GenomeNet

Database: Pfam
Entry: DUF2209
LinkDB: DUF2209
Original site: DUF2209 
#=GF ID   DUF2209
#=GF AC   PF09974.10
#=GF DE   Uncharacterized protein conserved in archaea (DUF2209)
#=GF AU   COGs;
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   COGs (COG4921)
#=GF GA   26.80 26.80;
#=GF TC   27.50 61.70;
#=GF NC   26.60 25.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR014514;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This domain, found in various hypothetical archaeal proteins,
#=GF CC   has no known function.
#=GF SQ   34
#=GS Q46FK8_METBF/5-124      AC Q46FK8.1
#=GS A0A166S8S9_9EURY/1-104  AC A0A166S8S9.1
#=GS K4MCG5_9EURY/1-64       AC K4MCG5.1
#=GS V4XNG0_9ARCH/1-118      AC V4XNG0.1
#=GS Q8PZI2_METMA/5-124      AC Q8PZI2.1
#=GS D8J3E3_HALJB/2-121      AC D8J3E3.1
#=GS V4YCZ5_9ARCH/1-104      AC V4YCZ5.1
#=GS D5E6X9_METMS/5-123      AC D5E6X9.1
#=GS A0A2G1X110_9EURY/1-118  AC A0A2G1X110.1
#=GS G7WLN2_METH6/4-120      AC G7WLN2.1
#=GS A0A256ITM3_9EURY/2-121  AC A0A256ITM3.1
#=GS Q8TK02_METAC/5-124      AC Q8TK02.1
#=GS A0A238VDM2_HALVU/1-104  AC A0A238VDM2.1
#=GS A0A256IYA2_9EURY/1-76   AC A0A256IYA2.1
#=GS A0A256HAN1_9EURY/2-121  AC A0A256HAN1.1
#=GS A0A256KSY1_9EURY/1-118  AC A0A256KSY1.1
#=GS D7E8C1_METEZ/5-124      AC D7E8C1.1
#=GS D5VTX8_METIM/4-122      AC D5VTX8.1
#=GS U1QG47_9EURY/2-121      AC U1QG47.1
#=GS L0KU94_METHD/5-124      AC L0KU94.1
#=GS Y095_METJA/1-120        AC Q57560.1
#=GS A0A1N6YIQ5_9EURY/2-121  AC A0A1N6YIQ5.1
#=GS A0A1G9VSA8_9EURY/2-121  AC A0A1G9VSA8.1
#=GS Q8TY51_METKA/4-126      AC Q8TY51.1
#=GS M0FPM3_9EURY/19-138     AC M0FPM3.1
#=GS F7XLE5_METZD/5-125      AC F7XLE5.1
#=GS F6BBU6_METIK/2-121      AC F6BBU6.1
#=GS A0A081ESC7_9EURY/1-104  AC A0A081ESC7.1
#=GS A0A0E3NVH8_9EURY/5-124  AC A0A0E3NVH8.1
#=GS A0A365TF72_9EURY/2-121  AC A0A365TF72.1
#=GS Q12TG5_METBU/5-124      AC Q12TG5.1
#=GS D1Z208_METPS/4-121      AC D1Z208.1
#=GS W9DQU4_METTI/5-124      AC W9DQU4.1
#=GS F4BYQ5_METSG/1-101      AC F4BYQ5.1
Q46FK8_METBF/5-124                 .IAVDISGRHRIK-GGYYMVCAAAALTVSASHIEKIKQIKILPLWQKRAPSLLDVVQLIEDTADQL..SFEGTIVAEKGDMYNKPKWVTESMFSRAFKYQESIAERMSIELVHHVSLSARNLLI.
A0A166S8S9_9EURY/1-104             .-----------------MVAAAVHATVGTTRLHSVRGMG--FAVSHAEPTLSETTRVVADAVFDLpdPTAEPIVAERGEFYEEPIWMVEQYLEPDFKYVESIAERETVQAAHHAAYAARKLL-l
K4MCG5_9EURY/1-64                  .---------------------------------------------------------MEETVSEI..RFGGTIVTEPGDMYNKPQWLIDSMFSGNFKYEESLSERLCMQLAHHISLSARKLL-l
V4XNG0_9ARCH/1-118                 .--MDISGRHEED-GEYLMVAAAVHARVDPSRIRSVEGIG--FAAVREGPTLEATVALVADAVGNLpePPSCPIVSEHGEFYEEPAARIGVSFQPEFKYVESISERETVQAAHHAAYAARGLL-r
Q8PZI2_METMA/5-124                 .IAVDISGRHRIK-GGYYMVCAAAALTVSADHIEKVKQVKILPVWLKKAPGLLDIVQLIEDTADQL..SFEGTIVAEKGDMYNQPLWVPESMFSQAFKYQESMAERRAIELAHHISLSARNLLI.
