.GLR...DMLVDAVQD.rVT-.......................NAEILTTDTHVVNSVD-.....ASNQVGERV...E........ATELRSLVVGLLDDAIAD..LEPV.EAGMVT..NRAE.VTVFGND...R.T....DSL....ASYA....NAMIQ.M.GGALAVASVTAVSAI-s...........................................
A0A1F5DF27_9ARCH/1-553               ..................................mafflvnpvfs----------...-----...-----..---.--.-----------Svl.......................hgiVFGIFVFF.VP...SVLVD.I.I.A.SL.IL--LKDDp......pFSFRRF...LALSL..FSCTTWILIIILGTIGHIQLd...............iFVFPQDPFLIG...........................LFTII.PLRSIV.V.FS.LSSKSNLRKI...........IFSLLQPLISTLTVSFL.....................................vVSKITIIwgAFILATTISI..V.PLIF.L.......LRFIERQGKRII.KVSPMRIFKAFLVDWLDR..KNEM..fEAFLK..EI..GIESEIEVTLIRFDS.........K..................S.....NskM...........KGIIV.ISNFHPGPFLNVGSSMLP.YLIQNQ.FETKs.......................iaVF.VPHGISGHENNLVSQEDNTKVI....SAIKTML.RDCE......PSNIAS..VFK......TIEVG..S..A....KVNAQIFGK.CLLLTLTQSPKDMEDIPIELGKEVASMAKNK..-FKHVGIIDSHNCIDQVKMF.....S---....EEELNNLRSAAYKAIE-S..SSATG........TKIEMGVAKHNF......EN..DNPR.QG.VGPGGMRVFLFK..NS.D.......................QLIAYILIDANNMIK.GLR...EKILTSLND.iGID.......................GGEIMTTDTHVVNGLVRa..klGYYPFGEIL...N........QDNIVNSIKKTVKDAQEN..LEDV.TICSSS..KNVS.VTSLGSR...S.L....ENL....TSFM....YNIAR.L.VVRYLGILLLVS----nli.........................................
A0A1J4UXA4_9ARCH/13-594              ........................................sltrg------MSFQ...LPQLR...AVFAF..LLA.WS.FLAGFALHAAFLrlpea..................flfggAAGLIIFA.LP...AVSAA.V.I.A.AG.ALSR--KS........FWSQIKy.fLFTAV..VSTLVVTVIYAIATLAFGFSs...............pKTYVLVELANA...........................--IVY.VIWFVS.L.FV.ALGNDKVRAA...........LIAAIHPIASLALLVLWnkwaiv.........................etrialpF-VLTLP..KLALASAIIL..A.AFWF.V.......FYLFNAPTKRNL.GFSGAQAVSLFFAHWLRG..SREI...EQILD..EA..GADAQTTLGTVAFKD.........A..................S.....G.rL...........KALFL.APNVHFGPYGDLGGSEFP.RFLTER.FDARyg......................ctTL.VFHGTVYHDFNPVSSSSFASLS....TAFDRAL.RSCK......HFESTG..EII......EARRG..A..A....DVAGLRVGG.NVFLTLSPAPYPTGDIDYSAGVALSNAAERV..-FDCVVVADRHNSAGEIEPW....gV--G....SREYSEFENAVRAL----..QPGRA........GKLSVGVAKASL......P-..FSVR.EG.VGGAGLRVVVLR..AG.N.......................KSACFAVFDANNILP.ELR...AKLKTRLKG..YD-.......................FADICTTDTHSVNSPTT.....PSNALGQRA...D........WGVLEKALVDAVAEAEAS..VEPC.SVAVAK..TSYK.TRVLGSS...Q.A....NEL....ITTL....KSIFA.I.LRVLAPAVIAAAILL-a...........................................
A0A1D2R469_9EURY/4-576               ............................................a-RKLTKYLVKa.rFPSVG...VMLLL..DLT.IP.LAFAAVIALVLHd..........................nLVDMLAMY.FI...LFSLP.S.I.L.AT.FIPI----........VRRDYS...TAINL..ISLIIEVIVFTGGMLIA---.................EEFWVSALLIG...........................YALSF.TLRYAV.F.MG.LGVSSKR-AF...........TASALRLLLSFCIFYIWdifi..............................adiqMTIKDIA.rRLVAITALLA..A.IALL.F.......IYLISLPVRRVT.GVNPFDLFASFMTDWFQG..TATI...EKYLKstEI..SEKTKVFLDIIIFKNfkesfiknkE..................K.....K.rL...........NAVFI.ISYIHPGPFGSVGSSNMP.HLLSER.VGKEfn......................aaCF.VFHGSCSHDLNLVSRDDLNLVI....DEVVGSV.DEFA......KNPTFC..NIS......RVIED..-..G....DVKAQRVGN.KDIVFVSG---FEGDIDLGVGLASSD-----..-----IFVDCHSSGETVMKS.....IAAS....SEEGMKIIEICRDAREKL..EDARErlewceltGDISLGIANSKI......EN..----.EA.VGQGGIMAGVLD..IK.G.......................QRIAHILIDSNNMEP.GLR...EKIIDAVKN.eTEA......................dVAEVMTTDTHYVNTISG.....GLNLLK---...D........DPEIIELCVKLAKKASLG..MRRV.RVGTER..VYIDgIRVMGNA...-.-....SEF....ATSL....NFSAA.L.FKILVPVVVVLIII--ai..........................................
A0A1F5D2F3_9ARCH/1-420               ..........................................mcf----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..FLALSPIVSF..F.SVRS.F.......LFLLNRVGEQTL.KIPALSLFKAFLLNWVVG.lNAPF...EEFLE..RL..GEEQDVNVSLLKFDA.........N..................-.....K..P...........KVVIV.VPSVHPGPFKNVGSSLLP.SLLKTA.LEERlg......................yvAC.VMLGMQGHELDLASQFQNQKVI....NHVVKSM.GFET......RESTAT..PSV......KVSHD..L..V....TVRCQIFGK.AAFLSFTLAPNTTEDLPQELGLFVRQESEKH..GLTCCAAVNAHNSINNTLQM.....----....PVALETLEAAAVACLKRA..TLLKR........LPFQVGASTIIP......QD..FSLE.DG.MGAGGITVTTVK..VD.E.......................QKTAYVVIDGNNMVS.GLR...EKILSVLQS..--Ls....................idEGEVFTTDTHSVSAVILg..krGYHPIGEVM...D........NEKLIDYIKEAALKALSS..LEPA.KAACSD..IIIPkVKVIGEK...R.L....FAL....SLLI....ERSLQ.R.ARRVVIPL--------fgsiglvlmlf.................................
U1NGT9_9EURY/8-628                   .............................................LADLSRFIFR...APRWY...ISLTF..AIV.IA.ATVGVAAFDSGAyattwrg.............lfifgrdaWEGIFFIG.IP...TVVAA.F.A.T.TG.VDRFVGGK........LTANRS...SLLAL..ISELIVVTIVVTAAVISVVTg..............lgQRFVFDALIVA...........................LASVF.AFRLLV.V.VA.VSRSSLAIAA...........LPASIQTLVAAVLLFIYsgtlryisfggpllday....mmpylarpergpaelsaISMEHFV..LLGITSALYA..L.AVYG.F.......IMIVDRPWRRNL.DVSMLDFLGGFIGHIAEG..SREL...EEFFQ..QL..GEEALVPVSVLSFKT.........S..................D.....D.tE...........KARFV.LPMIHPGPMGEIGGGNLP.KRVATA.ANGL..........................AF.PPHATAGHDFNLVTEREVDTII....EAVETAA.DHIE......YTAEAT..RSV......RTHSG..E..A....SMLGQCIGD.DGLLISTYAPGFADDVAYGVGLSASAEARTT..GLDNVMLVDAHNSNNGLNGPtl.ghVTPG....SARAFDMINAAQQCGDRL..STAEQ........YPMELGTAWTET......P-..WNPT.DG.IGPLGVRVAVLK..VA.D.......................NETAYVLVDGNNMEP.GLR...GQIVETLVD.eGPV......................dAAEIMTTDTHIVNTIE-.....ADNQVGSAI...D........DEVFIQTLSDLTTEARRD..YETV.TGGMAV..ERVS.VTVFGND...R.T....ETL....ASHA....NVVVS.I.GGAFAVTVALAAIAVS............................................
A0A1H6HZT7_9EURY/6-546               .........................................vdvf----QRLVFS...LPPLK...AQIPA..LVV.LS.LVYSFGMHLAFTvftpir...............ltiplvlVAGSLVFL.LP...FLFAG.E.L.F.HQ.VLPR----........YPRSWS...YFLAL..VNQFVLFVYGLILSGADT-T.................GNAWSIVWLAF...........................ITLHV.NNVLVL.L.IS.TGIEYYKRIL...........VVSSAQTGILIAVFYLFvgg................................algIETYRHV..FSLASVAIAA..V.FVVL.I.......LLAVEYLIKSNT.DVSAFTLTAGLL----RN.dRESL...-----..DL..GFESEPHVQTLSIDN.........G..................-.....-..D...........RLTLA.APWIHPGPLGGFGGGQLSgTVISEL.NAEG.........................tGF.FLHVPCTHKEDLANPDDAEKVL....DAVADPE.----......QVSRAS..RLV......SEDYG..E..I....EFFGRRFDG.--KRIVFLHAEHIDDYDTGVFMRDVEE----..--SSVLLVDLHKHDIQEGPEk...eVQYG....TAEANRLKGHFDDFLETL..EAAPL........HEYEAGFD----......--..----.VH.LDDQDLFAMVEV..VD.G.......................ERTLLLGTDTNGVTA.DMRdleEEYREEFD-..---.......................HVLLFSTDTHASIHDL-.....-------AN...M........KRSNVTAMRRAVENAAAS..VAPA.TIGLTS..RTTRpLDLLKNH...-.Y....NGL....VFSV....NILIR.L.TIISLFLFYFVLIV--wm..........................................
F0TAW7_METLA/7-598                   ...........................................im--GLSKYIVT...LPGNR...FNVAA..MVF.IG.FILGCVVTAVEPstehsvl..............ysilyggAAGVLIFG.LT...SIMSG.A.I.T.QP.MINALEGR.......hMKMKQS...MFVSL..VSMVIVGFIYFIGSLVSKFT................iYSYTIDALIYG...........................CVVIF.GFRILV.I.WG.TSNISFFKSL...........PAAVIQPALILSMVVVIvsltsi.........................stnigyfSIVALLI..KIIVASLILV..V.AIYS.F.......VVIIESPMKRNL.GVGGLELLSQFLAHVTEG..SKAL...EDIFD..DM..GEPIDTIVGIVAFKG.........K..................N.....G..L...........KSLFL.SPCVHPGPIGNIGGGNMP.TQLANN.FENF..........................TL.VAHGPSTHDFNPVSTKEIKKIE....DSVRNSL.ENLE......YTNEAG..KFF......RVQNE..D..A....KICGQYFGK.NLLLLATLAPVGFDDMDFGVGLALSNLARVN.tNAENVVLVECHNAFKGENGR.....ILPG....NKEVFELMGAVDKL-D--..KPGDL........YDLKVGCAFDPM......EE..VSKD.QG.VGESGVKVMIVE..VA.N.......................QKSAYILLDSNNMEI.GFR...EQILEKISS..LDI......................dEAEIMTSDTHFVNALSG.....GHNPVGTKV...-........PELILESVFNCTKKAIDD..LEEV.SVACDV..AMIKdIKTFGPN...H.A....TEL....VTTI....SSIVA.V.SRIFAPVIFIIAFL--sv..........................................
A0A1H8PSM1_9EURY/8-656               .............................................LAGLSRFIFR...APRWY...SSLAF..ALL.VA.AMAGVAAFETGVpertwsg.............lfllgrdaWEGIFFIG.VP...TVIAA.F.G.T.TG.VDRFVGGR........LTPNRS...SLLAL..ACEVIIVAVVTVAAIASVFLp..............lgQGFVFNALVVA...........................LASVF.ALRLLV.I.MA.VSRSSMLVAS...........IPASIQTVASAVLLFIYggtlrlfefggpildaylipyvgqylarsdqapaalsaIQPSHFG..LLGIMCVIYA..T.AVYA.F.......LYVVDRPWRNSL.GVSVLDFIRGFIGHIAEG..SREL...EDFFE..QL..GQEAVVPVTVLSFRR.........A..................DteadaDveE...........KARFV.LPMIHPGPMGEIGGGNFP.ERAARR.SEGL..........................AF.PPHATAGHDFNLVTEREVDTIL....DAVDDAA.ERIE......YTSEAT..ASV......RTESG..E..A....KMLGQGFGD.DAVLVSSYAPAFADDVEYGVGLTAATEARTH..GLDDVLLVDAHNSNNGLDGPdl.ghVTPG....SRRSFDMIHAAGLAGEAI..DDARR........GDLSLGTAWDRT......D-..WTPR.EG.IGPLGVRVAVTE..VA.D.......................QTTAYVLVDGNNMEP.GLR...DRIVTALTD.eSATqtatgrava....adgaapravdAVEVMTTDTHIVNTVE-.....ADNQVGAAL...D........EDELLDRIADLVAEARAD..CEPV.TAGMAV..EEVT.VTVFGND...R.T....ETL....ASHA....NVAVS.M.GGAFAAAVILSAMVVS............................................
N0BBI7_9EURY/7-541                   .............................................IEKFYSKLFT...IPRKR...VSVLI..GII.TI.VFASFLNGTVSKs.........................ffAQRYFFIG.LS...LIISL.L.I.A.SK.LLKIA---........FNSRRV...FFLAL..FILIFVEIFDSIAIHILHNF.................-----NLIIMA...........................PSAMA.TGLTLI.L.FF.TSETEEFKAS...........LLSTTILLSIYPIDYAFs....................................fEAPHRFT..GYVAATVIGV..S.LALL.F.......IKFIDRNYGR--.-FNSKRLLRNFILFWLTS.dPSFF...ERELE..RI..SETKEGFVKCLKI--.........-..................-.....-..N...........DVHLV.TTSFHPGPIRNIGGALLV.EKLLDE.---N..........................RI.YLHSLVKHDSNPSTSRDVEEIV....RKAKNLS.SFI-......-SLKCF..KPV......SVEGE..R..F....KLMAFPFDK.-LTLIFISGKKAIDDIPESINR-----FAEK..IFGECIVVDCHNCHSQGYEM.....S---....SGDIIEILELMEALKEKI..DFREV........NRLRYSLASARI......DG..KSC-.--.---ERVSMLILD..YD.G.......................ERFVLLMLDGNNINC.EFK...SELENFFLK.sGL-.......................QPVIFSTDNHSKTGVSPk...iGYMPVGSDV..aE........RKAIIDFIMRNLGRELKD..--VG.EVGYSH..DTVK.VRVMGED...F.F....KAV....EKMF....VDLGE.K.AIYIFISIVLIQFFTS............................................
A0A2H1EIX4_9ARCH/11-578              .....................................ihkrytlt-------TF-...TPTSH..yVSLAI..SIA.VA.CVIVAVSYIDYF...........................kSTDNLTLA.IP...ITIGA.L.V.G.TQ.FLDPKILR........TEYSKS...IHMSA..FGNLLWLVTILCGILSSYVFs...............kPQLLPIYITEG...........................MLLYA.SFRIAI.F.TS.VLGAKLRTAW...........IICLLQPLSMFLAFVPSt...................................mwISMLTDP..RAIEYGVIFC..I.LGSL.W.......TLLSDRIAGRGK.LSSTHAFLQAYLAAWTNN.nPEPM...EYLME..KR..SESSKVSTFQVLFKT.........K..................N.....-..H...........NCRLV.IPDLHPGPFHPIGGSNIP.YLIYKN.LDSS..........................AM.VMHSISDHSLNLPSKSQVELYI....TSLKTNS.-TIQ......QGSKST..KPV......TIQVN..K..A....RTTGLLFDK.TAILILSLSPYGMEDIPYYIKSELEQYGKNR..GYERVLIVDSHNAMGKEIE-.....----....KLDADDLLNAAKSTLDTL..ITKET........LPMEIGYANSES......LS..FSA-.DD.LGPGKVAIMCFK..IG.D.......................EKFFLAWADANNMLN.GLR...EEIANHFSK.nGYN.......................FLEICTSDTHYKARTAKn..khGYFEFGSLS...K........ANDVISWFMELAKKAEQT..SPVS.SYELLK..SETN.VKVMGGN...Q.L....EIY....SKSL....DTAMR.I.TQAFLLITTGFFI---ytl.........................................
I3R284_HALMT/8-630                   .............................................LAGLSRFIFR...APNWY...TSLGF..ALL.VA.AMAGIAAFDSGDlagswrg.............lfflgrdaWEGIFFIG.IP...TVVAA.F.G.T.TG.VDRLVGGK........LTRNRS...SLLAL..AGEILIVIIVTLAAIISYLTg..............lgQTFVFDAFVVA...........................LASVF.AFRLLI.V.MA.VSRSSLLIAS...........VPASIQTLTSAVLLFIYsgtlhfyqvggpivday....lmpylarsgrappelsfIALSHFQ..LLAITCVIYA..F.GVFA.F.......LRVVDRPWRRSL.GVSVLDFIRGFIGHIAEG..TREL...EDFFE..QL..GQEAIVPITVLSFQC.........D..................D.....G.sE...........KARFV.LPMIHPGPMGEIGGGNFP.ERVARR.AEGL..........................AF.PPHATAGHDFNLVTEREVDVVL....DAVDSAY.EKIE......YSTDVT..ESV......RVESG..D..M....KMLGQRFGD.DAVLVSTYAPQFADDVEYAVGLSASAEARTE..GLRNVLLVDAHNCNNGLQGPdl.ghVTPG....SKRSFDMISAAGLAGEKL..TDLSH........GTLSLGVAADET......E-..WIPR.EG.IGPLGIRVALMQ..VN.D.......................QTTAYVLIDGNNMEP.GLR...DRIVEAITT.gPDAs....................adIAEVMTTDTHIVNTVK-.....AENQVGAVI...D........QDELLATIERLVDEAAAD..SEPV.SAGMAT..ERVE.VTIFGND...R.T....ETL....ASHA....NVVVS.M.GGALALAVLLASMAVS............................................
F4B903_ACIHW/4-499                   ........................................arill----------...-----...-----..---.--.-SIDVIEGAII-............................AFRGLEIG.IL...FFYSF.L.I.Y.SVsLLAILGKR........--IRTT...LTLIS..IFSAVYLILSLFPIPYV---.................-----------...........................FIFGT.FIPLVN.Y.SL.LVDYNEKISV...........TLASIASLIPSIILADL......................................-----TI..LGIVYVIAVG..V.SSYV.Y.......VALINRKGNKIV.GISSLKIVRPFLRALNYN.kSTEL...EEFLD..KI..SIPNMLNILTVKI--.........-..................-.....-..N...........ETYLI.LPQIHFGMYGEIGSSKFP.YHVEEV.IPN-..........................SF.VFHGPGSHEIDLTSSKESKRIA....QEILNTR.F---......EKANFT..GIT......QEMLG..D..F....KITTLNFDK.FTLSFVERPLKGIDDLPGALWRDMIST----..---NNFLVDCHNETLID--E.....I--G....RKEYVTLKNFIYSK-E--..RYLGN........RKLKIGYAEGEV......N-..---C.EG.LCKNKVRVLSFY..SP.Ee.....................dKKVSIIYLYANNACH.GLR...EKIEQNLSD..--L......................tNAILVTPDDHSCTAMS-.....----FGNLY...Qpa....tlCEQLIISSRELVKESLEK..MEDVkNIEYGI..LKVK.TRVIGKV...-.V....SSM....VDGL....EKVGG.F.AMKTFWIPIILPYVI-l...........................................
A0A256KDL0_9EURY/1-209               ............................................h----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.---------GEGIDDYDTGVFMSDVDE----..--SEVLLVDLHKHDLQNGPEk...eVLYG....SAEADRLKRHFDDFRERL..ADAPR........SDYAAGFS----......--..----.VR.HADQDVAAIVES..VD.G.......................QEVLLMGIDTNGVTP.DVR...ELA-ADYRE.tFD-.......................EVLIFSTDTHASIH-E-.....------LAN...T........TRSDTDALTAAVERAAGD..VAPA.TVGLTS..RRTRpLKLLKND...-.Y....NGL....VFSV....NILIR.L.TIIALAMLYALLVI--wl..........................................
A0A2I0NMC5_9EURY/9-571               .............................................VERLTRYIFS...APSWP...RSLAI..LVV.LG.FFIDAATYRAGNe.........................lfLAGTLGFS.VP...ALIAF.L.L.T.VP.LVGISGRH........ITWNRS...ALLAL..TCTVLSVILSLSPVLAFG--.................RDIFPALYAGA...........................LGLVF.GLRLLV.L.VA.VADYRISRMV...........LPAFLQSAAAIAVGAWY......................................FTPGFVP..YALLLQVVFG..L.GFVS.L.......IWLIERPLKRAF.QISGLNFLNTFIAHLTDG..SKKM...EDFFR..EI..GEEVYVPQVSLFFSR.........G..................S.....G..K...........DALFT.VPNVHPGPMGDVGGGNLP.RLLHDT.FPEE..........................TL.VAHGCATHDFNLVSESEIAKIA....CAVEASR.KGLV......FSATAS..RPV......RVASG..S..V....SILCQRFGD.ALLMVSTRSPERTEDLDYSIGMAIMAEGRGT..-FSEVAFVDAHNCMTSVGSP.....VLPA....TKIATEYIAAAREGFRVA..RDLPL........EPLAVGVSHVRV......P-..FTRE.QG.FGSLGVQVLVTD..VG.G.......................KKAAYVLIDGNNMAR.GVR...EDLRAVVLD.hAD-.......................EGEIMTTDTHTVNTIS-.....GKNPVGYAV...P........PEEIVPYIEQAVREALAD..LSEA.RVGAAT..ASCEgITVFGSQ...R.V....SQL....ASTV....NAMLA.F.IAPLSFMILVLAFLLS............................................
A0A0U3FPR3_9CREN/3-404               .............................eilkyykllftlppne----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........-----A...IFVSL..LAS-YAVLGLKKELLVLALV.................QQAYFTILFYE...........................NRILN.GRRLGF.L.YA.VSNVLMLAKPelsvalysmvsVLAIAHPLIEIVAILPL......................................------I..PFFPK----S..L.LALL.P.......VWLVSTYGHV--.-KGVMPLGIAWLRAWMGD.dYVHL...EEIVT..KY..GKKRIAKVLSLGP--.........-..................-.....-..-...........---IT.FTDVHFGLMRYSMGTLFP.YLLFV-.--NG..........................RI.PHRLCGSHENNPANRWETFKLA....LKVAKGE.ED--......-SKNVI..EVR......KEEGE..E..I....ECLGLNGI-.---K-VIYHKNGADDLECGD-----------..--YGVEIADPHNNEGEP---.....V---....--KAEVLEKELRNLKEIW..KDECV........FE---SVKEVQV......NG..----.KG.LCWDKGILLNLS..CE.R.......................GTRSWLVVFGNNMRR.GNR...DELVREGL-..---.......................-MEVSTLDDHTCAGFGR.....TKYEVSDVK...S........F-----------------..----.------..----.-------...-.-....---....----....-----.-.----------------evlrnlslsnsyrrre............................
A0A1M2YI61_9ARCH/10-610              ..............................lshvsmfaknlpssa----------...--SLY..aMLVLL..GLV.VG.PITAYIAHISDPlsgfay................alisgaIGGILAII.VP...TTINI.M.L.F.KA.IRSY----........IRVKYI...IFVSL..LAELTYGIFLIFSGAVFYIFh...............sYALALAAIIVG...........................DASIF.AWWIFV.N.KL.IMNRSKNASM...........-FSLLQPTINLIFFLPAsviffg..........................vtlpigV---MLI..KLYAAIFVFL..L.ISYT.I.......IYFIDSPIKKSL.GFSGIDTFSQMIQNWLFS.iNIAV..pNRKVK..KP.fGEKADIGVDSIVCTG.........K..................S.....G.kP...........IFVIT.VPNIHFGPVGTLGSSNFP.YLIERH.INLRyk......................anGV.VLHSSINEDYNAISSDQFSQLR....RTIDNTM.KHFRq....gTEDQEY..SYY......YGESN..G..A....MVKLIKFGD.SAIATLTRAPRVTEDITPEASV-IIKHALSG..FAKNITVVDAHNSRYETAPAd...eL-AAvkfdSKVLKDYLEAIKGLS---..KISSS........KTLEVGSASANI.....cEK..LGNP.KD.LAPGNSNAIVFR..IG.G.......................RDFGIIQFNANNMNP.KFR...ERILAHLSK.kFNI.......................DFELYTTDTHYVNSLRQ....tASNVLGSTS...S........YSKMSSELDKMVTSAMSN..MKTA.SLFWYS..ETMKnFYIWGIN...Q.R....EKM....LTAM....DSMIA.T.AKILIPAIIAAGFF--va..........................................
