GenomeNet

Database: Pfam
Entry: DUF2729
LinkDB: DUF2729
Original site: DUF2729 
#=GF ID   DUF2729
#=GF AC   PF10870.10
#=GF DE   Protein of unknown function (DUF2729)
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF SE   PRODOM
#=GF GA   20.20 20.20;
#=GF TC   31.70 61.30;
#=GF NC   18.60 17.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR022621;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This viral family of proteins has no known function.
#=GF SQ   4
#=GS Y072_NPVAC/4-60    AC P41471.1
#=GS Q8B9I0_NPVR1/4-60  AC Q8B9I0.1
#=GS Q1HH16_NPVAP/4-56  AC Q1HH16.1
#=GS Q0GYF0_9ABAC/4-60  AC Q0GYF0.1
Y072_NPVAC/4-60               .KLLTYCKVKLVKGFSKKFASLFCRCVVSHLSDEDDSDGDRYYQYNNNCNFIYINIVK.
Q8B9I0_NPVR1/4-60             .KLLTYCKLKLVKGFSKKFASLFCRCVVSHLSDEDDSDGDRYYQYNNNCNFIYINIVK.
Q1HH16_NPVAP/4-56             n-FLTDCKFKLIKSATKTVSALLCKCVAPQDS----DGGDRYTQINNNCNFIYVNVI-n
Q0GYF0_9ABAC/4-60             .KLLTYCKVKLVKGFSKKFASLFCRCVVSHLSDEDDSDGDRYYQYNNNCNFIYINIVK.
#=GC seq_cons                 .KLLTYCKlKLVKGFSKKFASLFCRCVVSHLSDEDDSDGDRYYQYNNNCNFIYINIVK.
//
DBGET integrated database retrieval system