D8J3E3_HALJB/2-121                 .VGIDISGRHEER-GEYLMVGAAVAASVGSNRIREVTGIG--LATSRLEPTLEATLSIADEAIGALpdLPEGPVVAERGEFYEEPERAVGASFAPEFKYVESIGERRTIEIAHHAAYATRALI-l
V4YCZ5_9ARCH/1-104                 .-----------------MVAAAVRAQVDAARIRSVDGMG--FAVLAEPPDLEATLAVVAEATGDLahPPEGPVVAEAGEFYEEPAEFVEPSFPTEFKYVETVAERQSVQAAHYAAYGARELL-k
D5E6X9_METMS/5-123                 .IAVDISGRHRHN-SRYLMVCAAVSLSVSGGHVKQIHGVNIKPFVSDNPPEVVDVVQMIERTVEGM..-EGVTIVAEEGDFFNQPEWLSNSMFTASFKYPESLSERMGIEIAHHISLSSRNLL-l
A0A2G1X110_9EURY/1-118             .--MDISGRHEED-GEYLMVAAAVHARVDSARIRSVEGMG--FAAAREGPTLEATVALAAEAVGDLpsPPEGPVVAEGGEFYEEPAERVGLSFQPDFKYVESIGERETVQAAHHAAYAARELL-r
G7WLN2_METH6/4-120                 .VAVDISGRHAVA-GRYIMVSASVAARISPEGVERTRRMR-LVPRVAESVDMEVVIGLMEESVRGL..--SGVVLAERGDLYNLERWRVESILGREFKYPESRGERRAVELAHHASFAGRRLA-l
A0A256ITM3_9EURY/2-121             .VGVDISGRHEED-GEYLMVAAAVHAAIDSSRIRSVEGIG--FASAREGPTLEATVDLVAEAVGNLpePPACPIVSEHGEFYEEPAERVGLSFQPEFKYVESIGERETVQAAHHAAYAARGLL-l
Q8TK02_METAC/5-124                 .IAVDISGRHRIKDG-YYMVCAAVALTVSADHIEKVKQVKILPFWLKRAPGLLDVVQLIEDTANQL..SFEGTIVAEKGDMYNQPLWVPESMFSGAFKYQESLAERRAIELAHHISLSARNLLI.
A0A238VDM2_HALVU/1-104             .-----------------MVAAAVHAVIDSSRIRSIEGMG--FASVREGPTLDATLALTAEAVGNLpePPDCPIVSEGGEFYGEPAELVALSFRPEFKYVESIGERATVQTAHHAAYAARDLL-r
A0A256IYA2_9EURY/1-76              .--MDISGRHEED-GEYLMVAAAVHARVDSARIRSVEGMG--FAAAREGPTLEATVALAAEAVGDLpsPPEGPVVAEGGEFY------------------------------------------.
A0A256HAN1_9EURY/2-121             .VGVDISGRHEEA-GEYLMVAAAVHARVGSTRIRSVEGMG--FAAVREGPTLDATLGLVATAVGNLpePPDGPIVAEHGEFYEEPPDRVGLSFRPEFKYVESIGERETVQAAHHAAYAARDLL-l
A0A256KSY1_9EURY/1-118             .--MDISGRHEED-GEYLMVAAAVHARVDSARIRSVEGMG--FAAAREGPTLEATVALAAEAVGDLpsPPEGPVVAEGGEFYEEPAERVGLSFQPDFKYVESIGERETVQAAHHAAYAARDLL-r
D7E8C1_METEZ/5-124                 .IAVDISGRHKIKNG-YYMVCAAVSVVSSADHVEKVNQVKIKPFWMDSAPQVTDVVRIIEDTVKEI..KYDGTIVAEKGDMYNKPEWVATSMFSKNFKYQESLSERLAIEMAHHISLSARNLLI.
D5VTX8_METIM/4-122                 .LAIDISGRHNIG-NRYLRVYAGILLEILADRIVHVEKID-VMVKEEKSQKVRDILRELKEFINKF..EDFEYVLCERGEFFNLSKDVVEGVLRKKVIFPKTRGELEAINIAHHISYSFRKFL-l
U1QG47_9EURY/2-121                 .VGVDISGRHEEH-GAYLMVAAAVRAQVDAARIRSVDGMG--FAVLAEPPDLEATLAVVAEATGDLahPPEGPVVAEAGEFYEEPAEFVEPSFPTEFKYVETVAERQSVQAAHYAAYGARELL-k
L0KU94_METHD/5-124                 .IAVDISGRH-VEDGEYFMVCVAVSFSVFPDHIDKTHQINIRHFTSRNAPEINDVATMVEKTVEGL..NPQATIVMEAGDMFNRPQWLVTGMFSRDFKYQESLSERRAIEIAHHISMSARRLL-k
Y095_METJA/1-120                   .MAIDISGRHHEN-DIFFRVYAGVLVEIKADRIVHVEKID-VMVKEEETQKLRDIVKEVKELIDKV.gDEFDYILCERGEFFNISKDIISAILKKEVIFPKTRGELEAINIAHHVSYSVRKLLI.