T0LI08_9EURY/9-563                   .............................................FADLSKYIKKs.pNPAW-...--ILL..AVA.LG.FLGVYIYTMNI-............................YLATLIVI.VP...YLLNL.A.L.D.QL.TFKSTNTI........FPLRRN...ITSVA..ITLWFYIIFSGILIIIFPWL.................---KFQAIPLG...........................ISFTA.FFRYLV.L.YI.YFSKKPYVNV...........IASLYFSLSLIPTFIYL......................................GLSGPIL..EIILFSIFSA..I.LAAI.F.......VEKSTKKFKERY.EEEPTDLIKFFLLHGFDR.kYNQI..gERFFK..RM.yNQNRTVPVKTITLRE.........K..................T.....G.sL...........KTILV.FPYIHPGPFGTVGSSDLP.IRLQKR.LNDLk.......................cdLM.VFHTTTTNDNNCSGEEDIGAIA....EGIKRAM.SSGE......KAEFMS..RAK......RVNAS..K..Y....AISIFKFGD.FGFGAILPERDPFDDVSLPEGKRIIEAVKES..GASDFAVIDAQSNYTPGVLE.....----....LMDCSPLIRPFQREFQ--..RMEAK........YPIMAGYARGSY......NI..----.KS.LGEMGIQVLTFN..ID.S.......................AISAVILTDSNNITS.YLM...IKIRENLKD.iCK-.......................VVEIYTTDNHVVNGSTL.....DMNPLGEKD...D........NVKLVEKIRNITELSIAS..ISEC.TAEMGS..ADVN.VKMGSEE...S.Y....QEL....LDTV....FSSVK.V.SKRLAGIIIPVAFF--i...........................................
M0MLZ7_9EURY/8-610                   .............................................LAALSRYVFR...APRWY...ASLGF..ALV.VA.ALAGVVAFDSRFvl.......................edaWQGVFFIG.VP...TVVAA.V.L.T.PP.VDRRLGGQ........LTPNRA...SLLAL..VCELLLVVVLVVAGLVVLLTp..............lgQGFVFDALTIG...........................LAAVF.ALRLLA.V.MA.ISRKSLLAAS...........VPASIQTATVALLVFVYsgtmryvevggplvr........sflsrptrgpaefqaVEPLDFA..LLGVTCVLYA..V.GVRV.F.......VAAIDRPWRRSL.GVSVLDFLRGFIGHIAEG..TREL...EAFFE..SL..GEEAIVPVSVLSARR.........S..................D.....G.tE...........KARFV.LPMIHPGPMGEIGGGNLP.ERVAES.ADGL..........................GF.PPHATAGHDFNLVTEREVDTVL....DAVSRAH.ERIE......YTETAT..PSR......RTTVG..E..A....TVTGHAIGD.SALLVATYAPGFADDIDYSVGLSAAAEARTR..GLADVLLADAHNSNNGLDGPdl.ghVVPG....SQRSFDLMEATGAVADDL..ADAPQ........ATLKLGVAWDET......P-..WEPT.DG.IGPLGIRVAVFD..VG.G.......................DTTAYVLVDGNNMEP.GLR...DAIVDSLP-..VD-.......................TAEVLTTDTHVVNTVD-.....STNQVGGAI...D........GDELTARIVALVEEARAD..CEPV.AAGMAT..ERAR.VTVFGND...R.T....EAL....ASHA....NAMIG.M.GGALAAALILALMAVS............................................
A0A1Q9MWV0_9ARCH/18-431              ..............................ayikvfqskglvfsl----------...-----...-YALI..PFV.VA.ITSQGLQFLQTQe.........................wnWDSFSHDF.VI...FFAAL.T.V.S.SL.CTRILRKK........--SKIL..tTSFSF..LINEYVVIFFAGSYLASHFLlif...........ydnTALIEVFFLLG...........................AIIAY.VLLFMI.I.FS.FTTVGSPRYF...........FLPAIQPIIGILIYAYYmyiadpd........................hfiyvmdFFLRAMI..FFFACAIIFA..I.PYSL.S.......MYSVSKIYGRKL.GKGGYKFIRAFILALLTEnnDDEV...EVFFD..EI..GVKRDVEINLNAFRV.........P..................G.....QnqL...........KGLFI.TPQIHFGPFKTAGSSALA.DQLYKA.FATIp........................gIT.IFHTACTHGENLTRHGQIDKIK....RHLEQNL.THLT......FSQAPV.pQFM......RTYHA..K..A....RVLGTIFGK.SPFIITTRHPLPSDDIEFGVLVKITQIFREK..GYQYLTFIDAHNAIIGDEIQ.....V---....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------kldseexxxx..................................
Q2NG70_METST/7-598                   ............................................v-MKLSRFMIT...LPKTK...ISVFL..IFV.VS.FITGALEGCLQPellsidtv............isaflgggATTFFLLG.LT...AIASG.G.L.I.HS.CVNKLHKR.......hMKLKQA...MFLSF..VCMLFPCLTYLLGSIISLGI................kVDITGNCLILG...........................ILFGF.AIEALI.L.WA.TSNIKYYQGI...........FIAAIQPVLTLSMLVLItnlvi...........................astsmdAVLSLYL..KVIIGAIVLA..I.AIYA.F.......VAIIESPIRNNL.GVGGLELLSLFIAQISEG..SNAM...EEIFN..EM..GEAIDTTVSLISFRT.........E..................K.....G..V...........KANYI.SPCVHPGPVGSIGGSNLP.TIIANQ.LDDF..........................AI.IAHGAATHDFNPVAAKEVNKIT....DAINGIL.PNLK......YTKKAS..KFQ......RVKSQ..D..A....KVGVQFFDE.GMILLTTFAPQSGDDIDYGVGLSLIYEAKAV.tGVKDVVFVDCHNSLEGNYER.....LLAG....HNRVVQLEEAIEKI----..EKQDM........YPIKMGYAYNPL......DE..IPIK.DG.IGQSGVKIMITE..VD.N.......................QKMLYVVFDGNNMKQ.GFR...AKIIEAVNE.aYPEi.....................dMIEVMTTDTHLVNTISG.....GGLTVGAKH...-........QELLIKRVLELIPKAFND..LEYV.EVASGT..SRVN.LKTLGPD...N.S....TEL....VTTI....TSIVS.V.TKLLAPLIFIVAAIM-t...........................................
A5ULA3_METS3/7-597                   .............................................VAGLSKYITT...LPKTE...KSITA..MFI.IS.FISGAVYFIINPspelgmv..............eniilggLFSLIILG.IS...SIIGG.G.V.N.QQ.IVSGLHGI.......nLKIKHS...MFLSA..LSMTIVCILLIIGGILTHFF................eTDFFLNSLLFG...........................CVLIY.GVNTLV.F.WT.TSKISFTKAA...........TVGIIQPLIMLAMYVLItflvtdt........................sflgsdlI--QMTI..KVIIASIIFI..L.AIYS.F.......ITIAGSPLKKNL.GIGMLDLLSLFIAHMNEG..SNSL...ESLFE..NM..SETVETMVTFISFKG.........K..................N.....G..I...........KSLFI.SPFVHPGPLGDLGGSNMP.TILANK.FDHF..........................TM.VAHGPSTHDFNPVRTTEIDKIE....NAVKEGL.EEIE......YSKDAS..IFT......RYNSE..K..A....NIGVQFFNK.GMVILSTFAPNDSDDIEFGVGLTMMTQSKSK.cDVKDSVIVDCHNSFAPESGE.....VLPG....NEEVFQLIDVIDKI-Q--..CNHQR........DTLKIGCYENIM......QD..LNKN.EG.VGESGIKTMVVE..VA.N.......................QRTAYVLFDSNNMEI.GFR...QEIIDATKD..LDI......................dEIEVMTTDTHTVNTISR.....GYNPIGIVK...-........RDEIIEYVKISINEAIKD..LEEV.EVGTGT..KRIKnLHTFGPN...N.S....TEL....ISTI....SSIVA.V.SKIIAPVLLITALVI-v...........................................
A0A0F8WCN8_9ARCH/17-618              ...............................ymelfqskilsysi----------...-----...-FFGT..PIV.FG.IFSLLLHYNIVNe.........................leIFHFIRFV.VF..fLLVSS.L.G.T.IF.SIKFYSKKvpl..lraPPNGWA...VQMNT..YFSALIEVTFVFGQVVSIFLq...............nIWYHEVFLILG...........................TIISY.IISFVI.Y.FS.FTTVDPPGYL...........ILSLVQPVSAILLYSIYi...................................gqF---DID..FFIRAMIFFV..V.CALI.FaipyrkgLFRVSNVYREAT.GMSGYPFIRAFVLSMMTD.gNDEL..iETFFE..RV..GIKSPVKIQYLMIRS.........I..................K.....NraI...........KGLFI.VPNVHFGPFKTCGSSDLP.EHIYKA.FEDIp........................gTT.VYHTTNDHTQNLTTQRFVEVIL....DRIKEDI.KLVKnsdkiiWENQIK..GFS......RKISN..T..A....KLLGTEISN.VPIVFITRHPLPSDDIEAEIGDQIRAQAISN..GYKDIIIIDSHNAILGDEIL.....IKKG....TIESQDLINVSNKFTKSNkvRNSPK........VQMLYGVAKGTF......QN..YTEK.DG.IGYGGIVLHLFKnlAN.D.......................QKTALIHFDGNNAYA.DIR...SYILNMLQN.rGIE.......................RGEITTSDSHTVARQFSg...rGYSPIGDKI...K........IDVILSKLENMIEIAENN..LEPV.EFYYKS..SIEDdVRIWGNP...RyF....YAI....LDTI....KECLK.V.SQKLLTLSLIVPTFF-s...........................................
V4Y8W8_9ARCH/8-95                    .............................................LAALSRVIFR...APSWY...SSVLF..TVI.IA.ALAGIASFDSRFil.......................edaWMGIFFIA.VP...TVIAS.G.V.T.PY.IDGRLGGR........LSPDQA...SLLAL..VCGT----------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------pps.........................................
M0GV31_9EURY/8-629                   .............................................LAGLSRFIFR...APKWY...TSLGF..ALL.VA.AMAGVAAFDSGDlagswrg.............lfflgrdaWEGIFFIG.IP...TVVAA.F.G.T.TG.VDRFVGGK........LTHNRS...SLLAL..AGEVIIVMVVTLAAIVSVGTg..............lgQRFVFDALVVA...........................LASVF.AFRLLI.I.MA.VSRSSLLIAS...........VPASIQTLTAAALLFVYsgtlrffevggplleay....lmpylarpsrappelsvIALSHFQ..LLVISCVIYA..L.AVYA.F.......LQVVDRPWRRSL.GVSVLDFIRGFIGHVAEG..TREL...EDFFE..QL..GQEAIVPVTVLSFRR.........D..................D.....G.tE...........KARFV.LPMIHPGPMGEIGGGNFP.ERVARR.SEGL..........................AF.PPHATAGHDFNLVTEREVDVVL....DAIDCAA.DDIE......YTSEAT..QSV......RVESG..D..A....KMLGQSFGD.DAVLVSTYAPLFADDVEYAVGLSAAAEARTT..GLDDVLLVDAHNCNNGLSGPdl.ghVTPG....SKRSFDMISAAGLAGERL..TEASR........DSLSMGTAWEET......D-..WVPR.EG.IGPLGIRVAVTR..VD.G.......................QTTAYVLIDGNNMEP.GLR...DRIVDALTT.tD-Gg....................vdVAEVMTTDTHIVNTVE-.....AENQVGSVI...D........QDELLATIERLTDAALDD..CEPV.TAGMAT..RRAE.VTIFGND...R.T....ETL....ASHA....NAVVS.M.GGALALAVILAAMAVS............................................
A0A1J4UES8_9ARCH/6-570               ..........................................lvr---ITDYFFG...LPDAK...VTLAL..LIG.LS.IISPIALYDSFSpa........................slMKGLLLFA.IP...----S.I.L.V.SY.ILYLLEPK........IQLKRP...LFLSF..VGVLIYLAAYYLSYTVGLN-.................-----VMLFAG...........................FAASF.VLWHLV.S.RL.FFFLDDKKSF...........VVALFQFISYAIPANLFg....................................iLSTSDVP..LAFASSLLSA..V.VSYL.L.......AEVTGGPFRKAF.GISIIEGVSQFFGQWLYG..SQEL...DRAFE..KL..GVSVESIIGVFRFRT.........K..................-.....T..Q...........NILLV.SPNVHFGPFGTLGGSRFS.SMLAAE.LKKSkn......................diVA.VFHGTAGHELNPVSESEFQKLK....DAVLHAI.SSIR......LSPAKG..SFS......KASSG..A..E....TAYSLVSNE.RVFLTLTRAPLSTEDIDYTLGSLLRQAALSR..-CKNAMVADAHNAETAEFEP.....VLPG....SQIALNYSNAIATALK--..KLSAP........ENLLVGASSVHP......DD..----.DS.MCGGGVNLLLFA..AG.K.......................SAFVQLVFDSNGIVP.EFR...NRLVAVLQE.rVRRsfs.................gdiLCEICTTDTHEKNVKKG.....VVNALGAGN...Se......sTGKLEKLALKLFDEAVAN..LSEA.ESGMAV..EKFT.FKAIGKE...N.M....ERM....MLAI....STSLT.Y.VKILGASILVALVL--gl..........................................
Q975B3_SULTO/7-520                   ............................................t-RKYYSKLKS...LPDMK..iLSGLA..TFE.SA.IV----------............................IIRSIEIG.LL...YLVSF.I.I.Y.FA.LLSIL---........FITEKKl.iFFFID..LTAFFYIIFSYIIIGYYY--.................-----------...........................YALTL.FSPLIG.Y.TL.LPRTSELKSS...........LIILAINFASIAFHITY......................................-------..LNVIYIVMIS..L.VFYY.Y.......IHLINKKGEKIT.GIKSLQILRPFLANIIKK.dSKQL...EKFLQ..DI..SIKSTIHIGIFKV--.........-..................-.....-..N...........NIYFV.LPKIHYGISGDIGSSKFI.YQLESE.NPN-..........................NL.IFHGPGSHEIDLATSTQSKAIA....KLISDEE.KKADn....wVSLKFY..GIK......EWTCG..E..F....SGVTLDFGD.KSLSFVQRPNYGIDDLPLKLWNFIVNSGN--..-----YIVDCHNEYLERELP.....----....SNTDSCITNGILKSIK--..EKGEE........KPFIVGYAEDKV......KD..---C.EG.LCDNRIRVTYIS..DG.E.......................KDLSIIYIYSNNADP.NLT...VKIREKLKG.vVN-.......................YPILVTPDDHSCTGTVF.....GDLYIPAQ-...P........CEQLVEKALELTLKAKSQ..ALKT.TISFKG..IEIKgVKILGS-...I.I....SLM....VNAL....EEVGG.Y.TMKTFWIPLVTPFILT............................................
J0S8V4_9EURY/12-574                  ............................................m-AGLSKYIFT...APSWP...RSLAI..IVI.LG.MLIDAASMRSESi.........................ilFFGTLAFS.VP...GILTT.L.L.T.RP.LIRTRGRM........IPWNRS...ALLAA..AGTVFAVIVAIFPVALGL--.................AAYLPLSFAIA...........................MGLVF.GIRMLV.L.AA.IADYHLSRVV...........LPALPQSVLGIAAASLF......................................FGPGYIA..LGAVLHLVFG..F.GCLL.F.......IWFIERPLNKGF.HISALNFINTFIEHMTDG..SKRM...EDFFR..EI..GEEVTVPQVTLAFER.........E..................G.....K..D...........GIIFT.VPNVHPGPMGEIGGGNLT.KRIHDA.FPEE..........................VL.TTHGCSTHDFNLVSESESEKII....AAMQKAL.DGVS......FVPRAG..RSQ......RLQTG..S..V....SLLCQPVGD.ALMMVSTRWPKKTEDLDFAIGMTIMAEGHSR..-FSHCAFVDAHNCMADVASP.....VALG....SKVGNEYLSAAARGIAAA..AGGAV........HPFRAGAAHVPV......P-..FSRE.EG.FGDIGVQALVIE..VD.G.......................QRTAYVLFDGNNMVE.ALR...PAVQAAIAD.lVD-.......................ECEVMTSDSHVVNTIS-.....GKNPVGMHV...P........PKEIVPYAVEAVQTAIAD..LAPA.RVGAAS..ACCRdIMVFGSN...R.I....SEL....ASTV....NAMLV.F.IPPLSLAILLVAFLLS............................................
A0A2I0P8H4_9EURY/9-571               .............................................VEGLTRYIFA...APSWP...RSLAI..LIV.LG.LAIDAATYRAGNe.........................lfLVGTLGFT.IP...ALVAF.L.L.T.VP.LVRVSGKQ........ITHNRS...ALLAL..ACTVITVILSLAPVLVFG--.................RELFPTLYAGA...........................LGLIF.GLRLLV.L.VA.IADYRISRMV...........LPAFVQSAVGIAVGAWF......................................FTPGFVP..YALLLQGVFG..L.GFIS.L.......IWLIERPLKRAF.QISGLNFLNTFIAHLTDG..SKKM...EDFFR..EI..GEEVYVPQVSLFFSR.........D..................S.....G..E...........DVLFT.VPNVHPGPMGDVGGGNLP.WILHDT.FPEE..........................TL.VAHGCATHDFNLVSESEITKIG....RAVEASR.KGLT......FSGTAS..RPV......RVVSG..S..V....AILCQRFGD.ALLMVSTRSPERTEDLDYSIGMAIMAEGRCA..-FSEVAFVDAHNCMTSVGSP.....VLPA....TRIATEYIAAAREGVRVA..RDLPV........EPLAVGVSHVRV......P-..FTRE.QG.FGSLGVQVLATE..VG.G.......................KKAAYVLVDGNNMAQ.GVR...ERLREVVLD.yVD-.......................EAEIMTTDTHTVNTIS-.....GKNPVGYVV...P........VGEIIPYVEQAVREAVAD..LSGA.RVGAAT..ASCEgIVVFGSQ...R.V....SQL....ASTV....NAMLA.F.IAPISFMILVLAFLLS............................................
A0A2I0PQL9_9EURY/9-595               ............................................l-GQLSRYIFT...APSAL...RSFFL..IVI.LG.LIIDGASARSWLnlpftsnigftlptvlssnlfflpekflFSGTLAFS.IP...AIAAL.L.L.T.KP.MIEYSGKT........MTWNRS...GLLAL..TCTVFGVIITLAALLSS---.................VSFIPLFYAIS...........................LGFIF.GLRLLV.L.VA.IADYRVPRMI...........LPALTQSGVGILVGMFL......................................FTPSFAI..LALVLHLVFG..L.GFVI.L.......IWMIERPLKRAF.KIRGLAFINAFIAHMTDG..SKGM...EDFFR..EI..GEEIFVPQVNFFFRR.........E..................K.....G..T...........PVLFT.VPNLHPGPMGEIGGGNLP.KVLHDN.FPEE..........................TL.VPHGCATHDFNLVSESEINKVI....DAVRKSR.NDLS......YAGTAG..RSG......RLTVG..S..V....QVLYQRFSD.SVLLVTTRSPQRTEDLDFSIGSTIMAEGHRW..-FPHVALVDGHNCMTDLSSP.....ILLA....TLTATEYQRAAFNAMEIC..SKAPL........LPLSMGVSHVTL......P-..YSRE.QG.FGDLGIQALITE..VD.G.......................QRTAYVLIDGNNMAQ.GVR...EVLVEQILT.lVD-.......................HAEVMTTDSHVVNTIT-.....GKNPVGMHV...P........VAEFLPFVMQSIRDAISD..LSPA.EVAAST..AHCEhVVVFGSN...R.I....SQL....ASTV....NAMLV.F.VAPLSLAMLLLAFLLS............................................
A0A2G9PSX0_9ARCH/17-598              ..........................gdfffklpsqgrlaaylfa----------...-----...-----..---.MC.FGAGVILRLIAGsgald.................alifggTEGILLLA.GP...ALVAA.V.L.A.PP.LFAS---K........RTLKHF...LFIAV..MASAASILVFAAGTLSVRSL.................GMELLNFVLVG...........................DAIVF.LVWFAA.C.FF.GLGLGISRSF...........AVALVHPFLNVAVLFIWarfgff.........................asaldvgSPFLAFV..KILLAAGVFL..S.ALWA.I.......SYVINAPAKKNF.GISTVEAVVLFFSHMVRG..GKGL...EEVLA..EF..GEDVETTVGAVTFRR.........K..................N.....G.sI...........KSVFV.VPYVHFGPFGNLGGSEFP.ALIARD.VEARlg......................apAL.IFHGTVNHDFNPVYSSSESLLA....NAVVGMA.RRER......KAEGRA..--A......FVSDS..S..G....RVAGISFGK.DGFLTLSLAPEGTEDINLAIGYALRYKAEAA..GFGHALLVDRHNSCTDGSL-.....LEIG....SPPYYEFEDAIASMT-PP..AAASQ........KPFKLGIASASL......P-..FTRE.QG.VGAMGLRVAVFE..IG.S.......................KRSCYALVDANNALP.ELR...GRVVSLIRR.hGFD.......................AGDLMTTDTHSVNTLSG.....VTNPLGLHT...E........QAKLLSAVDAAIHRAVED..AEPC.TASFAE..QRIR.LRVFGAN...R.Q....SEL....ITAI....NSTVS.V.AKIVAPFVFIAALAL-a...........................................
A9A387_NITMS/10-579                  .......................................nihnrf-------SLTl.vNPSSH..yFSLVV..SLG.VA.AIISLATLLGYLd..........................sSIEEAWYI.VP...AVMTV.L.F.L.TQ.LLDTRFTK.......kKEYSKS...LHSSL..FANMLWAATVLLGLLASFVL................sKETSLFFVTFG...........................MFLFA.SFRIGI.Y.TT.TLGVSLKKAW...........AICFVQPLAMFAVLIPQh...................................lwSPMFSDP..MTLFYGISFM..I.IASV.W.......SVLTDRAGRPGM.-ESTHKTIQAYLASQKND..HTEA...EEIME..ER..SSETKVATSQIRLSA.........N..................D.....G.gK...........EFRMV.LPEIHPGPYHPVGGSNIP.YLIYKN.LSSS..........................AM.VMHSISDHALNLPSKNEVENYL....KNLENSK.VKEE......-GLQCT..EPV......TVQIN..K..A....RVIGLLFGK.NPLLFLSLSPHGMEDIPNYMKNDIEQYAKNR..NYSKPLIVDCHNAMGEEIS-.....----....SEDGEDMLKAAKSCLDTL..ITKDS........FPIEFGYANSDD......MD..VWT-.ED.LGMGGLGIVCLK..IN.E.......................KKYFLGWADANNMEN.GVR...EKIIDLFAR.kD-L......................qLLEICTSDTHYAPVKARn..rnGYYQLGLIT...S........ADKLAKWFLEIASNAESN..TSTA.KFEILE..NETE.VKVMGQG...I.Y....EDY....SKAL....DNSLK.I.TKGFLIGGVIFFIT--sl..........................................
A0A151BLV9_9ARCH/1-521               .......................................mrrdpi----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........FDFRRR...LFLSL..VSSWVLLAFTAAASLVAALTr...............dVDVWVKLASLG...........................FAASS.SLRLLV.L.IS.VSSLKRWRTL...........PPALIQPAALLLVLAAFsvg................................gygLNVRHLL..MAVTTVSVAF..L.GTFL.F.......TFSVDRVGLKSV.GVPSIKLFKAFILNWIKG.iNGPI...ESIFD..SM..SEVKSVKVSMLGFKG.........S..................R.....G..F...........KALIV.VPVIHPGPFKNVGSSTIP.SMIQRV.FEDRfg......................cvVS.VPHGLSGHELDLTSQLESRKVI....EWLLEHV.DLQP......IGSVAT..PFI......RLRRN..G..A....SVGCQIFGGrCALLTLTLAPETMEDLPLELEETIQEEARKA..GLQSAVPIDAHNSINGDFDV.....----....ERASLLLEKAVKDALSEA..LRLEA........YQLRVGAAKVIP......TE..FGIK.EG.MGPGGITAIVVD..VK.G.......................DKAAYVTIDGNNMIS.NLR...DEILSRLRG.iGVD.......................GGEVMTTDTHIVNGVVMv..drGYYPVGEAM...D........HERLFWYIEKAVRDALGN..MEPV.SVLWCV..EVVPeVRVIGEK...Q.I....EDL....SLVI....DAVFQ.R.TKRTAAVIIPSFA---ailt........................................
B8D2L4_DESA1/10-553                  ............................................v-GRYYSILFS...LPHWE...LLAAV..LIG.VS.VIALY-GLRER-............................-------A.VP...LLLNA.V.L.I.IL.FLEAYRVFypl..tvfHKLKRI...IGLSL..TVLIYTLI------------.................YYLLLGDWILV...........................VAASS.TIVITV.I.QG.LDSTKWWRYI...........-IAVAPSFTSIVLSMWIt....................................sGVVSHTG..LVKGFSLILL..F.IITD.Y.......LIYLVMGRHRIN.GYKAPDLGSLFLQNWLER..RKDI...EKVID..EL..STSEGVHPRLIFM--.........-..................-.....-..D...........DLLII.YTDLHYGPFSNTGSSELP.GELKKL.FSSLg.......................ysVV.ALHGFGSHDRNLASSRYLRDYV....RKIYTAV.IDAE.....kTKLRYH..GAL......KLTGG..D.sW....EALALVFDR.LTIVFVSRPVKGIDDIPYNLFFRYNVIARKR..GLGDLILVDAHNWEKQE---.....----....DFNLGELDKLLDEVVEKA.iELKKR........PPVEVLFRYKCF......ET..----.SA.PGLIQGNACIIE..VT.Ge....................grERVVLLYLRGNNMKP.GSR...DKLIDVLGK.tTGA......................dYVEVFTNDEHSETGVRSs...lAYIPVH---...D........SPELLRDTEVAARELVGM..PYRL.GAWHSS..TRFD.TKLMGYT...A.V....MLE....KLLM....ASYIE.A.SILLLSYAFLLPILL-a...........................................
O30029_ARCFU/4-491                   ............................................v-EALYYKLFS...IPRAE...IMLVA..SLF.AA.LLLSLLD-----............................--ASLLYL.WA...L--VF.A.V.S.LA.ALKVAKLK........FDLKRI...SFLAI..FITTLSTPAVVLKGN-----.................-----------...........................ATASA.FVLFIT.Y.YF.CSERKALSVP...........-LAS---LPYI------......................................-ALSPQI..STLIGLLIST..L.LFLL.Y.......IRILDVKVGV--.-VRIRNFVEKFVLFWLTS.nPKFM...EEFLE..DS..ADDFEGRVRCLAV--.........-..................-.....-..N...........EARLV.QTDFHPGPFRNVGGAMLV.EKLSDG.----..........................GI.YLHSPTSHARNPVSAEEVEKIV....SAVRCSE.KALT......P----Q..KPF......KVESE..N..F....EAYCFPFAE.TRMVFVS-GKRHIDDFIINS-----------..---ESFVVDCHNAYEENYDP.....D---....EGEVGEIARLVKVAEE--..RTSEP........SNAKSAFVRVDA......ET..----.DS.LCGY-AAAVLLD..YG.E.......................ERYAIVVFDANNVDL.RFR...RHVEKLFGE.mGY-.......................TAVVASTDNHAKTGMRAk...lAYKPAGQDE...R........DWEVAEKLANCCREA--E..LKDA.VFSYGE..RRVK.VKVMGEK...L.L....RDA....EVAV....ERRAK.G.LIATFLAFAATNYLL-s...........................................
F3KI87_9ARCH/10-576                  ...................................ihnrfsltli----------...NPASH..yFSLVG..SLI.IA.AVITATVHFGYH............................ELDNIWFR.IP...IVIGV.L.A.LsQI.IDKQFTRK........KEYSKS...LHASL..FGNMLWIAVLLMGLLASWVL................iKEASLFFVTYG...........................MFLFA.SFRIGI.F.TT.TLGASIKKAW...........AICMVQPLAMFLAIIPYd...................................mwSSVLTDP..MAIGFGTVFL..I.IASV.W.......SVLTDRAGRPGM.-ESTHRTIQAYLASQGND..FSEA...EEIIE..QR..SYKTKVSTSQIRLYS.........S..................N.....S.nS...........EFRMV.LPEIHPGPYHPVGGSNIP.YLMYKN.FDSS..........................AM.IMHSISDHSLNLPSKNEVENYL....KNLDKSV.VKEE......-GLVCT..EPV......TVQIN..K..A....RVTGLLFGK.NPLLFLSLSPHGMEDIPDYMKTEIEQYAKNR..NYVRTLIVDCHNAMGEEIS-.....----....KEDGEDMLKAAKSCLDSL..ITKES........YPIEFGYANSDN......MD..VWT-.ED.LAMGGLGIVCLK..IN.N.......................KKFFLGWADANNMEN.GIR...EKIVENFAK.lGHT.......................LLEICTSDTHFAPVKARn..rnGYYQLGLIT...S........AEKLSKWFLEIACNAESK..MTAA.KFEILE..NETD.VKVMGRG...I.Y....EDY....SKAL....DNSLK.I.TKGFMIGSVILFIIT-l...........................................
A0A256Z9L9_9ARCH/1-205               .............................................----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..-----MVINAHNSLNGA---.....-VPF....NKAVEELQKAITESLRHV..SALEK........LPVRVGAAKTVP......KE..FGLK.EG.MGPGGITAITVK..VG.D.......................KTFAYITIDGNNMVP.ELR...EKILSTIKA.lGID.......................LGEVFTTDTHAVTALVLt..rrGYYALGEAI...P........HDRLVEYVRKTVEAALSN..TEPV.KVGYTV..EMVPrVKVIGEK...K.I....IEL....CSLV....DPAIE.K.AKHIAALIFSLT----glvl........................................
A0A0M0C0S6_9ARCH/15-598              ............................................i--KHYSSMFF...LPSLK..kSLLLL..MLF.CI.GFIGFCYFLLFLsf........................egLIYSLFLG.FS...LFSST.L.IlD.YF.ISNYILRTd.....piYILRRT...LAVSI..FCWLIWFIFLLLGLIFSLIF................dPLIWLKIALLG...........................FAAVL.TFRFVI.F.LS.TSSLGTIQRL...........VSSFIQPLANILILIGFwet...............................mftsIYFTFFP..FLIIFSIISF..F.SAAL.F.......LFLIDQIGKKNY.DVHAIPLFRAFMLNWVAG.lNAPF...EKFLE..KL..GKNALIEVMIMKFDS.........F..................-.....K..T...........KAAIL.VPFVHPGPFKNIGSSLLP.SQLKYE.FEKKfn......................cdAC.VPLGILGHELDLASQTQNKKII....DSVIDAS.NFIT......TESVAS..PFV......KINME..N..I....TASCQIFGK.TALLSFTLAPETTEDLPQELGFYVRKEAKKL..GMNCSIIINAHNSITDKKEM.....----....DLSLITLKAIALKSIKKA..LSLPH........YPFEIGIKTVFP......SE..FTLK.DG.LGPGGITSLVVN..VA.E.......................QKTAYVVIDGNNMVS.GLR...EKIISCLKS.kGFH.......................EAEIFTTDTHAVSAIVLg..srGYHPVGEAM...D........KTLLIKYILDISRDAALT..LEAC.RCKCVK..IQVPeVRVIGEE...R.L....HSL....SNLV....DLALK.K.AKKLVIPIF-------giegli......................................
R9SKC8_9EURY/7-593                   .............................................VAGLSKYITT...LPNIK...FSVKA..TIT.IT.FILGLLISIIRPyptnil...............lgiiiggIISFIIYG.LS...GIISG.F.I.N.QN.LISSFNGI.......nLKIKHS...MFLSF..INSTILSVITLIGSIISS-N.................PNFVINFIEFG...........................YILIF.AFSFLV.F.WG.ATQVNMKKSS...........LVALIQPVISIFLLLAVnfigl...........................nvysvsFSIYLVV..KMLIGCLIFL..I.AIYL.F.......VKTINSPMKTNM.GIDGLQLLSLFITHMNEG..SHDL...EELFV..KS..GADIDTVVSIVSFKT.........K..................E.....K..I...........KALFI.SPAVHPGPLGNIGGGNMP.TNLANR.FKPF..........................TM.IAHGPSTHDFNPASIKELDKIE....DSIRKGL.YKME......YSKSAS..KFV......RYTNK..S..A....KIGVQSFND.GIVLLNTFAPLGSDDIEFSVGLTMMVQANKT.fENKSTVIVDCHNSFSEESGQ.....VLPG....DPQVFELIDGISKI-K--..LGKKY........SNIKVGCSQNLM......DG..LGKE.EG.VGDSGVKTMIVD..VE.G.......................QKTAYILFDSNNMEV.GFR...QEILDFVYK.cGID.......................EAEVMTTDTHSVNTISR.....GYNPIGLSN...-........RAQIIDYVKETIEEALED..LEEV.EVGCST..EKIEnLKTFGPN...R.S....TEL....ISTI....SSIVQ.V.GKIIGPVIFVFAFILT............................................
F6D7Z2_METPW/7-602                   ...........................................iv--GLSKYMVS...LPSTR...ASVLS..MIF.IS.FILGFIVSLIEPtadrsil..............ysfiyggSAGFLMFG.LM...SIMAG.G.I.T.QP.MINALEGR.......hMKMKQS...MFLSF..VSMMMIAVIYGLGSLISTYT................iYSYTIDALVFG...........................CAVIF.AVRTIV.L.WS.TSNISFLKSI...........IPASTQPILIISMVIVLvsltsi.........................ttnigyfSIIPLLF..KIIIASIILV..V.AIYS.F.......VTVVESPMKRNL.GVGGLELLSLFLAHTTEG..SKAL...EGLFE..DM..GEAIDTITGIISFKG.........T..................N.....G..P...........KVLFL.TPSVHPGPVGNIGGGNMP.TQLANK.FDTF..........................TM.VSHGPSTHDFNPVSSKEIRKVE....NVIRNGI.ENMD......YTPKAS..RFI......RVEHN..G..A....KIGAQYFGG.NLLLLATLAPEGFDDIDFGVGLAISNLAKAS.cSTENVILVDCHNSFKGEGGR.....VLPG....NKEVFDLMGAVEKLP---..EMEKE........EGMRMGCAYNPM......DN..ITKE.EG.IGQSGIKVMVVE..VG.Sgs...................tlQRTAYILLDSNNMLI.GFR...DRIVESVKA.lGID.......................EAEAMTTDTHFVNTISG.....GHNPVGTKR...-........QDEILEAILECTKRAVDD..IEDV.EAAGKV..CHIKdLKTLGPL...H.S....TEL....VTTI....SSIVA.V.SRIFAPLIFIIALIF-v...........................................
A0A1J5J8Y6_9EURY/5-533               ..........................................akk---ATKYIKNi.kFPRLT...ILIAM..DLL.IP.LAFSV-GFSN--............................FVFLLLFG.IP...SIIAT.F.M.P.--.------GG........IKYRRA...EIINF..ISTILECIIFATGILISREYe...............iSNILYMSLAIA...........................ISFTF.AARILI.Y.RV.L-KMSLQKAV...........VRSSIRLLIAFFFFSFL.....................................nLGDIKFMgeRLVLIVSMFT..L.IMVV.F.......VYLLSKPFEKTI.GINPFDIVFAFANDWIHG..TNTI...ETSLI..KE..SEEGKAVINIINFTG.........K..................D.....G.nL...........KANFI.IPYVHPGPFGNVGSANMP.KIFHEG.IER-..........................SL.TFHGSCTHELNLIKNSDVYSLM....DDIKKEI.QNIS.....gNDENVS..TKY......GKFIS..D..G....KISVLQVDS.TDLKRVVF-CDGDGDIDVGIGLACSD-----..-----VFIDLHSSGNDDET-.....ITAS....TKRGMEIINKARNLRADL..KEIES........RKIQLGIAEGTV......QD..----.--.---CDVQVAFFD..LN.E.......................-PYALLLFDSNNMQNrEIL...DILRQKFK-..--F.......................TIFACTTDDHQRDN---.....GKFMIE--I...-........AEDDVNSISNLIEKAMND..TSDV.CVKFGK..IERN.VKVMGKE...-.-....YEM....LQAA....NFMTV.M.LKFLLPFLIFIMAF--fvf.........................................
A0A1J4UPS3_9ARCH/10-596              ...........................................in---ASKVLFS...LPSNK...RLLAY..LFY.SC.FFAGVVLRLAYGtepfe.................sfvfggSEGVLLLG.LP...AFFSA.V.F.A.AS.LL--YRKT.......fFAYLKQ..fLFVSL..LSAMLAAVSVLAGALSGKLV................lV-QSEAFVLLG...........................SALMV.GTWFVA.L.FL.VFSQKTWKAI...........PVSFTQSFFTLAFIVVWakfgaf.........................estltvsSGALALL..KSVVASSIIL..F.AVWA.V.......FTILNAPGKKNF.GISTVHATALFFAQWLRG..NKGL...EEVLA..DL..SERAQTYLQTVAFKN.........E..................S.....N.eV...........KALFV.VPGVHYGPFGNLGGSEYP.RLISEA.LDKRfn......................atTF.VFHATVNHDFNPTYSSSAQGIA....NTITRDV.EEAQ......HYSRDA..AFL......SSRSG..H..S....RVDGYSFGD.TVFLSLSRAPLTTDDIDLSTGTALRFKAESR..GFKHVALVDRHNSVGDG-KV.....FEMG....APEYFEYEAAVDAL----..KPEYS........QRFLLGVSKKHF......D-..FDLK.SG.VAGAGLRVAVFE..IG.G.......................KRSCLLLFDANNVLS.EFR...EKLLKELGD.yGFE.......................FVDLFTTDSHSVNTING.....THNPLGEHC...N........QDYLLAVSREAVEEALED..LEPC.KAAFLD..KKIS.LTVFGAK...R.Q....NEL....ISTI....NSVIS.I.AKIVAPLALIVSVVV-a...........................................
A0A0P9AVZ0_9ARCH/10-577              ..........................................nih----SRFSLTl.iNPSSH..yFSLIA..SLI.VA.VAITVTTYLGYF............................GSEDFWFR.IP..lVVMVL.A.I.T.QL.LDTRFTKK........KEYSKV...LHVSL..FANLLWVAILLMGLLASVVL................sKEISLFFITLG...........................MFLFA.SIRIGV.F.TT.TLGVTIKKIW...........AICLIQPLAMFLILIPQd...................................mwIPMLTNQ..MALGYGIAFL..I.IASV.W.......SLLTDKAGRPGM.-QSTHKTIQAYLASQKND..FTEA...EELME..QR..SNKTKVSTSQIRLLS.........S..................N.....G.nT...........EFRMI.LPEIHPGPYHPVGGSNIP.YLIYKN.FNSS..........................AM.VLHSISDHSLNLPSKNEVEIYL....ENLKNSK.VKDE......-GLVCT..EPV......TVQIN..K..A....RVIGLLFGK.NPVLFLSLSPHGMEDIPSYMKTEIEQYAKNR..DYIRIMIVDSHNAMGSKIT-.....----....KEDGEDMLKAAKSCLDSL..MTKEN........YPIEFGYSNSND......MD..VWT-.ED.LGMGGLGIICLK..IN.N.......................KKYFIGWADANNMEN.GVR...EKIVENFTK.rDCN.......................LLEICTSDTHYAPVKPRn..rnGYYQLGLIT...D........SEKLSKWFLDIAEIAETK..TTTA.KYEILE..NQTD.VKIMGQG...I.F....EDF....SKAL....DNSLK.I.SKIFMIGAVCLFIT--sl..........................................
A0A135VVQ0_9ARCH/11-611              .......................................vklfsk-------VWK...LPTYQ...RIIGR..IFL.AV.LLGSVLSGFLQIlatpsv................dvastlAVSFALLA.LP...AFVGT.G.L.L.YA.MIRKKDSP........LDARRT...AGSVQ..YGIFIWIGFGIIGAILSFISs...............nDFYEVRFWMLG...........................VGAAY.MLFAFL.V.TG.LSDHHPIRNF...........IAALMIPSLWYLIVSVFggyg.............................gviyvLPIWWPV..VAIIMFIMLS..V.SVNY.I.......FRAVSVPFERDL.GINGPELLRAFGYDYLTN.nSEPM...ETTLS..KI..GEMQDVPIEVLVIKN.........D..................A.....G..L...........VAVGV.VEYVHPGPFRQIGSSSLP.SAIIDH.VEQKhg......................vpAF.VMHGSCTHQQNLTSKKDFPIVM....AEIDRLI.DETE......VHDAMS..GPH......WSDLG..K..F....KVWTLFAGD.DVLTISTSAPEFTDDISLDVGRDAADMVRKRlpAIKGVSIVDAHNCINGEAVS.....VMPG....DPEAGEYVGAVSSAVFST..VSNPR........MKVSAGVYRAVP......ED..VRPD.EG.MGPGGVTALVLD..GG.N.......................REIVLLSLDGNNMEP.GFR...EEAIRMLKT.qGFD.......................DAEVLTTDTHVVNAISLs..srGYPPVGQNK...-........PQETMEAIIIAANKAREN..VSPV.SMGLGF..GEVKnLCTFGER...G.FdiltQNI....AEAA....GIAKR.V.GIRLGAASFLIAMLL-t...........................................
V4HDJ8_9EURY/8-652                   .............................................LAGLSRFIFR...APSWY...TSVAF..ALL.LA.AVAGVGAFETREaeqvyrt.............flfvgrdaWEGVFFIG.IP...TVVAS.F.G.T.VL.VDQFVGGK........LTRNRS...SLLAL..VCELLLVAALTVGATLAYAFps.............lgQTFVFNVLVIA...........................LASVF.GLRLLV.I.MA.VSRLSLAVAA...........VPASLQTATAALLLFVYsgtlrfiefggplvral....ltpylarsaeapselsaINPDHFL..LLGLTCALYA..G.AVWV.F.......LYTIDRPWRNSL.DVSVLDFIGGFIGHIAEG..SREL...EDFFE..QL..GEEAVVPVTVCSFRT.........P..................G.....G.rE...........KARWV.LPMIHPGPMGEIGGGNLP.MRVAQN.AEGL..........................AF.PPHATAGHDFNLVTEREVSTII....DAADRAF.DRVS......YAPGAT..EST......HTASG..E..A....NVLGQAFDD.DALLVSSFAPAFADDVEYAVGLSATAEARTR..GLDDVLFVDAHNSNDGLSGPdl.ghVTPG....STRSFDLMQAAREAGERL..ATAPR........GDLSVGVAWDRT......E-..WSPP.DG.IGPLGVRVMVAS..VD.LsgtadapdapdaagrsgdgadgeQTTAYVLVDGNNMEP.GLR...DQLVEAVVD.dDAV......................dEAEVMTTDTHVVNTVE-.....ADNQVGAAL...D........VDELEALVTGLTADALAD..RESV.EAGMAS..ERAA.VTVFGND...R.T....ETL....ASHA....NAAVS.M.GGALALSVTLASFALS............................................
A0A1I6GBX3_9EURY/8-629               .............................................LAGLSRFIFR...APSWY...TSLAF..AVL.IA.AMAGVAAFDSGEsmrtwrg.............lfflgkdaWEGIFFIG.VP...TVVAA.F.G.T.SG.VDRFVGGT........LTPNRS...SLLAL..VCEVLIVAIVTLAAIVSVFTg..............lgQRFVFDALVVA...........................LASVF.AFRLLV.V.MA.VSRSSLLVAA...........IPASIQTLAAAVLLFIYsgtltfmsvggpilday....lipylaradhapselstVSPDHFL..LLGLTCAVYA..F.GVYV.F.......IVVVDRPWRRSL.GVSVLDFLRGFVGHIAEG..TDEL...EEFFE..QL..GEKAIVPVTVLAFRS.........S..................V.....G..E...........KARFI.LPMIHPGPMGEIGGGNFP.ERVATR.SDGL..........................AF.PPHATAGHDFNLVTEREVDTIL....EAADAAY.DRIE......YGSEAT..QSV......QVQSG..E..A....KMLGQAFGD.DALLVSTYAPEFADDVEYAVGLSAAAEARTA..GLDDVLLVDAHNSNNGLDGPdl.ghVTPG....SKRSFDMITAAGLAGEHL..SAAAR........GDLSMGVAWDRT......E-..WEPT.DG.IGPLGIRVAVTE..VA.G.......................QRTAYVLVDGNNMEP.GLR...DAIVADLTE.gEESl....................vdVAEAMTTDTHIVNTVE-.....ADNQVGAAI...D........QGELRRLVADLTREAVRD..VEPV.EAGMAV..ERTE.VTVFGND...R.T....ETL....ASHA....NAVVA.M.GGAFAVSIILAAMAVS............................................
Q9HSH3_HALSA/8-617                   .............................................LASLSKYIFR...APRWY...SSVAL..SLV.IA.ALAGVAAFDSQYvl.......................adaWQGVFFIG.VP...TAVAS.M.A.T.TT.VDRHFGGQ........LTYNRS...SLLAV..ACEIVVVTVLVAAGVAAILTpr.............lsQNFVFDALIAA...........................LALVF.AVRFLV.V.LA.VSRNTLAVSV...........LPASIQTATAGVLLFVYggtlnyvtsgggsllg......aflarpshappeiqyaFAPRDFL..LLVAMTALYG..S.VAYG.F.......VVVIDRPWQRSL.GVSVLDFIGGFIGHIAEG..TREL...EDFFE..QI..GEEAVVPVTVLSFRR.........T..................S.....DetE...........KARFV.LPMIHPGPMGEIGGGNLP.QRVADA.TDGL..........................AF.PPHATAGHDFNLVTEREVDTLV....DAAADAH.DRIT......YTDTAT..APV......RATDG..E..A....TLFGQAFDD.DAFLVSTYAPNFADDISYAVGLSAAAEARVA..GLETVLLADAHNCNNGLDGDdl.ghIYPG....SERSFQLIQAAGSAARDL..ADAPE........HALRMGVAWDPT......D-..WQPC.DG.IGPLGVRVAVVE..TG.T.......................TRTAYVLIDGNNMEP.GLR...ERLLDAVGG.lGID.......................HAEVMTTDTHIVNTVE-.....SSNQVGAAI...D........WGALTDVVVALTEAATDD..LDPV.EAGVAT..ERAE.VTVFGND...R.T....ETL....ASHA....NAVIA.M.GGAVAGLAVLATVTI-s...........................................
A0A1V6N3C8_9EURY/7-618               .............................................VAGLSKYIRT...FPSTK...ISIFS..MIF.IS.FISGVLIFFIDPsmnltvl..............ekifyggAFGFGAFG.IS...SIIGG.A.L.S.QQ.LITSMKGI.......nLKTKHS...MLLAL..MSMVLVVLIAIIGTIISSIF................nIELLTNAVLFG...........................CVLVF.AFLIFV.F.WS.TSSIGLFKSA...........IVACLQPLLILAMLVVVlflgsa.........................dkvfefgF-LSLFV..KVIVANIIFL..L.AIYS.F.......VAVIESPMRKNL.GIGLLDFVSLFISHLSDG..SGSL...EKIFE..DI..GEPIDTLVGIVSFRR.........KiknpsdenesveeinyseT.....D..I...........KSLFI.SPCVHPGPIGSIGGSNMP.TILADR.FENF..........................TM.VAHGPSTHDFNPVSQKEINKIE....DTVKNAL.KVIN......YGDKAS..KFL......RYCEV..N..A....KVGIQFFND.SMVMLSTFAPFGSDDIEFGVGLSMMSQSKKH.cNVKNSIIVDCHNSFNEEKGR.....VLPG....NPEVFHLLDAIDKI-K--..CHSTE........KGIKVGCAEDLM......ED..LDKN.NG.VGESGLKLMVIE..TQ.S.......................QKMAYILLDSNNMEI.GFR...EEIIKAIKS.dDELp....................idEVEVMTTDTHFVNTLSN.....GYNPVGLTK...-........REEIINYIKISIKDAIND..LEPV.EVGCSV..ERIVgLNTFGPN...N.S....IEL....VSTI....SSIVA.V.SKIMAPIIFILAILF-v...........................................
A0A133UI38_9EURY/4-535               ............................................a-EKFKGILFS...SPSPN...HSLIT..IFA.IG.LVFGFFCSTIGImdfhk.................nflissLGFSLIFI.LP...AVFYG.G.L.T.SY.LIRY----........YYRRRA...LLLAL..LNEVLVFI----GLLFF---.................-KFFEPMLLFF...........................LGFAY.SINVLS.I.AG.ISNRKGPTPL...........LFPLLYFIPILSGLYLG......................................--NVFIL..TIFKVTAFFGigV.ASLS.L.......VYFVDYLFQMNL.QVSASQLFTYFL---NEK..PKNL...-----..GF..GTEKNVLLQGLKFKT.........G..................-.....K..E...........TYILS.LPWLHPGPSRQLGGGSLS.YSLIKN.LNEKg.......................nkGY.FWHVPSSHEEDPCDPRIFEKII....EKPQFEN.--SA......FEGKAT..KLL......KRDND..S..F....EIYGQRFGD.--IYLIFSNVEKIDDFEISIFQKIREQTG--..--KKIVFVDMHHHEPPETGK....iLLKN....EKLTDELSRTVLDLLKDL..ENEGQ........FEVKIGMEVSR-......--..----.--.--DNKFMVLVEE..LN.N.......................ERYLLITMDRNGIPE.KLN...DELENIKRDnrFD-.......................KFLFLTTDTHENFNF--.....----LD---...A........KKEIEFPSSELITKALKK..TSKA.EISLTE..HEIEnVRVLGKK...S.Y....IFE....TAS-....----L.F.AMYLFPALMLLVFLI-ffliii......................................
I3TGE7_THEC1/10-549                  ............................................v-SKYYTVLFS...LPHWK..vLAAVI..VVF.LV.AIVVLMG-----............................-QGSLPFL.TY...FAVSL.L.V.L.YV.YSRLSKGTv......fWKPKRV...LGLSL..TALIYVLI------------.................YAWLLGGWVVA...........................AVASA.SLLSVV.V.LS.LDGTKLVRYT...........VPVAISSIPVSLYTVLT......................................-TLKKGL..IAYALVGAVV..V.AALD.Y.......VVYRVINRRRIG.GYGAADIGTLFLRNWLDR..DKSI...EEFFE..SV..GSPRDVDLAVLKS--.........-..................-.....-..G...........DTLLV.YTSLHYGPFSNVGSSLLP.EELEKA.FSGNy........................nVI.VFHGFGSHDRDVVSTRELAKLRphlvKLVNEEG.ESLL......YH---G..AFE......ITTSE..K..W....RVLGLVFDK.LLLLMVSRPHVGIDDLPYSFSLKLKDLVLRK..MNSNLLLVESHNWER-----.....--AG....KVDTSGLEDALVKAVEAA.lETRKR........DPTWPMVRSISV......NV..----.KA.PGVVKGVARIVE..IR.Gsd...................grDPVLMVFFRGNNMAP.GSR...DRLLNALEG.eYNG.......................LIEVLTNDEHTETGVRAh...iTYIPVHLTD...E.......aILRLKDGVKRLVSKPFSR..----.GLYMTT..STVK.LRLLNNA...A.Y....ELV....YLLK....KSYLE.T.TVLLLFYVFLLSPLLS............................................