A0A1N6YIQ5_9EURY/2-121             .VGIDISGRHEED-GEYLMVAAAVHATVGTTRVQSIRGMG--FAVSHEPPTLSAITELVADAVCDLpePADGPVVAERGEFYEEPDWMVEQHFEPEFKYVESIAERETVQAAHHAAYSARKLL-l
A0A1G9VSA8_9EURY/2-121             .VGVDISGRHEEA-GEYLMVAAAVHAVVDSTRIRSVEGMG--FATSRAQPTLDATLAVVAEAVAELpnTPDGPVVSERGEFYEEPAERVELEFRPPFKYIESIAERETVQAAHYAAYAARELL-l
Q8TY51_METKA/4-126                 .VGVDVSGRHAEEDGHYNRITACVSAEVDGFNVFTVRDVNVFVVCTREPPNLRTLTEEVSRALNGLdkDDEYMVVAEPGEFFGEPEWRVSALLGAPFKYAETVAEREVVEMAHKLAYGVYRGV-k
M0FPM3_9EURY/19-138                .VGVDISGRHEED-GEYLMVAAAVHARIDSARIRSVEGIG--FAAAREGPTLEATVALTAEAVGRLpePPDGPIVAEGGEFYEEPAERVGLSFQPDFKYVESIGERETVQAAHHAAYAARDLL-l
F7XLE5_METZD/5-125                 .VAVDISGRHRTSRGHYYIVCAAVSLSVSPDHIEKIHQVNTKAFRMYRPLKVLDVVQIIEKTVSNI..KREGVIVTEKGDMYNKPLNFVSSRFKGEFKYQESISERLAVQLAHHISLSSRKLL-v
F6BBU6_METIK/2-121                 l-GIDISGRHEVY-GKFLRLYAGILAEISADRVIHVEKIE-VHYSESTTQTPKDIIKEVKELMSKI.kGNYDYIVCEKGEFFRIPKEHVSSLLGKEVIHPKTLGELELINIAHHVSYSCRKLL-l
A0A081ESC7_9EURY/1-104             .-----------------MVAAAVHARIDSTRIRTVEGMG--FAAAREGPTLDATVALAAEAVGSLpdPPDGPIVAEGGEFYEEPAERVGPSFRPEFKYVESIGERETVQAAHHAAYAARDLL-l
A0A0E3NVH8_9EURY/5-124             .IAVDISGRHRIKDG-YYMVCAAAALKISASHIEKIKQVKIQPRWLQEAPRLVDIVQLIEDTVAQL..DFKGTIVTEKGDMYNEPQWVPDSMFTLAFKYQESIGERRAIELAHHISLSTRNLL-l
A0A365TF72_9EURY/2-121             .VGVDVSGRHEED-GEYLMVAAAVRADVGTARIRSVLGMG--FAARRDGPTLENVAELVADAVDDLpePPEGPVVAEHGEFYEEPPWTVAHYFGGEFKYIESIAERETVQTAHHAAYAARKLL-l
Q12TG5_METBU/5-124                 .IAVDISGRHKIKDG-YYMVCAAVALEVSASHIESISQVAIKPFLSHDPLAVLDIVRIIEVTVSEI..AFPGTIVVEKGDLYNQPEWLSKNMFSRDIKYQESLSEMLAIEFAHYVSLSSRKLLM.
D1Z208_METPS/4-121                 .VAVDISGRHKLADGRYHLVCVAVSAVLSPFDVEKIEDMR-IYHEEADDVSVETVADLIKRAATRY..--RGAVVTEPGEFYNYPEWRVEAILGRKFKYAESVGERKAIEVAHHVSLAVHRML-h
W9DQU4_METTI/5-124                 .IAVDISGRHKVND-EYLMVCAAVAASVTADHIEKVNQINLRSFRSKSAPDVQFVVKMVETTVSEL..KSCGTIVTEAGDFYNKPQWLIDSMFTRDFKYQESLSERRCIEIAHHASLSSRKLL-l
F4BYQ5_METSG/1-101                 .-----------------MVCAVLSARVSPNFIEKVHSVR-LVPRIAEALDLNVIADLISDACLCL..--PGTIVAEQGDLYNLEVWRAQSILGRDFKYPETIAERTAIELAHHISLAGRRLI-v
#=GC seq_cons                      .lulDISGRHc.p.GtYhMVsAAVpApVsus+IcpVcths..hstt+csPsLpsslpllt-sVspL..sscGsIVuEpGEFYpcPt.hVpshFp.-FKYsESluERcslphAHHsuhuuRcLL.h
//
DBGET integrated database retrieval system