A0A218ZT49_9EURY/11-567              .............................................IEDLTRFVRG...APGWK...FYIVP..LIF.IM.G-IDYLLIRSLK............................-DVLIGIF.LS...FVFVL.V.F.D.RI.FI-LLGKF.......vFPMRRI...AYLDF..VSFGIWTIIFWIVHFLNLLV................gT---ESQVFFS...........................IAFVS.FFRLLI.F.YV.YYSEKVTSLL...........LPSLNYTYAGIVSFAYI.....................................yGGYPLII..PFLLASLASA..L.IAVV.F.......TKIVLSKFSKDY.GVSATKLLQFFLNFRSVG.dTDQV..gKEFFE..RI.yRKEQVVPVKVIDILS.........G..................E.....K..S...........KVTMV.FPYVHPGPFGRLGCSDLP.IRLQEK.LPDIg.......................reLM.VFHTTTTHSNNCQGEDDIERLA....EGIKKAL.SKIQ......YVDTMS..RFR......KLNAG..K..Y....SIGMIRIGD.FGFGSIIPEREPFDDVELGEGMRVMESIKTH..GARDFALIDAQNNFTKGAKE.....----....LRDCDDLIKPFTREFG--..RNIPN........SPAMIGFSSLKT......GF..----.PG.LAGMGIQTLAFR..TG.E.......................RLDAIVLTDSNNITS.STI...EKVRKKSAN.iVS-.......................NVEIYTTDNHIVNASTL.....DVFPLGIKG...D........IDLISELIVGTIKEAVKD..VNEV.KVGMGS..ANVM.VKMGEEN...S.Y....HKL....TENV....LSTVR.K.AKYAIAGTLPMALVIS............................................
U1PPF5_9EURY/172-509                 .......................................xxxxxx----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-ARWV.LPMIHPGPMGEIGGGNLP.LRVAEK.TDGI..........................GF.PPHATAGHDFNLVTEREVGRLL....AAADRAD.ERLS......YTAEAT..RSV......RTESG..E..A....SVVGQAFGD.GALLVSTFAPSFADDVEYAVGLSAAAEARTN..GLSDVMLADAHNSNNGLDGAdl.ghVTPG....SSRSFEMISAAGEAGDRL..ATAPR........EALAVGVAHVET......E-..WDPE.EG.VGPLGVRVMVTE..VD.G.......................QRTAYVLVDGNNMEP.GLR...GEIVDALD-..VE-.......................EAEVLTTDTHIVNTVE-.....AENQVGDAI...D........WDRLIDVVERATDRAVAD..LAPA.EVGMAT..EHAE.VTVFGND...R.T....ETL....ASHA....NAAVQ.M.GGALAAVVVLASLALS............................................
Q5V1J9_HALMA/8-611                   .............................................LASLSRFIFR...APTWY...TSLAF..ALV.IA.AMTGIVAFDSRFil.......................ddaWQGVFLIG.LP...TSIAS.A.V.T.PW.VDRQLGGQ........LTPNRA...TLLAV..ICELITIAMLTIAGVIAVFTvr.............lgQNFVFDVLLVA...........................LASIF.AFRLLI.L.MA.VSRHSLLKAT...........IPASVQTVTAAVLLAIYsgatafiledpmlr.........eylsrpeevppqvqgFIPEDFI..ILAVICVIYA..L.AVWL.F.......LVVIDQPWRSSL.GVSALDFLRGFIGHIAEG..TREL...EEFFE..EI..GEEAVVPVTLLSVRR.........P..................D.....G.eE...........KARFV.LPMIHPGPMGEIGGGNLP.RRVAES.ADGL..........................AF.PPHATAGHDFNLVTEREVDKIL....STAETAY.QNIE......YDSQAT..AGH......RVTEG..E..A....TLTGQAFGS.DALVVNTYAPGCADDVEYAVGLSAMSEARAD..GLDDVLLVDAHNCNDGLEGDdl.ghVVPG....SQRSFDMLHGAGQLGSLL..TDAET........GQLRCGVAWDET......P-..WKPE.EG.IGPLGIRVCVFE..VN.D.......................QRTAYVLIDGNNMEP.GLR...QRIIDAAEG..VD-.......................TMEVMTSDTHIVNTVE-.....AENQVGQVI...S........EKEIVALIGDLVDRAIAD..LEPV.EAGMAS..EQAT.VTVFGND...R.T....ETL....ASTA....NAMVS.M.GGALAAAFILIVMTVS............................................
F2KNU4_ARCVS/7-542                   .............................................MEKFYSKIFT...IPRKR...ISVSL..GVI.TI.LLASILNGIVSKa.........................ffAQRYFFIG.LA...LIVLL.L.A.I.SR.FIGLA---........FNSRRV...FFLAL..LLLIFIEVFDFVAIHLS---.................---LFELIVLA...........................PASIA.TLLTLV.L.FF.TSEAGERRIV...........AGVILMLLALYPVNYMYs....................................fSTPHRTL..SYTIASFAGV..M.LGLA.Y.......IKYLDRDYGV--.-FNTKHLLKSFILFWLTS.kPEYF...EKRLE..KA..GEKRKGWVKCLKV--.........-..................-.....-..G...........NARLI.STSFHPGPMRNVGGARLV.SRILEI.P--D..........................TM.YLHSATKHELNPATLKDVDRIV....KSISCDA.AESI......TIDKVY..RPF......EVEGE..R..F....SLKVFPFED.-VSLLIFSGKNATDDIPTGI-NSIAE----R..YFGEVMLVEAHNAHMEDFDV.....S---....AEDFYELEELIRTACS--..IPREE........SNLEYCFFKERC......ET..N---.-N.IC-GWIALLLLK..YD.S.......................EVHGILMLDGNNVVK.EFR...HRLEKFAEE.rGV-.......................RLTVVSTDNHSKTGISPk...vGYNPVGS--...-........NKEDEKAVFSFMERALSDakFKKA.DISYGR..REVE.ITVMGKR...F.F....ENV....EKAF....IQLGE.K.ALYLFWAMIAVQIVL-t...........................................
A0A1F5CVU8_9ARCH/1-408               ...........................................mg----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.ASIV.F.......SRIIDSYGKRTI.GIGAIDLFKAFVNSWAEG.iPTGL...EYQFE..KL..GEEIDVEIDLLAFED.........C..................E.....N..P...........FAIMV.VPALHPGPFRNVGSSTIP.YDIQEK.LSNKtg......................avVC.VPHGTAGHELDLTSAGQREKVI....QAVVESI.PIKG......SFKGIT..RMV......RVEKD..Y..F....KASCQVLGR.SALVTLTCSPRSTEDLPTSLGKALTKFSLDS..GLDGAVIIDSHNCIEQEASF.....--LS....MADTLVLQECAKEAIRRV..VNEKR........SHFECGVSHIVP......EE..FSMN.DG.MGPGGIVVLVLK..TK.S.......................DHTAYVTIDGNNMIK.GVR...EKILESIIN.lGIN.......................DCEIFTTDTHVVNAIGPs..krGYHPIGEKI...D........QKKLLDLIRKATQEALSN..LRVA.KVAFKK..IKVKkVKVLGEK...N.I....LEI....TRLV....DVIMK.K.IKTLAVTIFLPAIIL-a...........................................
G2MHN4_9EURY/8-629                   .............................................LAGLSRFVFR...APNWY...TSLAF..ALL.VA.AVAGVGAFDSGEadavfrg.............ilfvgqdaWEGIFFIG.IP...TVVAG.F.A.T.PW.VDRWTGGR........LTYNRA...SLLAL..ICELVLVAALSVAGLLAYLFpm.............lgQEFVFDALMVG...........................LASVF.ALRLLV.V.LA.VSRSSLPLAV...........LPASIQTVVSAALLFVYsgtirymadggsaiqay....ltpylnqnadapgvlsvVSPTQFA..LLGVLCVLYA..A.AVYI.F.......LVAIDRPWRRSM.GVSMLDFLRGFIGHVAEG..SDEL...EDFFE..QI..GEHAVVPVTVLAFRE.........L..................D.....GgpE...........KARFV.LPMIHPGPMGEIGGGNLP.KRVADT.AEGL..........................AF.PPHATAGHDFNLVTENEVERLI....DAADRAH.ERIE......YGTEAT..QSI......RPHAG..D..A....KMLSQAFGD.DGLLVNTFSPGFADDVEYGVGLAVTGEARTN..GLDDVLLVDAHNCNNGLAGPdl.ghVTPG....STRSFDMIQAASLAGESL..TTAPT........GELSLGVAWEET......E-..WEPL.DG.IGPLGVRAAVTE..VD.G.......................QETAYVLIDGNNMEP.WLR...DRTVDALTE.aGLD.......................EAEVMTTDTHVVNTVE-.....ADNQVGGAI...D........HGEFIETVLGVVEEARAD..SEPV.EAGMAT..ERAE.VTVFGND...R.T....ESL....ASHA....NAVVS.V.GGAFAVAVLLAVTAI-s...........................................
A0A257AK55_9ARCH/1-356               ............................................v----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..--------SYILFQG.........E..................N.....G.kM...........KGGVI.IPSLHPGPFRNVGSSNLS.YQISRK.LEKLig......................gvFL.VFHGAATHRDDAPSSKEVVRLI....RDLSRAV.KKEK......K-FISR..FPY......PNQHR..N.lF....NVTTFPTHN.LSFSFISQLNSDAEDISHNVAEYLEEKIG--..--TNLTLIDLHNNIGAEGKP.....ITLG....DTRVSVLEKIVPKTLN--..-VQRA........RQVKVGMAKVRD......TG..ITRK.EG.MGPDGVSVTLID..YG.D.......................LCVVLLLYDANNMIP.ELR...ETLERYVQR.yLKEngg................yrnvIPLVGTTDTHTVTAIGQg...vTYHPLGNAV...D........HEKVLNATKRCLNKAISN..LGKS.KYAVNR..IYTY.VKVLGEN...-.Y....NIL....KNVVvhgvSSYKS.F.MKFIVPTVLFLNL---lll.........................................
A0A1C8ZWK6_9CREN/7-520               ............................................t-RKYYAYIKG...LPNIK...IFLTL..TSF.EY.II---L------............................LIRSLQIS.FD...YLYSF.L.L.Y.SV.LLIALFRE........-RYKLG...LFITD..LTGIPYIVLSFLPVSPI---.................-----------...........................FAFGF.FMPLLA.Y.IL.LGSYRESLSI...........TLSALLSFVPIIFYLKY......................................-----IL..PYIIYIIIIS..L.IFHL.Y.......IYTVNKKGVKIL.GFKSTQVAVPFIRAITEK.nKAPL...ENFLS..LI..SVKTTLNILLYKL--.........-..................-.....-..D...........DILFV.LPQIHFGIFGDIGSSRFV.YDAEKT.LGKN..........................VM.VFHSAGSHELDLASSFDVNKVL....EEIKRSL.NGNS.....wNKVNFY..GIS......VEKIN..N..F....EVTSLEFDK.FRISFLERPNLGIDDLPSSLWKYMLSYNN--..-----YLVDCHNNYMIEGYS.....----....KDEVESLKMFLMEQ-K--..GIKSN........RKLYIGYAEGVI......EK..--SC.EG.LCDNRVRVVTLS..DG.E.......................SKISLVYLYANNSSR.ELY...TAMKN-LEE..GS-.......................RVILITPDDHSCTGVSLg...iTYYPAG---...V........CEELINKTKMLVKESTLN..LKEVkNIQYTV..VKVKgVRVVGK-...I.V....SLM....SKAL....EEVGA.Y.TAKTFWIPLVTPYL--al..........................................
A0A1G9QAR9_9EURY/8-650               .............................................LAGLSRFIFR...APRWY...TSLAF..ALL.VA.AMAGVAAFESGLperswsg.............lfllgrdaWEGIFFIG.VP...TVIAA.F.G.T.SG.VDRFVGGK........LTPNRS...SLLAL..ACEVIIVAVVTVAAIASVFLp..............ldQTFVFNALIVA...........................LASIF.ALRLLV.I.MA.VSQSSLLVAA...........IPASIQTVAAAALLFVYsgtlrfleiggpllnay....fmpylarsgvappelsaVQPSHFG..LLAVTCVIYA..T.AVWA.F.......LYVVDRPWRNSL.GVSVLDFLRGFIGHIAEG..SREL...EDFFE..QL..GQEAIVPVTVLSFQR.........D..................D.....G.tE...........KARFV.LPMIHPGPMGEIGGGNFP.ERVARR.SEGM..........................AF.PPHATAGHDFNLVTEREVDTIL....DAVDDAA.ERIE......YSAEAT..TSV......RTESG..E..A....KMLGQAFGD.DAVLVNSYAPNFADDVEYAVGLAAGTEARTH..GLDDVLLVDAHNSNNGLEGPdl.ghVTPG....SQRSFDMIRAAGHAGEAL..ADADR........GALSLGTAWDET......D-..WIPR.DG.IGPLGIRVAVTE..VD.G.......................QTTGYVLVDGNNMEP.GLR...DRIVSTLTE.gAEEadaetaereravaadgarpqtldAVEVMTTDTHIVNTVE-.....AENQVGAVI...D........HDELVDLVCDLVGEARDD..CEPV.SAGMAV..EETT.VTIFGND...R.T....ETL....ASHA....NVAVS.M.GGAFAAAVILSAMAVS............................................
A0A0N8VKN3_9EURY/7-564               .............................................LAGISRYIKK...SPKW-...YYFIF..PVL.FI.YIINFLLIKSM-............................VNFIFLSI.IP...FFVFI.A.M.D.VI.TIRLTNKS........FNSRRI...IYLDF..MSFLSASLFLWIFLALNSII.................GLNIVYLIGIS...........................TSIAV.FLRFLI.L.YV.YYPGNMHYAI...........ILSPDYSYSILISSLFIfl.................................ktpYLPMFLF..TVSFSSAIFL..L.FSYL.F.......ITLTTKKFTRKY.SASVPEIINFFLNRSQDN..SVG-...ESFFG..KI.yNKRVKIPVKTVDIKD.........C..................E.....K..S...........KVILI.FPYVHPGPFGNLCSSNLP.EKLSHE.LNMD.........................nIM.VFHTATTNSNNCGGESDIKNIA....DAVKQGL.KDMH......YSGTVS..EMK......KINVN..G..Y....EISMQKFGN.YGFSAIIPESEKFDDISLESGLKLIRAMRDS..GMDDFALIDAQNDFTKNAPE.....----....LDNCSQFIPEMKRAFS--..KLSDA........YPARIGYSRISA......RI..----.SG.LAAMGIQALAME..IN.G.......................KYNAIVLTDSNNITH.DIM...EKSRNELSD.iVD-.......................NLEIYTTDNHVVNASNL.....DINPLGLNC...N........PDDVVNLIKTAVKDAIND..ISDV.KIGMKT..VYTT.VHMGRED...S.F....KTL....MDTV....LGAFR.I.AKYSIGFILIASILI-a...........................................
A0A0P9EFP1_9ARCH/15-601              ............................................l--KRYSSLFT...LPSHA...RIVFL..LCA.LC.VLGGTLAILPFHls.......................yygLILSLMFG.GI...FLFVT.L.S.S.DF.VISHSSMKrd....piFNLRRC...SALSL..FSCLIWFGVIFLGSLISVFLe..............nqKNLWVRFFFLG...........................FCGVL.MLRLLV.F.FT.ISFADFGRIF...........FSSLLQPALCTIPIFFMgsv...............................igydPEAQLPI..FFLISIVIAV..L.TMFL.F.......TYFLDRVGKRTL.GIPSSSLFKAFFANWTEG.lNAPL...EAFFE..KL..GNEQNVRVSMLTFRA.........N..................K.....R..I...........KAVMV.VPALHPGPFKNLGSSFLP.SLIQTT.LENKlq......................cvVS.VPHGLVGHELDLSSQFQSQRVV....EGILGFI.DSSP......IYSKAT..PFV......RTRKN..E..A....TANCQIFGN.CALLTLTIAPKSMEDLPQELDLFIVKEAEKQ..-GLSALVIDAHNSIEGSFN-.....V---....NEAVVSLRKAAMASLKKA..LSYKR........FPFEVGAATVVP......KE..FALK.EG.MGHGGISVIVTG..VG.D.......................QKAAYVTIDGNNMIS.GLR...EKILSELGE.vGIV.......................DGEVLTTDTHSVCGVVRt..arGYHPIGEVI...N........QSKLINYIRQAAVKALDS..MEPV.EASWRT..EIIHnVNVIGEK...Q.I....EEL....CLVA....DKTAK.Q.AKRLAVSLFSVASVL-l...........................................
A0A0M0BM27_9ARCH/11-224              ...........................................iv--SYYSYLFT...FPSRG...AMAGA..IVI.IS.ISGCAAAFAMTWgvaa...................alrglLFGLLGLT.FP...LLASD.A.L.S.SA.LFK----Dd.....afLTPRRF...TILSY..ASSIVYAGAILLSSATSTVIg...............gTDLLVRGVMFA...........................IAVNA.SLRYLV.V.QV.FSNRGVTRNM...........AATFMQPIFCFVSGALLs....................................yPAMRIPV..LGAIGTAITV..G.GIHL.L.......LLAMSRTRNVPR.GMRLIPLFRAFVMAWAE-..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------dl..........................................
H1Z4F5_9EURY/9-571                   .............................................IEGLSRYLFI...APSWP...RSLTI..III.LG.MLTDIASVFGNSe.........................frFFGTLGFT.LP...AIISF.V.L.T.KP.LVEYFGKK........ITWNRS...ALLVL..ACFIFSVIISFFPVLLIF--.................EGIVPLLFAVS...........................LGFIF.GIRLIV.L.VA.IADFRLKKMF...........PAAVTQSFFGTFVGYFY......................................FGPDFLL..LSATTHILFG..I.CVFL.F.......LWLIERPLKKNF.NISALNFINAFIAHNTDG..SKAL...ETFFR..EI..GEEVYVPQVSLFFKR.........E..................G.....K..E...........DVIFT.VPNLHPGPMGEIGGGNLP.RILHDS.LPGE..........................AF.VAHGCATHDFNLVSEDEVAKIA....DAVRKSA.LGIE......YFESAG..KSM......RFECG..T..V....KTLVQTFGD.SVLAISTRSPGMTEDLDYPIGLAIMAEGHKR..-FKNVAFVDAHNCMTDVVTS.....VLPA....SFTAYEYIRGALSAFEGC..SDCGQ........DEFSIGVCRMDL......P-..FTRE.DG.FGDLGIQTLVVE..TA.G.......................QRTAYVLFDGNNIHQ.GVR...EKIRDEVLR.hVD-.......................ECELMTSDSHVVNTMS-.....GKNPVGLRV...P........PEDIIPYVIDSVRTAVKD..LSPA.TAAAST..GWCEgVVVFGSQ...R.I....SQL....ASTV....NAMLT.Y.VAPLGVAILGVALVFS............................................
A0A117MHP8_9EURY/9-572               .............................................IERLSRFIFT...APSWP...QSLLL..ILI.LG.FLIDMALIRAQEp.........................iwFFGTIAFT.LP...ALLAF.L.F.T.RF.TIRIQGKE........LAWNRS...GLLAL..ASVVIGIITTAFAAIGV--D................sGFYLPITYATG...........................LGMIL.SLRMPV.L.VA.VADYRLRRMI...........IPAALQSLFGLGAGYYY......................................FGGEFVL..WASGLLIIFG..I.GSSI.F.......IWLIDRPMKQAF.GLSGLSFLNAFIAHMTDG..SKTL...EDFFC..EI..GEDVTVPQVSLFFSR.........E..................G.....A..G...........DAVLT.IPNVHPGPMGEIGSANLP.KIIHDR.FDEE..........................IF.VAHGCATHDFNLVSESEADTII....EALENSR.KNLS......FSRRAS..RPV......RTRYG..S..V....EILTQRFSD.SILMISTRSPEKTEDIDFNIGMMIMAEGHRW..-FRDVAFIDAHNCMTEVSSP.....VLPA....TPLGTEYYRAALAAMEKA..LTEPL........LPFSVGICHRRL......P-..FTRT.EG.FGDLGIQVLAMN..VD.D.......................IKSALILFDGNNIHE.GVR...EEIRDAMSD.lVD-.......................ESEIMTTDTHVVNTVS-.....GKNPIGHII...P........VSSIIPHVRSAVLEALDD..MKPA.KSASVT..TWCEgLIIFGSH...R.I....AQF....AGTV....NAMLI.F.IPPLSLGILILAFILS............................................
U1NLA1_9EURY/8-612                   .............................................LAALSRVIFR...APSWY...SSVLF..TVI.IA.ALAGIASFDSRFil.......................edaWMGIFFIA.VP...TVIAS.G.V.T.PY.IDGRLGGR........LSPDQA...SLLAL..VCELLVVGGLVLVGLLSALVpr.............lgQGFVFDVLFAA...........................LAAVF.GLRLLV.V.MA.VSHRSPLRAS...........IPASVQTVSAGVLLFVYtgtaryleiggpiar........sylsrpedtpeellvIVPSDFL..LLGGMCLLYA..G.AVIG.F.......IKVIDRPWQRSM.EVSVLDFLRGFVGYVADG..TTEL...EEFFE..AI..GQEAVVPVTVLSFRG.........S..................T.....G..E...........KARFV.LPMVHPGPMGEIGGGNLP.AQIASQ.ADGL..........................AF.PPHATAGHDFNLVTSREVETLL....DTAADAM.DDMT......YRSGAT..ESV......RHGEG..E..A....TLLAQAFGD.SAFVTASYAPAFADDVEYAVGLSAAAEARHS..GLETVMLADAHNCSDGLNGEnl.ghVVPG....SKRSFDLIEGAGQVGETL..ADAPR........SPLRMGVAWDRT......S-..WDST.DG.IGPLGVRVAVTE..VG.D.......................QQTAYVLVDGNNMEP.GLR...DTLVDAVQD.hVT-.......................NAEILTTDTHVVNSVD-.....ASNQVGERV...E........TTELRSLVVGLLDDAIAD..LEPV.EAGMVT..NRAE.VTVFGND...R.T....ESL....ASHA....NAMIQ.M.GGALAVASAMAVTAI-s...........................................
D1YX19_METPS/5-573                   .............................................LASYADYIFE...APDIK...LSMGI..ALA.LS.ILIGAGSFPFTLsn........................niIAGLLLFF.VP...ALLSA.F.L.T.KV.MSNVFGEN........VNYDRS...ALISL..LMLIIVAVVTLAENVVTYLA................hIPYTYLGFVMA...........................LSLIF.AFRMLV.L.MG.ISVNSLPKVI...........VPASVQSLFSALALLYY.....................................tRLPVLYI..DLAISSIIFV..M.AAYA.F.......VRYVDHPMMKSF.GVSSLDFIQDFIAHLTEG..SPAM...EEFFE..KI..GESIDAPVNVLSFKR.........M..................D.....D.sI...........KAVIV.TPYVHPGPMGEIGGGNLP.TIVSGA.FNEG.........................lII.VPHGTAYHDFNLVSAEESEKII....KAAKTAL.GRVQ......YSTQAT..KSN......RVTVG..N..T....KILGQRFND.SVFLISTQAPTSTEDIEFSVGFTAMAESRVA..GARYSTIIDAHNCTEPFATA.....IEPG....TRDSYNIIRAAENSSKAL..LSMPM........GDIRLGVASSPP......I-..CTRL.EG.MGDLGIQVAVVE..AL.G.......................QRTAYIVIDGNNMVN.GLR...EDIIRRLP-..VD-.......................EAEVMTTDTHVVNTLS-.....GANYVGQHL...D........CDLLVDTVAQLVDKAISD..LEPV.KAGMES..ELATdVNVFGSH...K.I....AKL....ASTA....NAMVA.M.GGAFAVAVIVAALSL-t...........................................
A0A135VGM8_9ARCH/10-604              ...........................................tv--RLYSRVWQ...LPSYR...QIVLR..MVL.LV.LTGSLILSVTKGlll......................evfMNYLIILG.IP...VFVGS.G.L.L.YM.IATEEGSP........LDGRRT...AGLVL..FGLIFWISLSAIGGIIDSLRs...............sNVFEIRFSMLG...........................VSIAY.MAFAFL.V.NG.LSDHHPARNT...........TAALMPPVLWIIVELLFapln.............................aalptLPPLWYI..SVSASFIIAS..I.VVHY.I.......YRAVSVPFERDL.GINGPQLLRAFGHDYLAD.nPKPF...EDILT..KI..ATIQDIPVEILLFRD.........D..................A.....G..P...........VACGV.IQYVHPGPFRDIGSSDLP.SVIIEH.IKKKhg......................ipAF.VMHGSCTHQQNLTTKEDYPIVL....AEIDRLI.EATG......VHEFIS..GPH......WYDGG..K..F....KVWSLFVGN.DVLTISTSSPEFTDDISLDVGYDVANMIRERlpQIEGVAVVDAHNCIDDLAVS.....VNPG....DTDAGEYVGAVSGAVFST..INNEK........SRLQIGMHQIIP......DD..ISQS.EG.LGPGGVTATVLN..LS.E.......................REMALISIDGNNMEP.GFR...ENVQSLLKA.qGFD.......................ESEIITTDTHVVNAISLs..srGYPPIGRNK...-........PDETMEHILAASVKARER..IQPV.SAGLGF..GMARnLRTFGER...G.F....DIL....TQDV....AEAAG.I.AKR-------------mgiragsgsillyill............................
A0A218NMM5_9ARCH/16-614              .......................................lsnvkv------FSKS...LPGTR...TLLII..SII.YS.LLIGIISSSIAGhsifls................nlgsvmASGVLVGI.VA...LIVPF.T.M.T.II.AFKAMKRY........VTLKYI...LFSSM..ISLLSYGVFVMLSVSIASLTg...............iAALGVLVILLG...........................DAAIY.AWWFFV.S.KI.LLNERKA-SA...........LTSLIQPTLNLLFLIPVfkil.............................lipvlPLKILLV..KLYFGIFVFL..L.IAYV.I.......IYFIDSPIKKSL.GYSGFDVFTQMLQDWLFN.vNIMI...PQPIM..SN..SPSYNVNTDTIVFKD.........P..................S.....G.kV...........KGIFF.VPNLHYGPMGTIGSSNFP.YLLEKY.SVGNyk......................atTI.IMHPTVSDDYNAVSSSEYGKVK....SALSQGV.KSSIr....lNFSDNS..EFY......EGGYK..T..A....KVTLIKFGS.FGIATFTRAPRVTEDIAPETATLFKSA-LQA..YVKHPIMIDAHNARYESAPKkelesVKIN....SGIANDYIKAISSL----..HRISK........GKLKAGFYSVNP......AS..KINCgVD.IAPGNMNISVLS..FG.K.......................FKYCMIYFNANNVKP.QFR...ESLVNHIRK.kYGM.......................YGEVYSTDTHFVNSFKL....tASNVLGLHT...K.......ySKELEKMVDQGIESAVED..MSEC.TIGHSS..IKMKnFKIWGAN...G.R....DKI....VTTL....NSMIA.I.AKLAVPLVIIGGFF--la..........................................
A0A087RZR4_9ARCH/10-579              .......................................nihnrf-------SLTl.vNPSSH..yFSLFV..SLG.VA.VIISTTTLLEYLe.........................asIEETWHVI.PA...VIVVL.F.L.T.QL.LDTRFTKK........KEYSKS...LHSSL..FANMLWAATVLLGLLASFVL................gKETSLFFVTFG...........................MFLFA.SFRIGI.Y.TT.TLGVNLKKAW...........AICFVQPLAMFAVLIPQd...................................lwFQTLSDP..MALFYGVSFM..I.IASV.W.......SVLTDRAGRPGM.-ESTHKTIQAYLASQKND..HTEA...EEIME..ER..SSETKVATSQIRLSA.........N..................K.....G.dK...........EFRMV.LPEIHPGPYHPVGGSNIP.YLIYKN.LSSS..........................AM.VMHSISDHSLNLPSKNEVENYL....KNLENSK.VT-E......EGLQCT..EPV......TVQIN..K..A....RVMGLLFGK.NPLLFLSLSPHGMEDIPNYMKNDIEQYAKNR..NYSKPLIVDCHNAMGEEIS-.....----....NEDGEDMLKAAKSCLDTL..ITKDS........FPIEFGYANSDD......MD..VWT-.ED.LGMGGLGIVCLK..IN.E.......................KKYFLGWADANNMEN.GVR...EKIIDIFVK.kD-L......................qLLEICTSDTHYAPVKARn..rnGYYQLGLIT...S........AEKLAKWFLEIAGNAESN..TTTA.KFEILE..NETK.VKVMGQG...I.Y....EDY....SKAL....DNSLK.I.TKGFLIGGVIFFIT--sl..........................................
A0A256KNA9_9EURY/1-364               .............................................----------...-----...-----..---.--.------------............................--------.IP...FVVAA.E.L.F.PR.VLDG----........YPRPWS...YFLAL..TSQFVLFVYALVLTGANN-V.................GNAWSIIWLSF...........................ITLYL.INILVL.V.VS.TGIDRSDRIL...........LVSLVEPAALITAFYALggs................................dlgFSTYRHV..FAFASLLIAA..G.FLVL.V.......LLVVDYLIKSNT.DVSAFALTSGLL----RN.dRESL...-----..DL..GVEARPSVETFAVDN.........G..................-.....-..D...........RLTVA.APWVHPGPLGGFGGGQLSgNLIDAL.NDGReadgaergrgeaatdggvgaaadgsaGF.FFHVPCTHKEDLSNPADAERIL....DAVAAPE.RTER......TSRLVT..KSY......GEREGyaD..V....RFHGRRIGD.--KEVIVLHGEGIDDYDTGVFMRDVDN----..--DEVLLIDQHRHDIQNGPDv...eIQYG....SAEADRLKRAFDEFR---..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------e...........................................
A0A2I0P106_9EURY/13-260              ............................................i-ESMSRYIFT...APGWP...KSIVI..LVL.LG.LLMEALSWRLSPh.........................frFFGVLCFI.IP...GLVAL.I.T.T.RP.FITVIGRQ........MTWNRS...ALLAV..SCTLFSSLITLIGLIAL---.................REFLALIFAIA...........................IGFIF.GLRLLI.L.VS.IADSRMPRVV...........VPAIIQSLTAYIGGLFI......................................FSDPFMI..LAPVLLILFG..S.GFAG.L.......IWLIDRPLNRAF.RIRGLEFLNAFIAHLTDG..SRSM...EDFFR..GI..GEEAFVPQVSIFFRR.........P..................E.....K..R...........DLIFT.IPNVHPGPMGEI------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------............................................
A0A2H9L2E1_9ARCH/16-599              .........................................sigd------FFFK...LPRQG...VLVAY..LFA.LC.FSAGVVLRMIAGsplwd.................alvfggTEGILLLA.GP...ALIAA.V.L.A.PP.LFAS---K........RTLKHF...LFIAT..ASSAANILVLLAGTLSVRSL.................GMELLNFVLIG...........................NAIVF.IVWFAA.C.FF.GLGLGLARSG...........TVALVQPFLDVAVMFIWarfgff.........................ataldvgSPLLAFV..KILLAAGVFL..S.ALWA.V.......SYVINAPAKKNF.GISTVEAVVLFFSHWVRG..GKGL...EEVLS..EF..GEEVETTIGAITFRR.........K..................N.....K.sI...........KSVFV.VPYVHFGPFGNLGGSEFP.ALISKD.VEARlg......................apTL.VFHGTVNHDFNPVYSSSESLLT....NAVIAMA.RRER......--GAEG..RAA......FVSDP..S..G....SVAGISFGT.DGFLTLSLAPEGTEDINLAIGHALRYKAQAV..GFRHALLADRHNSCTDGML-.....LEIG....SPAYYKFEDAISSMSP-P..SAASQ........KPFRLGIASASL......P-..FTRE.QG.VGAMGLRVAVFE..IG.G.......................KRSCYVLVDANNALP.GLR...ARVLSLIKR.hGFD.......................YGDLFTTDSHSVNTLSG.....VTNPLGLRT...D........EGRLLSAIDAAIHRAVED..AESC.TASFAE..QRVR.LRVFGAN...R.Q....SEL....ITAI....NSTVS.V.AKIVAPFVFVAALAL-a...........................................
U1N8U3_9EURY/8-412                   .............................................LAGLSRFIFR...APSWY...TSLLF..ALL.IA.AVAGIAAFESAQsftswrg.............vfilgrdaWEGIFFIG.VP...TVVAA.F.G.T.TG.VDRFVGGK........LTANRS...SLLAL..VSEVILVVVVTAAAVISVFTg..............ldQRFVYDVLVIA...........................LASIF.ALRLLV.V.MA.VSRSSLLVAA...........IPASIQPGAAAALLFVYsgtlrylsvggpilnay....ltphlarasqappellvISADHFV..LLGITSGVYG..L.AVYA.F.......IIVVDRPWRRSL.GVSVLDFLRGFIGHVAEG..SREL...EEFFE..EL..GEEALVPVSVLSIIR.........E..................D.....G.sE...........KARFV.LPMIHPGPMGEIGGGNLP.ERVAVT.ADGL..........................AF.PPHATAGHDFNLVTESEVDTII....ESVEAAA.SRIT......YASHAT..ESR......TTDAG..E..V....SMLGQAFGE.NAIMVSSFAPGFADDX---------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------xxxxxxxaqksa................................
A0A256XUM2_9CREN/11-556              ............................................l-TKYYKFIFS...FPNLR...VLLCE..IFL.LL.GF-WILQILIFP...........................qIFETS-IL.LA...VLISS.I.I.F.GL.TLYLLDKE.......iFTFRRS...IALIP..IFILWGFIFDLIYTFSLN--.................-----------...........................VLVPP.LLTMLTpA.FF.LSEKKSLKVI...........F--SLYATLYILASILS......................................----ENL..PLSVIILLYI..F.LVSL.I.......HHNVDKRIYKNM.NIGGISLFRSFIRYILSG.dKSLL...EENLS..IL..GKLRSIPIYKILFYD.........D..................T.....G..V...........IGGIM.VSYIHPGPLRDLGSSTLPfKIIKKG.EEIGi........................pIL.YLKGACTHAENLIKSDSIKKII....DTLFIEK.SNEE......-NTQFL..GIK......RIDVD..D..V....TTLHFLFDH.KLLSIVSRTRIGMEDIPYELRELISQKIS--..--KEVILVDAHNRLPHSKTYe...sPIPG....SDLARKIEKTFEIF----..EKPKL........SSLEVGFSHRNI......GE..--NR.YE.IGPGGVTSLVIK..TN.G.......................KKYFLISFDGNNMVD.GVR...DYLYHYIIK.qKNF......................mDGELMTTDTHVFSGLIPg...vEYHAIGETL...S........RKYLAKITDSLLEDALKN..TRKVsRISITK..IMVN.SYFMDET...K.L....NLL....SELT....RKNVR.D.GLILTGFLFLTYLL--al..........................................
A0A2G1WEM4_9EURY/6-552               .........................................vdvf----QRLVFS...VPSLS...RQIPA..MAL.LA.VAYSVVAFTAFSmftpls...............pepstllPVAVLLFL.LP...FLFAG.E.L.F.HR.VLPG----........YPRTWS...FFLAL..TNQLVTFVHVLVLSGANDV-.................GNAWSIVWLLF...........................ITVYL.INILVL.V.IS.TGIDHYKRIL...........FVGLAEPAALIAAFYAFagg................................dlgFTTYRHV..FAFASLLIAA..A.FLVL.V.......LGIVDYLIRSNT.EVSAFELTSGIL----RN.dRASL...-----..DL..GVEAEPAVETLAIDN.........G..................-.....-..D...........RLTLA.APWVHPGPLGGFGGGQLSgNVIDAL.NDGEegd...................dgesGF.FLHVPCTHKEDLSNPGDAEKIL....DAVADPE.----......RVARAS..RLV......SHDYG..E..I....EFYGRRIGD.--KQVIFLHGEGIDDYDTGVFMSDVDE----..--SEVLLVDLHKHDLQNGPEk...eVLYG....SAEADRLKRHFDDFRERL..ADAPR........SDYAAGFS----......--..----.VR.HADQDVAAIVES..VD.G.......................QEVLLMGIDTNGVTP.DVR...ELA-ADYRE.tFD-.......................EVLIFSTDTHASIH-E-.....------LAN...T........TRSDTDALTAAVERAAGD..VAPA.TVGLTS..RRTRpLKLLKND...-.Y....NGL....VFSV....NILIR.L.TIIALAMLYALLVI--wl..........................................
A0A1M5JNR3_9EURY/8-634               .............................................LAGLSRFIFR...APSWY...TSVAF..ALL.LA.AVAGVGAFEHPEtsvvwrg.............vlfvgrdaWEGVFFIG.IP...TVVAG.L.A.T.AW.VDRLVGGR........LTPNRS...SLLAL..VCEVVIVAFLATGALLAYLTp..............laQRFVFDVLVVA...........................LASVF.AMRLLV.I.MA.VSRSSLPVAA...........VPASIQTAVAAVLLFVYsgtlrvlevggpfldtf....lmpylsrpeeapselsaISPDHFV..VLGLICGLYA..V.AVWT.F.......LYVVDRPWRNTL.GVSVLDFLRGFIGHIAEG..TREL...EDFFE..QL..GEEAVVPVTVLSIRT.........E..................D.....G.dE...........KARWV.LPMIHPGPMGEIGGGNLP.VRIAES.TDGL..........................AF.PPHATAGHDFNLVTEREVDTVV....AAVDRAH.SRLT......YSPTAT..ESV......RTTAG..E..A....SVLGQAFDD.DALLVSTFAPEFADDVEYAVGLSTAAEARTA..GLDDVLLVDAHNSNNGLDGPdl.ghVTPG....STRSFDMMQAARRAGERL..AVAPR........GDLSVGVAWERT......D-..WTPE.EG.IGPLGIRTMVAE..VS.Agdd.................adsQTTAYVLVDGNNMEP.GLR...GHLVDAVVD.aVDT......................dEAEVMTTDTHIVNTVE-.....ADNQVGAVV...D........RDALTDVVVDVAREAVAD..TEPV.ETGMAT..EHAE.VTVFGND...R.T....ESL....ASHA....NAAVS.M.GGALAAAVILASLAIS............................................
F7PJI2_9EURY/8-611                   .............................................LAGLSRYIFR...APRWY...SSIGF..ALL.IA.ALVGVAAFDSRYil.......................edaWQGIFYIG.LP...TLAAG.V.L.T.PP.VDRLIGGQ........LTPSRA...SLLAL..GCELLVIAIMTSASLVAALTs..............lgQIFVFDALLFA...........................LAAIF.AVRLLV.V.MA.VSRHRLAVAA...........IPASIQTVAAAVLLFVYsgtmryleiggplar........sylsrpeqappellvVLPNDFL..VLALLCLLYA..I.AVWL.F.......LVVIDWPWRRSL.GVSALDFLEGFIGHIAEG..SNEL...EEFFE..EI..GEEALVPVTVLSFRR.........P..................A.....G.eE...........KARFV.LPMIHPGPMGEIGGGNLP.KRIAQE.ADGL..........................GF.PPHATAGHDFNLVTEREVETVL....DAAEQAH.ERIE......YSETAT..AGE......RIAEG..E..A....TLTGQAFGD.HALATVTFSPGYADDVEYAVGLSAAAEARNG..HLSEVMLVDAHNCNNGLDGEnl.ghVVPG....GERSFDLIHGADRLGEAL..AAADQ........GTLRLGTAHEET......P-..WEPE.DG.IGPLGVRVAVVE..VE.G.......................ETTAYVLIDGNNMEP.GLR...EEIVAAIDQ..VD-.......................LLEVMTSDTHVVNTVE-.....AENQVGDQI...P........GAELIDVIDGLVEDALAD..LEPV.EAGMAS..EQAE.VTVFGTD...R.T....ETL....ASTA....NAVVS.L.GAPLAGIFTLAVVAIS............................................
A0A1H1DGD0_9EURY/8-630               .............................................LAGLSRFIFR...APSWY...ASLGF..ALL.LA.AMAGVAAFDTGEavrtwrg.............lfflgkdaWEGIFFIG.VP...TIVAV.F.G.T.TG.VDRFVGGK........LTPNRS...SLLAL..VSEVIMVAIVTIAAIVSVFTp..............ldQRFVFDALVVA...........................LASVF.AFRLLV.I.MA.VSQLSILVAA...........VPASIQTLTAAVLLFVYsgtlrylsfggsllsay....ltpylsradhapaalsaLSPDHFL..ILGVMCSVYA..A.FVYG.F.......IVVVDRPWRRSL.GVSMLDFLGGFIGHVAEG..SREL...ETFFE..KL..GEEAVVPVTVLSFRE.........P..................G.....G.sE...........KARFV.LPMIHPGPMGEIGGGNFP.ERVARR.SEGL..........................AF.PPHATAGHDFNLVTEREVDTIL....DTAEDAY.RSIE......YGTEAT..ESV......RTESG..E..A....KMLGQGFGD.DALLVSTYAPGFADDVEYAVGLSAAAEARTK..GLDDVLLVDAHNSNNGLDGPdl.ghVTPG....SKRSFDMITAAGLAGEEL..READR........GDVSLGVAWHRT......N-..WTPM.EG.IGPLGIRVSVTE..VN.G.......................QTTAYVLVDGNNMEP.GLR...DELLSDLTE.gEDAp....................adVAEVMTTDTHIVNTVK-.....ADNQVGAAI...D........WDELRTLVADLVEEAEAD..CEPV.EAGVAV..ELAE.VTVFGND...R.T....ETL....ASHA....NAVVS.M.GGAFAASVILAAMAVS............................................
A0A1I0P0W3_9EURY/8-616               .............................................LASLSKYIFR...APRWY...TSVAL..SLV.IA.ALAGVAAFDSQYil.......................edaWQGLFFIG.VP...TVVAS.L.A.T.TP.VDRYFGGQ........LTYNRS...SLLAV..ACEVVVVVVLVLAGVVAVLIpr.............fgQNFVFDALIAA...........................LALVF.AVRFLV.I.LA.VSRNSLLVSA...........VPASVQTATAGLLLFVYsgtmnylteggplvp.......aylsrpaqappeiqyaFAPEDFL..LLAAMTGLYG..G.VAYG.F.......VLAIDRPWKRSL.GVSVLDFVGGFIGHIAEG..TREL...EDFFE..QI..GEEAVVPVTVLSFRR.........T..................S.....DetE...........KARFV.LPMIHPGPMGEIGGGNLP.QRVAES.ASGL..........................AF.PPHATAGHDFNLVTEREVDTLV....DAAADAH.ETIE......YSDTAT..RPV......RVQEG..E..A....KLLAQAFDD.KALLVSTYAPKFADDVEYAVGLSAAAEARVE..GMDDVLLVDAHNSNNGLEGDdl.ghVYPG....SERSFQMIQAAGTAAREL..RDAEE........SVMRLGVAWDRT......P-..WRPS.DG.IGPLGVRVSVLE..TG.G.......................DRTAYVLVDGNNMEP.GLR...DELMDALDA.vGVD.......................HAEIMTTDTHIVNTVE-.....SSNQVGAAI...D........WDDLTDVVVDLAEEAVDD..LEPV.EAGMAS..ERAE.VTVFGND...R.T....ETL....ASHA....NAVIA.M.GGAVAGLAVLATVTI-s...........................................
K0BAD4_9ARCH/10-580                  ......................................nihnrfs--------LTl.vNPSSH..yFSLVV..SLV.VA.SVSVLAIYFGYLg.........................nlGFEENWYR.LP...IVLAVlV.L.T.QL.LDTRFSKK........KEYSKS...LHSSL..FGNMLLTVTLLMGILSSIVL................sKDLQLFFITFG...........................ILLFA.SFRIGI.Y.TT.TLGASLKKAW...........TICLIQPLAMYFVLIPQd...................................mwVSILSEP..IGLGYGISFM..V.IASV.W.......SVLTDRAGRPGM.-ESTHKTIQAYLASQGND..FADA...EELME..QR..SSETKVSTSQIKFST.........H..................D.....G.qK...........EFRMV.LPGIHPGPYHPVGGSNIP.YLIYKN.LSSS..........................AM.IMHSISDHALNLPSRNEVEKYL....KNLEKSK.VKEE......-GMKCT..EPV......TVQIN..K..A....RVTGLLFEN.NPLLFLSLSPHGMEDLPSYIMTEIVQYAKNR..NYTRTMIVDCHNAMGEEIS-.....----....KDDGEDMLKAAKSCLDSL..ITKDS........FPIEFGYANTDE......MD..VWT-.ED.LGMGGLGIICLK..LN.E.......................KKYFLGWADSNNMEN.GVR...EKIIDIFAK.kDYQ.......................LLEICTSDTHYAPVKARn..rnGYYQLGLIT...S........ADKLAKWFFEIAKKAEQN..TGKA.KFEILE..NETN.VKVMGQG...I.Y....EDY....SKAL....DNSLK.I.TKGFVIGGVIFFV---tsl.........................................
D3E2D0_METRM/7-598                   .............................................VAGLSKYIRT...LPKAK...STFLM..IIV.LS.FIIGAVLFLVKPmslgsgl..............enffyggAFGFVVYG.LP...AIITG.A.T.D.QK.WVSTLKGI.......nLKMKHS...MFLAL..VSMTMAGVISIIGTIIGNIL................hFDLFINSILFG...........................IVIAF.AFNILV.I.WS.VTRIRLIKSV...........LVAIIQPLLMIGVLIITsflnnle........................svfelgiF--TTFF..KVIIASAVFL..L.AIYS.F.......ISIVESPMKKNL.GFGALEILSFFISHMNEG..SKSI...EELFD..NA..GEAIDTLVGVCSFRK.........P..................D.....G.dI...........KALFI.SPCVHPGPLGDIGGSNMP.TILANR.FDSF..........................AM.VAHGPSTHDFNPVSSDEIVKIE....SSVRTAL.ENME......YSSKAS..RFV......RYSHK..K..A....NIGTQFFNN.GCVMLSTFAPSGSDDIEFAVGLATMIESQKE.lEIDNPILVDCHNSFNAEKGG.....VLPG....NPELFQLLDTIKLI-E--..KKDLE........HEIKVGCYSTDL......GG..FGKH.EG.IGDSGLKTMVIE..VD.G.......................QRTAYVLFDSNNMEL.GYR...ETIFNAVED..--Le....................idEIEVMTTDTHSVNTLSA.....GYNPVGTVE...-........KEKIIEYVRESIIEAIDD..LETV.EAGTRT..ERIEnLKTFGPN...N.S....TEL....ISTI....SSIVS.V.SKIAAPLIFIMAIIF-v...........................................
A0A060HFG8_9ARCH/11-594              .........................................nihr-----RWSFTritPGSLR...ASYAM..MLA.CA.AVVIAVSHVFHLq..........................tDMTSLAVH.LP...LGLAV.L.V.G.LT.YLDFAMLRgt....pvNKMSKV...VHVTS..FANLLWAITVIVGILASTVF................aKPGTTDYIVAG...........................MLLAA.GLRISI.F.VS.VFGAGMGRAI...........AICLVQPLIFFLAFVPAqs.................................yniV--ITDP..AGLGFGALFV..A.LAIS.W.......AAIVDRAGRPEI.-PSTFRVLQAFLSAWTEN.kAGGL...EEYLE..SR..AHDESVSTRIIRFLP.........Q..................G.....AgnN...........QSAII.LPDIHPGPFGSVGGSNLP.YVLYER.FGKS..........................AL.VMHSVSDHSLNIPSKAEVDRYI....SSLSGAA.VQSR......-GKTCS..LPV......QHRQG..N..A....TATAIVFGK.SALLMLSLAPKGMEDVPQSVRKELESYAEGL..GMDHLLLVDCHNAMGAQLG-.....----....DQDISDLVAAAKKCLDEA.gKEKAQ........YEFSAGFAGLAD......VKhsLHNS.HD.LGQAGLAAIAIV..TQ.G.......................RTFAIGWADSNNMDN.ALR...DKVVARAGS.sNNNsnn.................gitMLEVCSSDTHSTSGKRTs...eGYFALGGAS...D........QDAIAGAYAEMCRVAQER..ASPC.TYEVSS..ARSE.VKVMGEK...Q.F....QDY....SGAL....DRAMN.I.TKVFVGTTVAVFIAM-q...........................................
A0A031LS02_9CREN/7-513               ............................................t-RKYYSKIIT...LPSTK...ILLPL..ASV.ES.IAV---------............................VIRSLIVG.FD...LLYSF.L.I.Y.AV.AISLIFWN........-KYRST...LFFFS..FFPIIYIIFSFFGKVYL---.................-----------...........................FTFGT.LVPLTN.Y.AM.LIDHRDITAV...........GLSTLIAILPTLIYPN-......................................------F..WFILFPIVVG..V.LSFL.Y.......ISSINRKGRKIM.GISSMSVLRPFLRAISYK.kDNEV...ESFLS..KI..SIPSLLNVMVLRL--.........-..................-.....-..N...........DIYII.LPQIHFGLYGKVGSSFFP.YLFEES.LPK-..........................SF.VFHGPGSHEIDLPSLKETKKVV....EEILSNI.KNME......-KISFG..EIE......TEEFD..G..F....RATSIIFDN.ISLSFLERPNGGIDDLPGSLWTTMVER----..---KDFIVDCHNQTLKKEI-.....---G....RKERDEIRNFLGRKVK--..--FGG........NKLRIGYAEGKL......EG..---C.EG.YCNEKIKVLTFI..SE.N.......................KKTSIVYVFANNACE.GVR...EKIRENAS-..-DL......................tDAILVTPDDHTCTASS-.....----LGNLY...Qpa....tlCPKLITESRRLIEESLNN.aLEVN.DAEFKM..IKIK.TRVLGKV...-.I....SSL....TEGL....EKVGS.Y.AIKTVWIPIALPYLV-l...........................................
A0A0M0BSN0_9ARCH/11-594              ............................................i-TDYYSYLFT...FPSQA...AMIAA..TAG.IS.MAGCAAAFALVWglas...................lvrglLLGLLGLF.LP...VVASD.A.L.V.--.-AAMFKGDl......fLTWRRF...TILSF..ISSIAYVAVALIFSSAAALTg...............rGEILVRGIVFA...........................VALSS.PLRYLV.V.AV.FSTRGSGMNL...........AATFLQPALCLAAGIVLl....................................rITELRVA..ALWALSASVM..VcGVQL.L.......VWVMDRYGDSPQ.GLRLIPLFRALILAWADE.hGAPL...EEYLA..RV..GEVRDLRVDALTYIE.........P..................E.....G.pC...........RAALV.VPYIHPGPFRNVGSSGLP.EMLVDR.LGAKmg......................ceVL.VAHGPSTHEMDLTSRVEAERVV....ETVAAGL.RADG......AVDLAS..PMV......RVERH..G..A....QASCQVFGS.IALVTLTLSPKSYDDLPESLGGRIMRAAEDV..-GLTAVVIDSHNSILEGDD-.....--LG....SADLESLFEAAVEAMAMA..NESPR........SSFSAGAARLIP......GE..WGLN.DG.MGPSGISALAVV..VEaG.......................QTCVYVAVDGNNMRS.GLR...ERIVEAIRS.rGVD.......................EAEVFTSDTHLVNAIGVt..srGYHPIGEKT...D........EERLEGYVLDVVAASLSK..VRRC.NVSHTP..IEVAdLTVLGEA...G.L....KLL....SDVL....ESAFG.L.FKRTTLVLAPSS----lvl.........................................
M0P2F8_9EURY/6-549                   .........................................vdvf----QRLVFS...VPPLS...RQLPA..MAV.LG.VAYSVVAFAAFTaftpls...............pepstiiPLAALLFL.LP...FLFAG.E.L.F.HR.VLPR----........YPRTWS...FFLAL..VNQFVTFVYALVLSGAN--D................vGNAWSIVWLLF...........................ITIYL.INILAL.V.VS.TGIDRYKRIL...........LVGLAEPAALIAAFYAFagg................................dlgFTTYRHV..FAFASLLIAA..A.FLVL.V.......LAIVDYLIRSNT.DVSAFELTSGIL----RN.dRASL...-----..DL..GVEAEPAVETLAIDN.........G..................-.....-..D...........RLTLA.APWVHPGPLGGFGGGQLSgNVIDAL.NDGDdg......................esGF.FLHVPCTHKEDLSNPDDAETIL....DAVADPE.----......RVGRAS..RLV......HRDYD..E..I....EFHGRRIGD.--KQVIFLHGEGIDDYDTGVFMGDVDE----..--SEVLLVDLHKHDLQNGPEk...eVLYG....SSEADRLKRHFDDFRDRL..ADAPL........HDYAAGFA----......--..----.VR.RADQDVAALVES..VD.G.......................QEVLLLGIDTNGITP.DVR...ELAADYREE..FD-.......................EALVFSTDTHASIH-E-.....------LAN...T........RRSDTDALTEAVERAVDE..VAPA.TIGLAS..RTTRpLKLLKND...-.Y....NGL....VFSV....NILIR.L.TIIALAVLYALLVI--wl..........................................
D3TAX2_ACIB4/9-557                   ...........................................ml--SLRRHVVA...TPRYE...ITIIL..SIV.FI.IIASYLISFDI-............................WKTILFFG.LP...YIIVI.L.L.D.IL.IIRFTRIY........FPSRRI...ITLNL..VVAISAIVQIAIFQLFYP--.................---FEFSLFLA...........................FSSAT.FLRTLV.Y.YV.FMRRKPGLAI...........LTSLNYNIIYAIMLPFV......................................-GKNYIL..PFIVSTTIYT..V.IALL.I.......LKISTVQFIKEF.GEDPLWFISSFVNYLSNE.tKENVhhiNRFFE..SI..YDKRKAPVSTLIFWK.........G..................E.....K..P...........KAIFV.FPYIHPGPFGNVGGSNLT.KKLRDF.TGMS.........................nLL.VFHTTTTHDNNVANDKDVKKIA....EVIKRSL.NSQK......KYEKMS..DIY......RFKID..G..F....EVLTQIFGK.YAFISLLPTNNIFDDVDLESGLILRNKLSNI..-YEDSAIVDAHNNFDEDATP.....LSLK....NKDINRIVERMKNI----..--KAD........APIKMGYSQRLI......KG..----.DS.VGPDGIKVAVFE..YK.N.......................KKMGYILVDGNNIKK.GFR...DKVKSSVKE.lLD-.......................DVEIFSTDNHIVNYDIL.....DLNPFGSKD...S........WEDLIKNIRDAIKDAINN..IEDV.KVSMHT..ENVE.FIMARRG...Q.L....KRM....SDIT....KDALR.R.VKISIPLLTL------ggff........................................
A0A087S5M6_9ARCH/1-207               ............................................m----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..----LWAATVLLGLLASFVL................gKETSLFFVTFG...........................MFLFA.SFRIGI.Y.TT.TLGVSLKKAW...........AICFVQPLAMFAVLIPQd...................................lwFQTLSDP..MALFYGVSFM..I.IASV.W.......SVLTDRAGRPGM.-ESTHKTIQAYLASQKND..HTEA...EEIME..GR..SSETKVATSQIRLSA.........N..................E.....G.gK...........EFRMV.LPEIHPGPYHPVGGSNIP.YLIYKN.LSSS..........................AM.VMHSISDHALNLPSKK------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------............................................
A0A1J4UIY2_9ARCH/10-604              ...........................................vg---VTRYAFE...LPTYK...RIVVY..ALI.FS.AFAGVVGYVLQRgigssa...............aafvfggADGIVLIA.VP...LLAAA.A.L.A.AT.VTSRKMFR........KGFRRF...AFVGL..VCGFIYGAALVATLAFASNGf...............aSRFLEQASLIL...........................VANAL.VTVIWF.I.AGfVALNLGRKAF...........LLAVFHPLLNMAFLVIWqgygvv.........................aasievgSPWIGFV..RMLFAALIMM..L.AVGA.L.......FFVINAPAKRNF.GISSIQAATLFLAQWHSG..EKGL...EEVLA..EM..GETVQTYLGVASFKT.........R..................D.....G.rQ...........KAVFV.APYVHFGPMGNIGGSEFP.FLLARE.VEMHvg......................apAL.VFHTTAYHDFNPVHSSSATQLV....TEINGLV.DSVK......KFDDRA..AFV......SSCVD..G..S....CVDGLTFGK.NAFFTLSRAPSATDDIELSLGIALMNKAKSR..GFNEVLLFDRHNSKAPG-GA.....VEAG....SKAFYAYDDAVGKLSP--..CEEKQ........LPFKMGVAQQPL.....fPE..FTYS.DG.LGKAGIKAVAFE..TN.G.......................KRICFVLVDANNCVS.VFR...QKTVKAIKA.vGFD.......................YCDLMTTDTHAVNQNA-.....VENPLGAKP...S........HQKILSLIEKTAKRALDD..LEPC.KAAFAM..KRID.IDVLGAR...R.S....SEL....LSTV....NSVVA.V.LKILAPTIFIVSLAL-a...........................................
A0A256YVS1_9CREN/1-129               .............................................----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......------------.------------------..----...-----..--..---------------.........-..................-.....-..-...........-----.------------------.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................----LVYIYGNNMDG.KFR...RKLEKLIWS.lGIT.......................DAEIITPDDHSCAA-SI.....KESPYDIVS...E........CRSLVNAVRKALTSAINN..--EV.RAKYSTleVVIKnVKFVGHK...I.F....-DI....AYSV....QGVAK.V.AERMLMLALAL-----lnllpilflfi.................................
A0A0N7HBY7_9ARCH/11-590              ..........................................slh----KRWLFTn.iNPSSE..kFSFLI..AILsLI.TNIALINFVITP...........................hSIADFLIS.LP...IIASV.F.S.V.TL.VFDYLSLR.......gTPLNRFskvLHVAA..FANLLWTLTVIGGYISEFIIn...............tNTPNINFVLQG...........................MFMAI.GLRIGI.F.VS.VFGASLKRSI...........PISFIQPLIIFILFSFFyf..................................nhIFYTNFT..VYVFGSVIL-..F.IGVL.W.......TIVIDRIGRPNF.-TSAFKILQAFLIAWTEN.kSDEM...EKIAE..AK..ASPKMVNTLIVKLRP.........K..................N.....Q..K...........EISIV.LPELHPGPFNPIGGSNLP.YDIFKF.YSNS..........................AM.VMHSVSDHSLNIPSKKEVEKYL....MSLDQHN.-HLE......AGDKCS..IPL......TIRNQ..D..C....NCSGLALGK.NVIIMFSKSPSGMEDIPPDVKTELEMYAKQI..GFEQILIIDAHNSLGEKIE-.....----....QENIEVLIKIGKECLIKL..RESEQ........FPFKIGYANSYQieeqtnKD..LLKQ.PD.LGHGQFGLLIIS..IN.K.......................IDYSLCWIDSNNMKN.GFR...EKIVDALEA..ENL......................kVIEVCTSDTHSTSGKRNi...kGYYTLGDVT...P........ESKILNVFKSLATRAKNS..LDIS.TFDVFK..IESQ.VMVMGND...Q.F....DDY....SNAL....EKSFL.V.TKIFLAITFVVYILM-l...........................................
A0A0F7IFV4_9EURY/7-532               .............................................LEKFYSKIFS...VPKKR...VSVAI..GIT.SI.VLASYLNGISGKs.........................ffAMRYFFIG.LA...LLALL.L.F.F.GR.L---LGSG........FNSRRI...FFFAL..FMLVLIEIADVIAIHLL---.................---SPELIVVS...........................PSAIA.FILSVA.L.YF.TSERFSY---...........LAPLLILALLYPVDYLFs....................................fSAPHRGL..AYALSSLAGV..S.LSYL.F.......VSFMSGKAGR--.-IVVSDILRDFVLYWLKG.ePGIF...ERRIK..MY..SEVREGKVFVIRV--.........-..................-.....-..G...........DATLI.APEFHPGPFRDIGGAKLV.ER---A.LGRF..........................SM.FLHAASTHATNPSTGEDVEAII....RVT-PEF.---E......-GARAR..KPY......SVEGK..R..F....RLKIYPFTT.-FTLIIIHGKESIDDIPSEVRDIAE-----R..FFANPIVVDGHNAYAERYEL.....T---....PEDMTEIYMLMEKASQ-I..SPDEC........GRFEAYFTSADY......ES..----.QS.IC-GKLALLLMS..FE.G.......................ERHGILMVDANNMDI.ELR...EYLERVGKK..YGV.......................ELDVITTDNHSKTGVSPk...iGYKPAGMVD...-........----AEAIESFLERAMANakLSEV.EVEFGV..ASVR.VTVMGER...F.F....KDV....DAAF....KNYGE.R.AMYLFILFSALNYAL-t...........................................
V4Y4T7_9ARCH/8-629                   .............................................LAGLSRFVFR...APRWY...ASLGF..ALA.LA.AATGVAAFDAGQnasgwsr.............llvlgqdaWEGVFFIG.VP...TVVAA.F.A.T.TG.VDRFLGGR........LTYSRS...SLLAL..ASELILVVIVMTAGVVDVLTp..............laQRFVYDALVLA...........................LASVF.AFRLLV.V.LA.VSRSSILVAA...........VPASIQTLAAAVLLFVYsgtlrflefggpvlsayl.prlfpylsrtdeappaltaIGPNHFV..LLGVTCGIYA..V.AVYG.F.......LRVVDRPWRRSL.GVSMLDFLRGFVGYVAED..SHEL...EAFFE..DL..GEEAVVPVSLLAFRR.........P..................D.....G.tE...........KARFV.LPMVHPGPMGEIGGGNLP.ERVARS.TEGL..........................AF.APHATAGHDFNLVTEREVDSVL....DAVSRAE.SRLR......FDDGAT..PSV......RVERG..E..A....SILGQRFGD.SALLVSTFAPGAADDVQFGAGMPARLAARST..GLEEVLLVDAHNCNVGLDVDei.phVAPG....SERAFDLHDGAEETGARL..VERSP........APLRLGVAWDET......S-..WDPD.EG.IGPLGVRVAVVE..VA.G.......................QTTAYVLVDGNNMIP.GLR...RRILDRLAS.rVD-.......................AAEVMTTDTHIVTTVE-.....ADNQVGEKI...A........SDALVALVDDLTATALAD..CEPV.ETATAT..ERAR.VTVFGND...R.T....ETL....ASHA....NAVVS.I.GGALAAAVILAAVAVS............................................
U1QNX8_9EURY/5-284                   ...........................................le--SFELFVVS...IPRTR...RVASY..ILG.VS.VFAGLLTAAALQfgadlgwtv..........elsaldgtaVSRTLVLV.VS...FAVAA.L.V.G.GE.TTQLLVPV........YPRNWG...YYLAL..VCLVLVGVLVPVGVLLGGAT................dDAAAPVWFALG...........................TAFLF.SVQGLV.I.SG.DI-PGVWRYG...........PASAVQPAVLFFGLTVAtp..................................lsLSLSAHA..PAIAVLVGVG..V.GLVL.I.......SGFVELLMRANVpEVRAFEITSNLV----QR.tPLHL...-----..GM..GFSMDRPVQTFAVET.........D..................-.....D..G...........QTQIT.TPWVHPGILEGIGGARLTpNVLATL.N---..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------gqtd........................................
A0A1H3ISZ2_9EURY/6-546               .........................................vdvf----QRMVFS...LPPLK...VQIPA..LVA.LS.LVYSFGMHLAFTvftpir...............lsiplvlVAGSLVFL.VP...FLLAG.E.L.F.HQ.VLPR----........YPRSWS...YFLAL..FNQFVLFVYGLVLSGADT-T.................GNAWSIVWLAF...........................ITVHV.NNVLVL.L.IS.TGIEYYKRIL...........AVSSAQTAVLVAVFYLFvgg................................algIETYRHV..FSLASVGIAA..V.FLVL.I.......LLAVEYLIKSNT.DVSAFTLTSGLL----RN.dRESL...-----..DL..GFEAEPDVQTLAIDN.........G..................-.....-..D...........RLTLA.APWIHPGPLGGFGGGQLSgTVIEAL.NAEG.........................tGF.FLHVPCTHKEDLADPEDAEKVL....EAVADPE.----......RTGRAS..TLV......HRDYG..E..I....EFFGRRFDG.--KRIVFLHAEHIDDYDTGVFMRDREE----..--SDVLLVDLHKHDIQEGPEk...eVQYG....TAEADRLKRYFDDFLGTL..DDAPL........HDYDAGFD----......--..----.VH.LGDRDLLAMVEV..VD.G.......................ERTLLMGIDTNGVTA.DIRdleAEYREEFD-..---.......................HVLLFSTDTHASIHDL-.....-------AN...M........TRSNVDAMRRAVAAATDD..VAPA.TIGLTS..RTTRpLQLLKND...-.Y....NGL....VFSV....NILIR.L.TIISLFLFYFVLIV--wm..........................................
A0A1J4UD57_9ARCH/8-585               ............................................v--NLTKYFMS...LPRAR...VLWLY..LAL.VG.MIFGIAIISIRKgevgfs................savegmATGIFLIT.VP...ALLSA.I.T.F.YI.VR----RE........IVLRRV...IFLSL..VAAAVYGSFYIAGALLERAG.................MPLGNEVVFVG...........................FGLAF.VTWFFI.V.GT.VFGLG-KTAF...........LFSLLQLCYNAAFLLASrqie.............................ieqdwL--LAIL..KMYFASFLFL..V.GLYM.L.......FFLINAPMKRNI.GVKSTDAISMFAAQWLNR..EKDL...EETFE..EM..GEEVETLLGVLCF--.........E..................G.....K.rQ...........KTTFI.VPYVHFGPFGNLGGSEFP.KILAQR.IGKQeg......................geVF.VFHGTCTHDFNPVAGTEAEKIM....QAYEFER.KKMK......FSPAKG..AIL......EGKSG..D..S....GALCLLVND.CAFASFTRAPKTTEDVNFAIGRSLMNVAGRY..-AKTAIVVDEHNSETGDIAS.....VEPG....SPIAFEMEDALLDALS--..KKADM........KKMRLGIGRKNP......VG..---E.PA.IGGNGIKVALFD..VG.-.......................KLFAYVVIDSNGVTP.EFR...SELIETVQK.wGRGkg..................qkiGCEVFTTDTHEINNVQG.....VLNPIGKRG...-........GAKTADAVLECLLSAYAN..LEEV.KAGSAL..GRMK.IEVFGSR...Q.S....IEM....VATI....SSVVA.I.ARIAAPTILIGTVV--ai..........................................
A7I4Q8_METB6/9-574                   .............................................LEALSKYIVT...TPSWA...KSTAL..ILL.LC.GCVEIMAMLGSHhsl.....................thpsLFPVFAYL.LP...ALAAL.A.L.T.PA.LAGLFGGK........LTYGWS...GLTAA..IGLVISLFVSLSPVLFF---.................TSSFPVFFAAS...........................LAFVF.AFRMLL.L.AA.VVDFHLRRVV...........VPALIHSGIAVIGAAPF......................................LGLPFVQ..LSVLLHISFA..A.GVLV.F.......IIVVERPMKANF.RVGPLELANAFLAHLSEG..SHKL...DEFFR..SI..GESVVVPQVSLALQR.........E..................G.....K..E...........EILVT.VPNVHPGPLGEIGGSNLP.KILHGI.LGSG..........................SM.VFHGAASHDFNPVDEEEVKKLG....AEVLATL.PRTC......TNNGCT..VPV......RHRFG..S..V....DVLVQAFGD.TVIAAATRSPEVTEDLEFAVGFAIIKSGEKY..-FHNVGFIDAHNCMDALSDG.....VYPG....TELAMEYMNAAETAFAAA..SREPQ........AAFSAGYAARTF......P-..FTRQ.DG.FGDLGVQVLVIE..TR.G.......................RSTAYVLVDGNNMQT.GGR...DEIRKRLHS.lVD-.......................ECEVMTTDTHVVNTVS-.....GRNQVGLKV...P........VDSFYPVIEEAVRAARDD..VAPA.RSAGVT..HYCHgIVVFGSQ...R.I....SQL....ASTV....NGMMG.F.LLPIAIIVILGAFLT-t...........................................
Q97W82_SULSO/9-526                   ............................................t-RKYYGYLKT...LPSIK..iFATTF..SVE.SL.LI----------............................LLRSFQLT.FD...YLFSF.V.L.Y.SI.LLIIIFKN........-KIKIA...LFMMN..LTAIPYLLLSLLPITPF---.................-----------...........................YAFGF.FMPLMA.Y.IL.LGSYKEIPSI...........VLSGITSYVPIIFYFKY......................................-----SI..IFLLYILIIG..L.IFHF.Y.......IYTVNRKGVKIL.GLKSTQVAVPFITAITEK.nKVPL...ENFLN..LI..SVKTTLNVFMYKL--.........-..................-.....-..D...........DFLFM.IPQIHFGVFDNVGSSRFV.YDIEKA.LRNN.........................iVT.VFHGPGSHELDLPSSAEVNKVI....EAISKST.IERN......DWNKAT.fYGI......SIERR..S.tF....DITSLEFDK.FRVSFMERPEFGIDDLPSSLWKYMLSS----..---NNYLIDCHNSFLEREYD.....----....SHEINSLKDFIADQR---..GIKST........RRLMVGYSEGKL......GK..--AC.DG.LCDNRIRVFTFD..DG.V.......................KRVSIVYIYANNSTK.ELN...YAISNAVRQ.iVD-.......................KVILVTPDDHSCTGVS-.....----LGITY...Spa....tfCEDLVNIASELIKRSTEN..MKEInRVEYKV..VKIKgVKILGK-...I.I....SIM....LKAL....EDVGN.Y.TSKTFWIPLITPYVL-l...........................................
Q9HJC7_THEAC/10-567                  ..........................................idd---LSTFVRKs.iSPK--...-YFIA..PLI.AI.GLIDYYFIRDI-............................TTTLLIVP.GT...FLISI.L.L.D.LF.FTKISKIV........FPVKRN...VYLNF..VSLVIWNVFFWILILTHAFR.................--SYDSSLLLA...........................ISSTT.LFRFLI.F.YV.FYPADGIKDL...........IPSMNYVYSMLIIFILIf....................................rSQYLLIV..PFIISSLVYA..L.AAYF.L.......IRRATAKFVKKY.KSSPSKILEFFLNSGKRL..ESNIs.vKHFFD..RI.ySHERKIPVKLVEVRR.........M..................D.....G.sI...........KVSMI.FPYIHPGPFGVLGSSNLP.ERLSTR.LPELg........................dLM.VFHTTTSNDNNCRGDQDIDNIA....EAIRSAH.QKLV......FTERMA..RPR......KVAAG..K..F....VIYVERFGN.FGLGAIVPEKTAFDDVALEEGLKIIAHMKKI..GADDFAVIDAQNNFRKKAPE.....----....LKNASPTIKAFEREFL--..RDEPK........YETRIGYARVYE......DV..----.PG.LASMGIQAAVLQ..TG.D.......................RYDAVVLTDSNNITT.DLI...ERVRSRLSD.tVS-.......................SVEIYTTDNHYVNASVL.....DVFPLGSRG...D........ADRIADLIALAVKRAKAD..VEPV.KVGMAT..DYAT.VKMGEKN...N.F....QTL....ISTV....FSAVR.T.AKFTAIYTIPTTIAT-t...........................................
A0A0F8BGK5_9EURY/6-549               .........................................vdvf----QRLVFS...VPPLS...RQLPA..MAV.LA.VVYSVVTFVALSaftpfs...............pepsmfvPLGVLLFL.LP...FLFAG.E.L.F.HR.VLPG----........YPRTWS...FFLAL..TNQFVTFVYALVLSGAN--D................vGNAWSIVWLLF...........................ITVYL.INILAL.V.VS.TGIDRYKRIL...........LVALAEPAALIAAFYAFagg................................dlgFSTYRHV..FAFASLLIAA..A.FLVL.V.......LAIVDYLIRSNT.DVSAFELTSGIL----QN.dRASL...-----..DL..GVEAEPAVETLAIDN.........G..................-.....-..D...........RLTLA.APWVHPGPLGGFGGGQLSgNVIDAL.NDGDer......................esGF.FLHVPCTHKEDLSNPEDAANIL....DAVADPE.----......RGARAS..RLV......HRDYG..E..I....EFYGRRIGD.--KQVIFLHGEGIDDYDTGVFMGDVDE----..--SEVLLVDLHKHDLQNGPAk...eVLYG....SAEADRLKRHFDDFRDQL..ADAPL........RDYAAGFA----......--..----.VR.RADQDVAALVES..VD.G.......................QETLLMGIDTNGVTP.DVRalaADYREEFD-..---.......................EVLIFSTDTHASIH-E-.....------LAN...T........TRSDIDALREAVERADDD..VAPA.TIGLAS..RRTRpLKLLKND...-.Y....NGL....VFSV....NILIR.L.TIIALAMLYALLII--wl..........................................
A0A1D2X1U5_9EURY/7-597               ...........................................im--NTSKYLIK...LPETK...SSLLL..III.VS.FITGGISSCLEPglslnsl.............ayyflsggATTFFLLG.TT...AIASG.G.L.V.YT.LVNKLNKR.......hIKQKQA...MFLSF..IGMLIVCILYIIGYIISVVT.................NITLLNFLVLG...........................ILFTF.AIESMI.L.WA.TSNIRYYQGI...........LIGAIQPILILSMLVLInyitf...........................atisinAVLSLYL..KAILGAIVLA..I.AVYA.F.......VEIIQSPIKNNL.GVGGLELLSLFVAQISDG..SQGM...EQIFN..EI..GEEIDTSVSLISFKT.........E..................K.....G..I...........KANYI.SPGVHPGPVGSIGGSNLP.TIVANQ.LENF..........................SI.IAHGAATHDFNPVTEKEVDKIT....EAINSIL.PNLK......YSDKAS..KFQ......RIKSQ..D..A....KLGVQQFND.GLVLLTTFAPNPGDDIDYGIGLALSYQAKAQ.tGVKDIVFVDCHNCLEGNYDR.....LLAG....QNRVTQLENAIEQI-N--..PNQEL........YPIKMGYAYNPL......DE..IPVK.DG.IGESGVKLMLTE..VD.T.......................QKMLYVVFDGNNMQK.GFR...EQIITTIKE.kYPEi.....................dMIEVMTTDTHLVNTISG.....GGLTVGSKH...-........QEILLKEILKLIPKAIND..LEYV.QVASGT..AKIQ.LKAFGPN...N.S....TQL....VTTL....SSILS.V.AKLLAPLVFLVAALI-t...........................................
U1PAB2_9EURY/8-628                   .............................................LADLSRFIFR...APRWY...VSLTF..AIV.IA.ATVGVAAFDSGAyattwrg.............lfifgrdaWEGVFFIG.IP...TVVAA.F.A.T.TG.VDRFVGGK........LTANRS...SLLAL..VSELIVVTIVVTAAVISVVTg..............lgQRFIFDALVVA...........................LASVF.AFRLLI.V.MA.VSRSSLLVAA...........LPASIQTLVAAVLLFVYsgtlryisfggpllday....mmpylarperapaelsaISMEHFA..LLGITSALYA..L.AVYG.F.......IIVVDRPWRRSL.NVSMLDFLRGFIGHIAEG..SREL...EEFFQ..QL..GEEALIPVSVLSFKT.........V..................D.....D.vE...........KARFV.LPMIHPGPMGEIGGGNLP.ERVATA.ADGL..........................AF.PPHATAGHDFNLVTEREVDTII....DAVETAA.SRIE......YTAEAT..QSV......RTHAG..E..A....SMLGQCIGN.NGLLISTYAPGFADDIAYGVGLSASAEARTT..GLDNVLLVDAHNSNNGLSGPtl.ghVTPG....SARAFDMMSAARQCGDRL..TTAEQ........YPMELGTAWTET......P-..WDPT.DG.IGPLGVRVAVLN..VA.G.......................NETAYVLVDGNNMEP.GLR...GQIIETIVD.eGPV......................dAAEIMTTDTHIVNTIE-.....ADNQVGSAI...D........NEMFIDTLSDLIVEARRD..YETV.TGGMAV..ERVS.VTVFGND...R.T....ETL....ASHA....NAVVS.I.GGAFAVTVALAAIAVS............................................
E4NSM2_HALBP/8-629                   .............................................LAGLSRFIFR...APSWY...TSLTF..AIL.IA.AMAGVGAFDSGEsmqtwrg.............lffigkdaWEGIFFIG.VP...TVVAA.V.G.T.SG.VDRYVGGT........LTPNRS...SLLAL..VCEIIIVTIVTIAATISVFTg..............lgQRFVFDALVVA...........................LASVF.AFRLLV.V.MA.VSRSSLLVAA...........IPASLQTLAAAVLLFIYsgtltflsdggpilnay....lrpylvradrapaelsaISPDHFA..LLGVTCVIYA..L.GVYA.F.......IVVVDRPWRRSL.GVSVLDFIRGFIGHLAEG..SREL...EEFFE..QL..GEEAIVPVTVLSFRS.........S..................A.....G..E...........KARFI.LPMIHPGPMGEIGGGNFP.ERVASR.SDGL..........................AF.PPHATAGHDFNLVTEREVDTIL....EAADAAH.EQIE......YGSEAT..QSI......QVQSG..E..A....KMLGQGFGD.DAVLVSTYAPNFADDVEYAVGLSAATEARTA..GIENVLLVDAHNSNNGLDGPdl.ghITPG....SKRSFDMITAAGLGGEAL..TSASR........GDLSMGVAWDET......E-..WVPR.EG.IGPLGIRVAVTE..VA.G.......................QTTAYVLIDGNNMEP.GLR...DDIVSDLTG..GENpl...................adVAEAMTTDTHIVNTVE-.....ADNQVGAAI...D........QGEIRELIVELTREALSD..VEPV.EAGMAV..ERAE.VTVFGND...R.T....ETL....ASHA....NAVVA.M.GGAFAVSVTLAAMAVS............................................
A0A1Y3A5Q4_9EURY/6-576               ..........................................vda---FQRLVFS...VPRLR...VQAAA..LVL.LS.GVYGVATVAAITvftpfa...............ldpsrivPVAVLIFL.VP...FVVAA.E.L.F.PR.VLDG----........YPRSWS...YFLAV..TSQFVLFVYALVLSGADNVG.................-NAWSIIWLSF...........................ITLYL.LNILVL.V.VS.TGIDRSDRIL...........LTSLAEPALLIAAFYALggs................................elgFSTYRHV..FAFASLLIAA..G.FLVL.V.......LLVVDYLIRSNT.DVSAFALTSGLL----RN.dRESL...-----..DL..GVEARPAVETFAVDN.........G..................-.....-..D...........RLTVA.APWVHPGPLGGFGGGQLS.GNLIDA.LNGAregedgatdraa.vaadggaaadgdaGF.FFHVPCTHKEDLSDPADAERIL....DAVADPD.RTER......VSRLVT..ESY......GEREGyaD..V....RFHGRRIGD.--RQVIVLHGEGIDDYDTGVFMRDVDH----..--DEVLLIDQHRHDIQNGPEv...eIQYG....SAEADRLKRAFDDFRDRL.aTADLA........DGYAAGFAVTRT......A-..----.--.---QNALAMVES..VD.G.......................QEVLWIGVDTNGLTP.DVRataDAYRDEFD-..---.......................AVIPFSTDTHASIH-E-.....------LAN...M........RESDLDAIERAVDRAVDD..VAPA.TVGFAS..RRTEpVKLLKND...-.Y....NGL....VFSV....NILIR.L.TIIALVTLYVLLVL--wl..........................................
U6EAY7_9EURY/7-595                   ............................................i-TNLSKYLVT...LPPSR...ISILC..MTF.LS.FLVGIIAAFMEPsssifd................siiyggLAGFLIFG.LT...SIIDG.A.I.T.QP.VINSFKGR.......hMKLKQA...MFVSL..LNMVLVALVYILGSLFSIFT................vYNYVIDALILG...........................CVLSF.GMRIFI.I.WS.TSNIGALRSI...........LVSAIQPILILIMVVAIvsltsi.........................ttnigsfSILAVAM..KGIIAGLILM..I.AIYF.F.......MLVIEAPIKRNL.GVGGLELLSLFIAQYSEG..SQAM...ETLFE..EM..GEPIDTLVGVVSFKG.........K..................N.....G..V...........KGLFL.SPCVHPGPVGNIGGGNMP.TVLAKS.LEPF..........................TM.VSHGPSTHDFNPVSSQEICKIK....EVVLEAL.EDME......YSSTAS..QFM......RVEHG..D..A....KLGVQYFGN.NLLLLATFAPLGFDDIDFGVGLALTKAAQAH.tQAENVILVDCHNSFEGEKGR.....VLPG....NPEVFQLMDAVGKI----..ENPGE........SEIKMGCAYDDI......PE..LSKK.SG.VGQSGVKVMVLE..VE.Q.......................QKTAYILIDGNNMII.GFR...QELLEAVEK.lGVD.......................HAEVMTTDTHFVNTLSG.....GHNPLGTKD...-........RDILIEKVVECTKKALED..VETV.EVGAKT..MKLSnINTLGPN...H.A....TEL....VTTI....SSVVA.V.SRVVAPLVFLLALIF-v...........................................
A0A0M0BUM7_9ARCH/5-589               ............................................l--KHYSSMFF...LPTFK..kAVTIV..AVL.CI.GGVGLSTFALFFsv........................ygLGSSLVLG.VS..vFSVVL.F.A.D.YV.ISKLLLERd.....piYILRRT...VALSL..FCWVLWMFFIVLGVAFGVFF................gLLWWVKLCLLG...........................FAAVT.TFRAVV.F.IA.TSSARFLRRL...........LASLLSPLLCIAPFMVFway...............................idsaIPLQFLS..FLVISTIAGC..S.SAFL.F.......VFLVDQLGRRTY.GVPSMPLFRAFMLNWVAA.lNAPF...EEFLE..KL..GRNENIQVTLLKFDS.........Y..................-.....K..P...........KAAII.VPLVHPGPFKNIGSSLLP.FLLKRD.FEKEfg......................cdTC.VPLGILGHELDLASQEQNQKII....KHVIEAA.KFPS......SVEKAT..PFV......RVTEG..F..A....TVSCQVFGK.TAFLSFTLAPKTTEDMPQELGRIVNEEANHL..GLECNIVVNAHNSINETVDV.....----....EASLDTLREVASKCLKKA..VSLPS........YAFEVGASTVFP......KE..FSLE.DG.MGSGGITAIVVN..VA.E.......................QKTAYVVIDGNNMVS.GLR...EEILAALKS.aGFH.......................ECEVFTTDTHSVSAVVLg..rrGYHPVGEAM...D........HSTLIRHITEVAEVAASN..LECC.KAGCMS..LVVPkVRVIGEA...R.L....ASL....SLLV....DKALR.R.AKQIVAPIFV------seglll......................................
I0A137_FERFK/148-528                 ...........................................sk----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.--------........------...-----..--------------------.................-----------...........................-----.------.-.--.----------...........-----------------......................................-------..----------..-.----.-.......---------ISY.GIDPFNLFSAFLFSVFGE..GEQF...EEELK..KI..GEEKEVDIHLFKLHG.........E..................-.....K..S...........RAVAV.VSNVHPGPFKGVSGAKLI.DFINSE.VGKKg.......................ykLL.FMHGVGSHENDPASSEDVKKIA....EIIGSKL.EDGGsl..wrSANPCI..-PG......QGIKK..D..V....MVTSLPLDPgPNIHIVSKVKSSMDDIPSSFARMIK------..--ENDILVDAQNRFDGDVQW.....S---....EEDLKDLISLIDNI----..KKEKC........EDYYIGIGNVSM......GD..ADKTrSE.FGQLGISSLVIS..CS.N.......................KKTALLIFDSNNIKV.GIR...ERLVEKLKE.kGYD.......................TVEIISTDNHRETGVGRg...fGYRVAGERV...P........FEVIEKKALQAISMAESD..MEKK.RVEYLK..LRVK.AKFLGEK...G.F....KLL....TSIA....MKRSY.F.ASAIFAYIIIAMFLT-t...........................................
A0A0F8VEA1_9ARCH/16-618              ........................................symel--------FQ...SKKLS...YSIFFgtPIV.FG.VFSLLLHYYIVNe.........................leFFHFFRFV.VF..fLLVSS.L.G.T.LF.SISLYSKKapi..lraPPNGWV...VQMNT..YFTATIEVTFLFGQIIAILLq...............nVWYHKVFLILG...........................TILSY.ILAFVI.Y.FS.FTTVDFPGYL...........ILSLIQPISAIILYSLYigq...............................fdidFFTRAMI..FFVVCALIFA..I.PYRR.G.......LFHVSNVYREAT.GMKGYPFIRAFVLSMMTD.gNDEL..iESFFE..RV..GIKSPVKIQYLFIRR.........I..................T.....NrvI...........KGLFI.IPNVHFGPFKTCGSSDLP.EHIYKA.FEEIp........................gTT.VYHTTNDHTQNLTTQRFVDVIL....DRIKRDI.NLVKngdeiiWENQIK..GFS......RKISN..T..A....KLLGTEISN.VPIVFITRHPLPSDDIEAEIGDQIRDQAISN..GYKDIIIIDSHNAILGDEIL.....IKKD....SIESQDLINVSNKFTKSNkvRNSPK........VQMLYGVAKGTF......QN..YTEK.DG.IGYGGIVLHLFKnlSN.G.......................QKTALIHFDGNNAYA.DIR...SYILNMLQN.kGIV.......................RGEVTTSDSHTVARQFSg...rGYSPIGDKI...K........IDEILRKLDNMIEIAESN..LEPV.EFYYKS..STEDnVKIWGNP...RyF....YTI....LDTL....KECIK.V.SQRLLTLSLIIPTFF-s...........................................
Q8ZYS0_PYRAE/4-532                   .............................................FERSYSLIFG..rSPR-K...LAFYA..TAF.LI.IL-AALKSLSQP............................-----AAL.LL...YIAYG.G.A.I.LT.ILMLADRA.......vINLRRS...YYIAV..ISTLLVAFFDVIFQKP----.................--VLSFALVGS...........................-----.TASALV.L.QS.LKCKSPV-YI...........LPLVLTALIYYLMGSVS......................................-------..-LLLLSAVYI..A.VLYL.F.......RIVVNKMA---G.GLDAMCMFSSFLYAVFAE..DDVL...EDAFK..EL..GQREKVPIHLFLI--.........-..................-.....G..G...........SHVVL.VSDFHPGPFRHIGGGMLV.DVLHRE.VGKMg.......................yrLT.FLHGVGSHERDPVSRDSVQRIV....ESVKSAL.ASMHn....gALPAGV..RPL......KVEVG..D..V....KLVGLSLGTpPHLAIVSRVRSASDDIPTWV-----SKLVDP..--GEYILVDAQNKFNGAVQW.....R---....DEDVISLSRGLKALH---..EAGAC........RSFKIGVGHAAT......EH..LVPLgYE.IGPAGVSAIVGD..CD.G.......................ARSLLIVFDGNNIDS.ALY...DKLVKAYER.rGYS.......................VVEVVTTDTHRATGVGIg...rGYRIVGERL...S........HGAILEVVEKAVLEAEKN..LAPL.PVAYRR..VEVE.AEVLGEE...G.F....RKI....QKAV....KMYKK.V.GVIVILAVFVLPSLV-i...........................................
A0A2H9HZD0_9ARCH/23-600              ...........................................at--KHYSSLFK...LPSHE...RLLLG..LLV.AS.IIAGFTATRT--............................LIGLTYFP.II...VLLNA.A.L.K.AN.VF---KKEp......lINLKRL...SALSL..FSLAIWTVFAALGAGLQLLLn...............sNSIWIKLLFTA...........................LSAST.AMRFLI.F.YV.LSFKSKPTIL...........SASIAEPLAISLLTLHQktgf.............................nhtasETAYYAT..HAILYLTILL..A.GVAL.Y.......IKLIDSEEIGVK.GFTPIALFKAFLADWMED.lNEPL...EDILE..KI..GKPKTIKVSILRFVS.........K..................G.....K..P...........KALIV.VPRIHPGPFKNVGSSPLP.NLLSEA.LKEKfg......................cvAL.VPHSLSGHDLNLTSRGQTDRLI....EHVLIAS.KPRV......SSNLAS..PPR......KVRMG..D..A....EAHCQIFGK.CAFITLTVSPKTMEDLPPELDDFIDREARKR..GLDCAVVVDAHNSIGKPSD-.....I---....KRYLPELREAALKSMEAA..LKLKK........RKFEVGSSSVYL......EG..IGVE.KG.LGPGGISILVVK..VG.G.......................KKSAYVLIDGNNMVS.GLR...EKILSSLRE.lGVD.......................NGEVMTTDTHTVNGVVLt..erGWYPVGEAI...D........HEELIGCIKGGVEQALSK..LEPA.EVSWGT..YTIPnVKVIGEE...Q.V....NSL....CVGT....DKMVK.R.SKDLALTIFPIL----glmi........................................
M0M1I6_9EURY/8-609                   .............................................LAALSRFVFR...APKWY...ASLGF..ALV.VA.AIAGVAAFDSEFvl.......................edaWQGVFFIG.VP...TIVAA.V.A.T.PP.IDRRLGGQ........LTPNRA...SLLAL..VCEVFLVAVLVVAGAIAVLTp..............lgQQFVFDALTVG...........................LAAVG.AIRLAV.L.LA.VSRKSLVVTA...........IPAGIQTATAAFLVFVYsgtaryvevggplvq........sflsrpsrgpaefgaVKPLDFA..VLALLCAFYA..L.AVVV.F.......VRVIDRPWRRSL.GVSVLDFGRGFIGHIAEG..SNEL...EEFFA..AL..GEEAVVPVSVLSARR.........S..................D.....G.sE...........KARFV.LPMVHPGPMGEIGGGNLP.KRVAKS.ANGL..........................GF.PPHATAGHDFNLVSEREVDTLL....DAVSRAH.DRIE......YSTTGS..PPV......RRRVG..E..A....SVTGQAMGD.GAMVVATYAPGLADDIDYSVGLSAVAEARSH..-GVDAMVVDAHNANDGLTGDdl.ghVVPG....SQRSFDLIEGVGEVSAAL..ANAPQ........GPIELGVAWDET......P-..WTAS.EG.IGPLGIRVAAFT..VE.D.......................ETAVYVLVDGNNMEP.GLR...EAILDHID-..-AG.......................SAEVMTTDTHVVNTVE-.....SANQVGGAI...P........DDELIALIASLVEEALAD..REPV.EAGMAT..ERAR.VTVFGND...R.T....ETL....ASHA....NAMLG.M.GSALAGAFAVAMLAVS............................................
G0EC50_PYRF1/3-507                   .....................................lrgkavql----------...-----...-----..---.--.------------............................--------.--...-----.-.-.-.--.----YNSL........VRSPPR...LLLAP..LVAIHALLVILYPVLIVP--.................EALVIVAYLLGfglcsrhymrraagvllyatpymilyaIVFAL.GLRPLV.S.AI.TAPFALLVSG...........LCGV-KT---AMIYVII......................................ATVVSFP..LGLIESL---..A.AAAS.G.......IIAILVPMV-AL.GLRGIEVARAAILAWADD.nYEPL...ETVIS..--..GEERRVKWHALMFKR.........D..................-.....D..E...........KLVLI.VPGVHYGPFRGAGSSHLP.RMLMKY.SRDK..........................VI.PLHGCGSHELNIVSRKEAEAYA...qRLVKEAL.VATW......HECKPL..TPT......LVNHK..S.gW....NALAIGCVE.-RPTVILWNRSGTEDIPCSTLEHLD------..--DKLMIVDAHNVETESV--.....----....--DTRGLHEVVNSLLSK-..IEECK........GSLRCCWRLVRV......DN.sVVDE.AK.MCDNWILVLKVL..CD.N.......................NGVTMVIFPANNVDP.LAA...RKYTEVLG-..-S-.......................RTVLITIDDHSCAAVIN....eGVAPLK---...W........SEKLAKILQENVKMCVPG..--DC.RISYAS..GFDN.LRVWGEH...T.I....QEI....RHLL....ERGVR.AkALPLVIYVLFLIA---ali.........................................
A0A135VVL6_9ARCH/10-611              ...........................................tv--SLYSRVWR...LPTFQgiiIRITA..TVV.LG.AFFSSVLSFFKDpgsd....................fiwiLGQYLVLTvVP...AFVGT.T.L.L.YA.IVRKKGSP........LDARRT...AGAVQ..FGILFWIVTGALGGLLDYLLv...............iTYYEVRFWILG...........................LGIAY.TAFAFL.V.TG.LSDHHPIRNF...........IAALMIPILWYLEAFALggip.............................esvlvLPPLWLA..FAVVTMLVYS..L.AVHF.I.......FRSVSVPFERDL.GINGPELLRAFGYDYLMS.nSEPI...EKTLT..QV..GEKQDVPVEIVVLKN.........E..................D.....G..L...........VGVGV.IQYVHPGPFRQIGSSSLP.SAIMDH.IRQNhg......................vpAF.VMHGSCTHQQNLTTKEDFPHVM....SEIDRLI.KETE......VHDTAS..GPH......WSDFG..K..F....KVWTLFAGE.DVLAISTSAPEFTDDISLEVGREAANLVRERvpQVKRVAVVDAHNCIDGDAVS.....VMPG....DLEAGEYVGAVSGAVFAT..FDAPR........SPISAGFHQVVL......GS..MSPE.EG.MGPGGVTAMVLV..IG.S.......................REVVMLSVDGNNMEP.GFR...EEAIRILKT.qGFD.......................DVEVLTTDTHVVNAIATs..srGYPPVGQHK...-........PQEILEAIVLSANRAREQ..VSRV.RIGLGF..GEAKdLRTFGER...G.F....DILtqdiAEAA....GIAKR.V.GIRAGVAAFLLAV---fla.........................................
A7I8W3_METB6/9-570                   ............................................l-GQLTKYLFT...APSWP...VSLLI..LVI.LG.LVIDGASARAWVy.........................lpFSGTLAFT.IP...AIAGF.L.L.T.KP.IIEYSGKT........MTWNRS...ALLAL..ACTIFAVIITFASLAGG---.................IKYLPLFYGIS...........................LGFIF.GLRLFV.L.VA.ISDYRLPRMI...........LPAITQSGVGVLAGFFL......................................FSPGWAL..FAIVLHIVFG..L.GFAI.L.......VWLIERPLYRAF.HIRGLAFVNAFIANMTDG..SKSM...ENFFR..EI..GEEIYVPQVCLFFRR.........T..................K.....K..I...........PLLFT.VPNLHPGPMGEIGGGNLP.MVIHDH.MEEE..........................TL.VPHGCASHDFNLVSESEIGKVV....DAIERSK.NDRI......YGQGAT..PSS......RISCG..T..V....QILYQRFGD.SILMVSTRSPQMTEDLDYSIGLAIMAEGHRW..-FPHVAFVDAHNCMTDLSSA.....VLPA....TLTATEYQHGAIQAMQAA..HAAEL........HAFSVGYARERL......P-..YSRE.QG.FGDLGVQVMVVE..TC.G.......................QKTAYVLFDGNNMAS.GVR...DVMLGKILT.lVD-.......................AAEVMTTDSHVVNTLT-.....GKNPVGQEV...P........VDVFLPAVLRTVQAAIDD..LGTA.ECAATT..AQCEhVVVFGSN...R.I....SQL....ASTV....NAMLI.F.VAPLSLAMLLLAFFLS............................................
A0A257ALI8_9ARCH/55-318              ............................................i-EDLYLSIRS...LPRGT...LIVSF..SIL.SS.LVLSLE-FLFLMdcpl...................sldllTYSFVLVL.LS...TLLSA.I.V.V.SL.LARADNRNp......lLNLRRS...LYLSI..YSNAVIFILWAISGNQF--Trs.............lfSISLESAYSFS...........................IASPI.LIRLIV.I.ST.LLSINPLLQF...........IGASINSFTLLILGFSL.....................................lHSESSLL..TGLIISLLLQ..I.FLYIiF.......KSFVSYNIE---.GVENLELMKGFLFEWAEN.vPTYI...EEKLS..QL..SQPEKIEVSYILFQG.........E..................N.....G.kM...........KGGVI.IPSLHPGPFRNVGSS---.------.----..........................--.----------------------....-------.----......------..---......-----..-..-....---------.-------------------------------..--------------------.....----....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------............................................
A0A1U7ETZ4_NATPD/8-607               .............................................LAALSRFVFR...APDWS...ASLFL..TLL.VA.AVAGVAAFDSGFvl.......................ddaYLGMVYVG.VP...TVIAA.F.L.T.PW.VDRPLGGR........LTYNRS...ALLAF..LCELLVVVAIVVAAAAVAVTg..............lgAGAIVGALVVS...........................LASMF.AVRLFV.V.LA.VSRQSLPVAA...........IPASIQPVAAAVLVFLHsdaarhlgfapaad..........ipfvgtfaapvldaVRPVDFA..LLLALCAVYA..V.AVYG.F.......LIAIDRPWRRSL.GVSVLDFVRGFIGHIADG..STEL...ESFFE..EL..GETAVVPVSALVVRQ.........P..................D.....G.tE...........KARFV.APMVHPGPMGDIGGGNLP.ARLDER.ASGL..........................SF.PLHGTAGHDFNLVTERAVEPVV....DAVDDAV.EAAG......EHEAAT..GAR......RTTVG..D..S....TLVGQAVGD.GAFAVITHAPEPADDIAFGVGLAATGELRAA..GFETALVADAHNCNGQVGDGp..gqVTPG....SRRAGDIQSAAGELGAAL..SAADS........GPLSVGVAASET......D-..WKPT.DG.IGPLGVRVAVFD..TD.G.......................DRTAYVLVDGNNMVP.GLR...ERIQDALA-..-AD.......................TVEVATTDTHVVNTVE-.....ATNRVGDAL...D........GDELVALVQSLEADATAD..LEPV.VAGVGS..AEAE.TTVFGTD...R.T....ETL....ASTA....NAMVQ.L.GGVLLLVVVGAVLTV-s...........................................
A0A0N8HZK0_9EURY/8-449               .............................................LAGLSRFIFR...APNWY...TSLAF..ALL.VA.AVAGIGAFDSGEadavfrg.............iffvgqdaWEGIFFIG.IP...TVVAG.F.A.T.PW.VDRYTGGR........LTYNRA...SLLAL..ICEVVIVAVVSVAALLAYLIaw.............ldQTFVFDALVVA...........................LASVF.ALRLLV.V.MA.VSRTSLPVAV...........LPASIQSAVAAALLFVYsgtiryladggsaiqay....ltpflnesaeapgvlstISPQQFG..LLGVLCVIYA..A.AVWV.F.......LVAVDRPWRRSM.GVSMLDFLRGFIGHVAEG..TREL...EDFFE..QL..GEEAIVPVTVLAFRT.........D..................D.....G.aE...........KARFV.LPMIHPGPMGEIGGGNLP.ERVAES.AEGL..........................AF.PPHATAGHDFNLVTKREVERLI....DAADRAH.QRIE......YGDGAT..ESV......RIEAG..D..A....KLLGQAFGG.DGLLVNTFSPEFADDVEYGVGLAARQGARTN..GLDDVLLVDAHNCNNGLDGPdl.ghVTPG....------------------..-----........------------......--..----.--.------------..--.-.......................---------------.---...---------..---.......................-----------------.....---------...-........------------------..----.------..----.-------...-.-....---....----....-----.-.----------------arars.......................................
H2C371_9CREN/7-520                   ............................................t-RSYYSKLIR...LPSTQ...NLVLW..VSG.ES.FLA---------............................ILRSFSDG.LS...YILGF.V.I.Y.AG.LSLLAFR-........KRIRTS...LFLTG..LFGILYLLLSFFPATLP---.................-----------...........................YSFGL.FSPLVA.Y.TL.VIDYGEKAST...........VISVFTGLIPGYTLVGL......................................---SLDI..PLLVFYLLVG..A.FSFV.Y.......FDFINRQGTKIT.GFPSLNIVRPFLKAFSYR.rEDEL...EAFLE..RI..STGFQTSVLSLKL--.........-..................-.....-..G...........EVVLL.VPRIHYGMYGRVGSSGFI.YQLEDL.LKDK..........................IL.VFHGPGSHELDIPSSRESMKVA....QAIASGL.NDGW......TPLKFQ..GLR......IFNES..Q..F....VFTSLIFDK.ISLSFAERPGKGIDDLPGNLWDESLITGN--..-----FIVDCHNESLKEEI-.....---G....HKDEIVLKSFLSKK----..LILDE........KELQVGYGETRI......GA..--NC.EG.VCDNRVKALVIG..DG.A.......................KRILVLYVYANNADE.ETS...RKARELFKD.kFD-.......................RVILVTPDDHSCTASV-.....----WGNLY...Spa....rpCNAMLEAFKEATEMALSN..IKKV.EASYKI..ITIK.TKIIGK-...F.V....SVM....VQGL....EQVGN.T.AMKTFWIPIIFPYFL-l...........................................
M1XTR6_NATM8/8-578                   .............................................LAALSRFVFR...APDWS...TSLFL..TLL.VA.AIVGVAAFDSGFfl.......................ddaYFGMLYVG.VP...TAVAA.F.L.T.AP.VDRLLGGQ........FTYNRS...ALLAF..ICELVVVAVLLVAAATAALAg..............vgQPFVLDALLVA...........................LASIF.ALRLFV.I.VA.VSRRSPAAAA...........VPASIQTVVATGFVAAY......................................DGSTDYV..LLLALCAVYA..A.GVSF.F.......VFAIDRPWRRSL.GVSVLDFVRGFVGHVAEG..SREL...ETFFE..QV..GERAVVPVTVLSIRR.........L..................G.....G.tE...........KARFV.LPMVHPGPIGEIGGGNLP.ERIAAS.ADGL..........................AF.PPHATAGHDFNLVSERGVDTLL....EATSSAA.DRIE......YAREAT..PSR......REAEG..D..S....KFLGQAIGE.DRLLVGTHAPEPADDVAFSVGLSIAAEASAG..--GDVMLVDAHNCNDGFDGAal.ghVTPG....SARSFDMIEAAGRLSERL..GTAKR........GELSVGVACEDT......E-..WGRE.DG.LGPLGLRAAVFE..VR.G.......................HRTAYVVIDGNNMDP.GLR...ERLLGAID-..-AD.......................DAEVMTTDTHVVTTVD-.....ATNQVGAAI...D........HDRLVEAVSRLVEAAAAD..LEPV.EAGMAT..ERAE.VTVFGND...R.T....ESL....AATA....NAMVG.M.GGVLLAAIVGAATAVS............................................
A0A1Q1FHF1_9EURY/8-625               .............................................LAGLSRFIFR...APNWY...SSLTF..ALV.IA.AITGVAVFDGRYvl.......................gdaWEGIFFVG.LP...TVAAS.V.L.T.PY.VDGRLGGQ........LTRNRA...SLLAL..TCELVTITVLMAAGVLVVAShplhgvmpatllteplgQQFVFDALLLA...........................LASIF.AIRLFV.I.VA.VSRHSLPVAA...........IPASIQTVAAAVLLFIYsgtlrflevggpfln........sylsrseaappelnvVGPQDFV..VLAAVCLVYT..G.GVWL.F.......LWAIDSPWRRSL.DVSVLDFIRGFIGHIAEG..TREL...EDFFE..EI..GEEAMVPVTVLVFRT.........E..................D.....G.aE...........KARFV.LPMIHPGPMGEIGGGNLP.ERVAHR.AEGL..........................AF.PPHATAGHDFNLVTEREVDTIL....DAADAAV.GEIE......FTDEAT..VSV......RASKG..D..A....KLVGQAFGD.DALAVATYAPEFADDVEYAVGLSAAAEARSA..GLDDVMLVDAHNSNNGLDGAdl.ghVTPG....SERSFDMITGAGEVGKRL..LDAES........GQPRLGVAWDET......P-..WDPE.DG.IGPLGIRVSVLE..VG.D.......................HRTAYVLIDGNNMEP.GLR...GQLLDAIDG..VD-.......................HAEVMTTDTHIVNTVE-.....ADNQVGAAI...D........DEKLVALVTELVEQATDD..LEPV.EAGMAE..QRAR.VTVFGND...R.T....ETL....ASHA....NAMIS.M.GATLAAAVIVAVLAIS............................................
A0A1N6V0P3_9EURY/8-609               .............................................LASLSRYIFR...APQWY...ASVTF..ALL.IA.ALAGIGAFDSQYil.......................qdaWEGVFFIG.IP...TVVAS.V.L.T.TP.VDRLLGGQ........LTYNRS...SLLAL..TCEVLVVIVMTIAGIFAAFTg..............igQQFVFDVLLVS...........................LAAIF.ALRLFV.V.MA.VSRTSFLVSS...........VSAGIQTGTAALLFFIYsetirvlevggplvq........nvlargshappelgvIAPRDFI..LLALVCGVYA..L.GVYV.F.......LVVIDRPWRRSL.GVSVLDFVRGFIGHIAEG..TREL...EDFFE..KM..GQKAVVPVTVLSFRT.........D..................E.....G..E...........KARFV.LPMIHPGPMGEIGGGNLP.RRVASQ.ADGL..........................AF.PPHATAGHDFNLVTEREVDTIL....KTAETAF.QRIE......YSDTAT..QSV......RAQNG..D..A....KIVGQGFGN.DALLAATYSPEFADDVEYSVGLAAAAEARSN..GLDDVMLVDAHNCNNGLQGEdl.ghVYPG....SERSFQMIQAAKAVSADL..ESAKR........GTPKLGVAWDET......E-..WTPT.EG.IGPLGIRVSVFE..VE.G.......................QRTAYILVDGNNMEP.GLR...DRIVSAVD-..-AD.......................EVEVMTTDTHIVNMVE-.....SSNQVGGAI...D........HDELISLVNRLVEEATAD..LEPV.EGGMAS..EYAE.VTVFGND...R.T....ETL....ASHA....NAVIA.M.GGALAGAVILAVMAIS............................................
L0HI55_METFS/9-574                   .............................................LEALSKYIVT...SPSWV...RSLAL..ILL.LS.GCVEIMSILGNGesf.....................tnpnLFPIAVYL.IP...ALAAL.A.F.T.PG.LARRFGGK........LDYGWS...GLTAA..LGLIISLFVSLSPILLF---.................RFSFPLFFAIS...........................LALVF.AFRMLL.L.AA.VVDFHLRNVV...........VPAFLHSGIAILGAAPF......................................LGLWFVQ..VSILLHISFA..V.GVYV.F.......IIVVERPMKANF.KVGPLELVNAFLLHLSEG..SHKL...DDFFR..SI..GESVVVPQVSLVLQR.........E..................G.....N..E...........EIFVT.IPNVHPGPLGEIGGSNLP.KILHGQ.IGGA..........................AL.VFHGSASHDFNPVDETEVKKVG....AAVLASR.PESC......TSTLCT..KAG......RYRHG..S..V....DVMAQAFGD.TVIAVATRSPLVTEDLDFAMGFSIMKAGEKQ..-FRHVGFIDAHNCMDTLADG.....VYSG....TALGMEYLAAAEDAFSGT..AHQEQ........VPFMAGYAHQTL......P-..WSRT.DG.FGDLGVQVLVIT..AG.G.......................QKTAYVLFDGNNMHT.GAR...DEIRRRLLS.lVD-.......................ECEIMTTDTHVVNTIS-.....GRNQVGLKV...P........VNAFYPHVERAVREAIAD..SAPA.CSAGAT..TWCRdVVVFGSQ...R.I....SQI....ASTV....NAMIG.F.LVPVAIIIVVGAFLT-t...........................................
O27931_METTH/7-596                   ............................................v-TDLSKYIMT...LPETE...ISLLS..MIF.IS.FIVGAIGFLIDLvpgssnl..............hdilyggANGVLVLG.FT...SIMAG.A.I.T.QP.WVNSLGGR.......kMKMKQS...MFLAF..FSMLIFSIIYLGGCLASSIL................kSDLILDSIIIA...........................SAVIF.GFRLLV.I.WG.TSNISFTSST...........LISSVQPLLIVSMNVVVavlslt..........................tnvgyfSVIGFFL..KMLVASVILI..L.AIYS.F.......VMVVESPMRRNL.GVGSLEFLSLFLSHITED..SPEL...ENIFS..EI..GEPVDTLAGVVAFRR.........G..................S.....D..V...........KAILI.SPSVHPGPIGTIGGANMP.TILSGR.FSEF..........................TM.VAHGPSTHDFNPVSIKELEKVE....AAVREAL.DDME......YHETAS..EFR......RYTRN..S..A....SIGVQFFGE.GMLMLATLAPEGFDDIEFGVGLSMMNLARSK.cGSENVVVVDCHNSSQGETGR.....ILAG....NPEMFDLLDAVELV-E--..CPSDY........HSLRVGCARRTG......K-..FSKE.DG.VGESGIMAMVVE..AG.D.......................QRTAYILLDSNNMVM.GFR...DEIREEIMK..LDV......................hEAEVMTTDTHFVNTLSG.....GHNPVGKQK...-........RDEIKNEIVMTVSDALDD..LEEV.SAGCRV..VRIKgLHTLGPT...N.S....TEL....VSTI....SSIVA.V.SRLIAPLIFVLAIIF-v...........................................
D2RDY8_ARCPA/6-495                   .............................................LERLHRIAFS...TPSL-...LTIAI..ILI.FS.FLIIY-K-----............................FNLGVLNF.LT...FSIAL.A.L.F.AP.ILDIK---........FNFRRY...SFFIA..FISISTILINALSKYINT--.................-N------PVG...........................-IFVA.FVTTTV.L.YF.ISEAETLKVS...........IASLVESLLLYPNAAT-......................................-------..------VLGV..V.LGII.F.......IKFMDKEIN---.GYNVRLYFKRFLLSWLTG.dPSYF...EEVLK..RK..ATSFRGWIKCLRI--.........-..................-.....-..G...........KAKLV.TTSFHPGPVRNIGGARLV.ERINSM.--EN..........................AV.YLHSPTDHSLNPVSANDVERLI....ASIECDD.VKLK......----PM..KPF......DLESD..N..Y....ILRVFPFDK.TRLMFIIG-KKCIDDLPYDL-----------..NVDNAMVVDAHNAHCEVF--.....----....KPNIEELKELVNRGLE--..FESEP........CEMKYVFKKFRV......ET..----.NS.IC-GSVAVLLLD..YG.S.......................EKHAIVIVDGNNVKL.EFR...KEIEDFCAK.rGF-.......................KAIVASTDNHSKTGISTk...fTYLPVGSDE...R........DRIIFKILEESFKLN---..FEDC.DVFFSK..RDVV.IDVVGKD...-.F....CRF....IDEV....GRFGL.S.VTKLYFALLTVSFALS............................................
C7NVR6_HALMD/8-610                   .............................................LAGLSRFIFR...APRWY...TSVTF..ALV.LA.AVTGIAAFDSRFvl.......................ddaWQGVFFVG.IP...TVLAS.V.G.T.AY.VDNALGGQ........LTPNRA...SLLAL..FCELIVIAFVVGAGVVSVLTa..............fdQEFVLDSLLVS...........................LAAIF.AFRLLV.V.IA.VSRSSLPVAA...........IAASIQPAAAAALLAVYtgttsallddptlr.........rflsrpdqappelqfLQPVDFG..VLALMCVLYA..G.AVWL.F.......LVLLDRPWRSSL.GVSVLDFIQGFIGHIAEG..SREL...EDFFE..EL..GEEALVPVTVLSVRR.........P..................D.....G.eE...........KARFV.LPMIHPGPMGEIGGGNLP.KRVATE.ADGL..........................AF.PPHATAGHDFNLVTEREVDSIL....SAARSAY.RELE......FTDRAT..ASR......RVEEG..D..A....SLLGQAIGD.DAVIVSTFAPGFADDVEYAVGLSAAAEARAG..SLDEILLVDAHNSNDGLEGEdl.ghVVPG....SERSFDMIDGAGKLGAEL..AAADR........GQLRCGVAWDET......P-..WEPQ.EG.IGPLGIRVAVFE..VE.G.......................TRTAYVLIDGNNMEP.GLR...GDILAALDG..ID-.......................DAEVMTTDTHIVNTVE-.....AENQVGSSI...P........DDELIALIAELTEQAIDD..IEPV.EAGMAS..EKAT.VTVFGND...R.T....ETL....ASTA....NAVVS.L.GGALAVTFILTVLTVS............................................
A0A2A2FH61_9EURY/6-549               .........................................vdvf----QRLVFS...VPPLS...RQLPA..MAV.LS.VVYSVVAFAAFSaftpfs...............pepstllPVAVLLFL.LP...FLFAG.E.L.F.HR.VL------........PEYPRSw.sFFLAA..TNQFVTFVYALVLSGANDV-.................GSAWSIVWLLF...........................ITVYL.INILAL.V.VS.TGIDRYKRIL...........LVALAEPAALIAAFYAFagg................................dlgFSTYRHV..FAFASLLIAA..A.FLVL.V.......LAIVDYLIRSNT.DVSAFELTSGIL----QN.dRASL...-----..DL..GIEAEPAVETLAIDN.........G..................-.....-..D...........RLTLV.APWVHPGPLGGFGGGQLSgNVIDAL.NDGDeg......................esGF.FLHVPCTHKEDLSNPDDAAKIL....DAVADPN.----......RVDRAS..RLV......SHDYG..E..I....QFHGRQIGD.--KQVIFLHGEGIDDYDTGVFMGDVDE----..--SEVLLVDLHKHDLQNGPEk...eVLYG....SAEADRLKRHFDDFRDRL..ADAPL........RDYAAGFA----......--..----.VR.RADQDVAAVVEA..VD.G.......................QEVLWMGIDTNGVTP.DVR...ELAADYRGE..FD-.......................EVLIFSTDTHASIH-E-.....------LAN...T........TRSDTDALREAVERAAAE..VAPA.TIGLTS..RRTRpLKLLKND...-.Y....NGL....VFSV....NILIR.L.TIIALVILYGLLVV--wl..........................................
A0A2A2HFR4_9EURY/7-596               ...........................................vv--SLSKYMVT...LPKTK...ISVFI..III.LS.FLTGAIADCIIPgiplnei.............vylfiaggAGGFFLFG.LP...TIISG.T.I.I.HS.SVNSLKKR.......hMKLKQA...MFLAL..VGMFFVCLIYIIGVIISIFI.................PIQIDSVLLLA...........................TLFIF.AIEALI.L.WS.TSNIKYYQGV...........LIAVIQPLLILSMNVLVnyfev............................atsgsMVLALYT..KAIVGAILLA..I.AIYA.F.......IAIIQSPIKNNL.GVGGLELLSLFIAQVSEG..SNAL...ETVFD..EM..GEEITTSVGIISFKT.........M..................D.....G.nI...........KANYI.SPCIHPGPVGSIGGGNLP.TIIANK.LDDF..........................TI.VAHGAATHDFNPVAQKELDKIV....EKIDEAL.PNMQ......YKDSAS..KFQ......RVEYE..D..A....KIGVQFFND.GCLELTTFAPNPGDDIDYGVGLSLMYETKAL.tGVRDVIFVDCHNCLNGNWER.....LLAG....HKRVYELEQAVAKI----..QKPSM........HPIRVGCSYDPI......DE..IAVR.DG.IGESGLKVMITE..VD.N.......................QLMLYLVYDGNNMKQ.HFR...EELMDEIHE.kYPQi.....................dMMEVMTTDTHLVNTISG.....GGVTVGTRS...-........SDILIDKTLHLIGEALDD..LSDV.FVATDT..VHVN.LKTFGPN...H.T....TEL....VTTI....ASVVS.V.SKLLAPVIFITAIIL-v...........................................
F8DDM0_HALXS/6-546                   ..........................................vdi---FKHIVFR...LPSLP...VQIAA..MVG.LS.PIYATLTYVALNefapve...............lqpwvvpVGAFVIFL.AP...FLVAA.E.L.F.YH.AL------........PDYPRHw.sYFLAL..TTQLFLFIYALILSGADTGL.................-NAWRIVWLAL...........................ITVSL.ANVMVL.T.VS.VGPERLRRIV...........PLSLVQPLLLIGTFQFFigr................................nvgVSEASLL..VNFGVLLVVV..A.VLVG.F.......LKLFDYLIGSNA.DVSAFALTSGLL----KG.eRSAL...-----..DL..GYPARPDVQTLTVDN.........G..................-.....-..R...........ELTLA.APWIHPGPLGGFGGGELSsEVIDEL.NDAG.........................tGF.FLHVPCTHKEDLADPADVTKVV....DAIGNPE.----......TVSAAS..RLH......AAEYD..D..L....EFYGRTIDG.--KKIVFFEAEGIDDYHPGVFMRDVSK----..--DDVLLVDMHNHHIHAELDr...eIQYG....TEEADRLKRCFDDFLEQL..EGAET........FPYSAGFA----......--..----.VD.CGDHPLMALVEE..VG.G.......................QRTLVFGVDTNGITD.DLR...AQ-RERFKG.eFD-.......................EVILFSTDTHASVHDL-.....-------AN...M........DDFDIETVTNTVRRAADR..ISDA.RIGLTN..DRTDrLRLLKLD...-.Y....SGL....VFSV....NILIR.L.VIISLAAFYVFLVL--wv..........................................
W0JWF4_9EURY/6-546                   ..........................................vdi---FKHIVFS...LPPLW...VQVTA..MVL.LS.PVYAALAYLSFNafapva...............lrpeiipLVALAIFF.VP...AFVAA.E.L.F.YH.AL------........PDYPRHw.sYFLAL..TNQLFVFVYALILSGAD--N................gGNAWRIIWLAL...........................ITVSL.TNVLVL.T.IS.VGYERLKRIL...........PVSIVQPVLLIATFQIFvgr................................slgIADSVIF..VHFAVLLVVI..A.FLVL.V.......LKVFDYLIGSNA.NVSAFELTSGLL----KG.eRSAL...-----..DL..GYPARPDVQTLVVDN.........G..................-.....-..R...........PLTLA.APWVHPGPLGGFGGGELS.KQVISS.LNETg........................tGF.FLHVPCTHKEDLADPDDADKIL....EAVGDPD.----......TESQAS..KLY......TAEYD..D..L....RFYGRTIDG.--TKIVFFEAEGIDDYHPGIFMGDVSK----..--DDVLLVDMHNHHIHAELDr...eIQYG....TEEAARLKRSFDDFLERL..EGVET........FEYNAGFD-V--......--..----.-D.CDGNSIMALVEE..VD.S.......................QRTLIFGADTNGVTD.DLRalrDRLEDEFD-..---.......................EVVLFSTDTHASVY-E-.....------LAN...M........DDIESGAMESIIQNAAAN..VSSA.SLGVTN..NRAEsVRLLKLD...-.Y....SGL....IFSV....NIIIR.L.VLISLATFYLLLIFM-v...........................................
A0A165ZH79_9EURY/7-609               .............................................VAGLSKYLKT...LPNTK...ISTFS..MIF.IS.FIAGTIVFLIDPtskisfl..............ekiiyggTFGFGLLG.IS...SIMSG.A.I.V.QQ.WVSSMKGI.......nLKNKHS...MFLSL..LSMIILAIIMIIGAIISAIF................kIDLIINSIIFG...........................SVLIY.AFIILV.L.WS.TSSIGFFKSG...........IVACFQPILTICMLIVItvlgya..........................gkipqfGIISLLL..KVIIANIIFG..L.AIFS.F.......IKVIESPLKKNL.GIGLLELLSLFIAHINDG..SNSV...EKLFE..EI..GEPIDTLVGIISFKV.........K..................D.....K.eKntntknnadeiKTLFI.SPCVHPGPLGVIGGANMP.SILPER.FNNF..........................TM.VAHGPSTHDFNPVSSKEIDKIE....STVKEGI.EEIE......YSENAS..KFI......RYSEK..K..A....KIGVQFFND.SMILLSTFAPHGSDDIEFGIGLSMMLESKAK.yNVKNSIIVDCHNSFDEESGR.....VLPG....NPEVFQMLDAINKI-K--..KEEQN........SGIKVGCHSNLM......KT..LNKH.NG.VGDTGVKVMVIE..VQ.N.......................QRTGYILFDSNNMKR.GFR...EKIIKEIED..LDL......................nEVEVMTTDTHSVNTLSN.....GYNPIGLSE...-........QDKIIEYTKDTVKKAIDD..LEPV.EAGAIV..KRIRnINTFGPN...N.S....IEL....VSTI....SSIVA.V.SKITAPLIFILAIIL-v...........................................
J3JH89_9EURY/8-655                   .............................................LAGLSRFIFR...APRWY...SSLAF..ALL.IA.AMAGVAAFETGLpertwsg.............lfllgrdaWEGIFFIG.IP...TIIAA.F.G.T.TG.VDRFVGGR........LTPNRS...SLLAL..ACEVIIVAVVTVAAIASVFLp..............ldQGFVFNALVVA...........................LASVF.ALRLLV.I.MA.VSRSSMLVAS...........VPASIQTVASAVLLFIYsgtlrflefggpildaylipyvgqylarsdqgpaalsaIQPSHFG..LLGVMCLIYA..T.AVYV.F.......LYVVDRPWRNSL.GVSVLDFIRGFIGHIAEG..SREL...EDFFE..QL..GQDAIVPVTVLSFRRst....egdG..................D.....G.eE...........KARFV.LPMIHPGPMGEIGGGNFP.ERAARR.SEGM..........................AF.PPHATAGHDFNLVTEREVDTIL....DAVDDAT.ERIE......YANEAT..TSI......RTESG..E..A....NMLGQGFGD.DAMLVSSYAPAFADDVEYAVGLAAATEARTH..GLDDVLLVDAHNSNNGLDGPdl.ghITPG....SQRSFDMIRAAGLAGETL..VDAER........GPLSLGTAWDRT......D-..WTPR.EG.IGPLGIRVAVTE..VA.E.......................QTTAYVLVDGNNMEP.GLR...DRIVTALTD.eTVTrpaeaqpva....adgarrqtvdVVEVMTTDTHIVNTVE-.....ADNQVGAAL...D........QDELLDRISALVAEARAD..CEPV.SAGMAV..EEVT.VTVFGND...R.T....ETL....ASHA....NVAVS.M.GGAFAAAIILSAMVVS............................................
A0A1H3CXE5_9EURY/8-627               .............................................LAGLSRFIFR...APRWY...TSLAF..ALL.IA.AVAGVAAFDSGVyarswrg.............lfffgrdaWEGIFFIG.IP...TVVAA.F.G.T.TG.LDRLVGGK........LTHNRS...SLLAL..ISEVIVVAIVTGAAIVSVFTg..............lgQRFVFDALVIA...........................LASVF.AFRLLV.V.MA.VSRSSLLIAS...........IPASLQTAAAAALLFIYsgtlrllevggslldvy....lmpylarsadapaelsaISAQHFV..LLGVTCGLYA..L.AVYA.F.......IVAVDRPWRRSL.GVSMLDFLRGFVGHVAEG..SREL...EEFFQ..QL..GEEALVPVSVLSFRT.........P..................E.....G..E...........KARFV.LPMIHPGPMGEIGGGNFP.ERVARD.CSAL..........................VF.PPHATAGHDFNLVTEREVDTIL....DAARTAA.DRIS......YDTAAT..QSV......RVQSG..E..N....SMLGQAFGD.DALLVSTYAPGFADDVEYGVGLSAAAEARTS..GLDNVVLVDAHNSNDGLNGPdl.ghVTPG....SQRAFDMIGAAGITGQRL..STADR........SDIELGVAWDET......P-..WEPA.DG.IGPLGIRVAVTV..VD.G.......................QETAYVLIDGNNMEP.GLR...GELHDAVVA.eGPL......................dEAEVMTTDTHIVNSVE-.....ADNQVGAAL...D........SAELERLVSDLVAEARAD..CEPV.EAGVAV..ERAA.VTVFGND...R.T....ETL....ASHA....NAVVA.L.GGAFAVSVILAAVAVS............................................
W0K0P5_9EURY/8-614                   .............................................LASLSKYIFR...APRWY...TSVAL..SLV.IA.ALAGIAAFDSQYvl.......................edaWQGVFFIA.VP...TIVAS.L.A.T.TP.VDRFFGGQ........LTYNRS...SLLAV..ACEVLVVIVLVTAGVIAVLVpr.............fgQNFVFDSLIAA...........................LALVF.AVRFLV.V.LA.VSRNSPIVAA...........IPASIQTATGGVLLFVYsgtmnfltgggplvg.......aylsrpsrappeiqyaFAPQDFL..LLVLMTTLYG..L.TAYA.F.......VVIVDRPWKRSL.GVSVLDFIRGFIGHIAEG..TREL...EDFFE..QI..GEEAVVPVTVLSFRR.........T..................S.....DetE...........KARFV.LPMIHPGPMGEIGGGNLP.QRVAET.STGL..........................AF.PPHATAGHDFNLVTEREVDTLI....ETAERAF.EKIE......YTEQAT..DSV......RVQEG..D..A....KLLGQAVDD.RALIVSTYAPEFADDVEYAVGLSAAAEARVE..GMDDVLLADAHNCNNGLDGDdl.ghVYPG....SKRSFDMIQAAGEVARRI..RDAPD........RDMRLGTAWDRT......T-..WRPT.DG.IGPLGVRVAVLE..TG.D.......................QRTAYVLVDGNNMEP.GLR...EQLIDALDA..VD-.......................HAEVMTTDTHIVNTVE-.....SSNQVGAAL...D........WDELTALVSELTEEAIED..LEPV.EGGMAS..ERAE.VTVFGND...R.T....ETL....ASHA....NAVIA.M.SGAIAVLAVLATVTI-s...........................................
#=GC seq_cons                        ...............................................th.phlhp...hPphh...htlhh..hlh.lu.hhhshhsh...............................hh.shhhhh.ls...hlhus.h.l.s....h.phhttt........hshp+s...hhLul..hsthlhhhhhhhushhs......................hh..hhhhu...........................hshhh.shphll.l.hu.hsphphhtsh...........hsuhlpshhhhhhhhhh......................................h...hhh..hhhhhshlhs..h.sshh.a.......lhhl-psh+psh.slushchlpuFltphhps..sppl...Ephhc..pl..Gppt.lslshlthcp.........t..................t.....t..t...........cshhl.lP.lHPGPhuplGGuslP.phltpp.hpth..........................sh.s.HususH-hNlsopp-lcpll....cslppsh.pphp......hsspso..t.h......chp.s..p..s....phhs.hFGc.sslhhhohuPphh-Dlshslshphhttupt....hppshlVDsHNs.st.ts......h..t....spcs.chhpustphhp.h..tsttp........tshphGhuts.h..........h..t.cG.lGshGlpshlhc..ls.s.......................pcsuhlhhDuNNMps.ulR...-clhptlpp..s.........................tsElhTTDTHhVsslp......uhp.lGtth...s........tcplhphltchlccAhsc..hpss.psuhss..tpsc.lplhGpp...t.h....ppL....spth....sshlp.h.sthhhhhhhhhshh..............................................
//
DBGET integrated database retrieval system