GenomeNet

Database: Pfam
Entry: DUF3371
LinkDB: DUF3371
Original site: DUF3371 
#=GF ID   DUF3371
#=GF AC   PF11851.9
#=GF DE   Domain of unknown function (DUF3371)
#=GF AU   Assefa S;0000-0003-2178-533X
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   PFAM-B_3115 (release 23.0)
#=GF GA   25.10 25.10;
#=GF TC   26.80 28.80;
#=GF NC   23.60 23.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR021802;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This domain is functionally uncharacterised. This domain is
#=GF CC   found in eukaryotes. This presumed domain is typically between
#=GF CC   125 to 142 amino acids in length.
#=GF SQ   1277
#=GS A0A1S3SG10_SALSA/239-384  AC A0A1S3SG10.1
#=GS A0A2K6EK08_PROCO/370-522  AC A0A2K6EK08.1
#=GS F7A3Z7_HORSE/375-500      AC F7A3Z7.2
#=GS A2AEW1_MOUSE/431-571      AC A2AEW1.1
#=GS A0A1D5QQI9_MACMU/196-315  AC A0A1D5QQI9.1
#=GS A0A384DAD5_URSMA/225-344  AC A0A384DAD5.1
#=GS A0A3Q1MKP6_BOVIN/391-516  AC A0A3Q1MKP6.1
#=GS M7BF36_CHEMY/290-408      AC M7BF36.1
#=GS A2AEW0_MOUSE/396-536      AC A2AEW0.1
#=GS G7Q2P5_MACFA/432-574      AC G7Q2P5.1
#=GS A0A3Q3NID2_9TELE/356-479  AC A0A3Q3NID2.1
#=GS H2ME82_ORYLA/283-406      AC H2ME82.1
#=GS A0A2K6AJJ3_MANLE/196-315  AC A0A2K6AJJ3.1
#=GS F7ADK8_XENTR/167-282      AC F7ADK8.1
#=GS W5NBT1_LEPOC/388-540      AC W5NBT1.1
#=GS G1RL61_NOMLE/225-344      AC G1RL61.3
#=GS A0A1S3MFQ0_SALSA/359-491  AC A0A1S3MFQ0.1
#=GS A0A3B5B5V1_9TELE/350-473  AC A0A3B5B5V1.1
#=GS A0A2Y9J780_ENHLU/284-409  AC A0A2Y9J780.1
#=GS G3H9I5_CRIGR/1-110        AC G3H9I5.1
#=GS A0A2R8QFU5_DANRE/386-458  AC A0A2R8QFU5.1
#=GS H3AZE9_LATCH/317-456      AC H3AZE9.1
#=GS A0A2I2YQK2_GORGO/290-415  AC A0A2I2YQK2.1
#=GS A0A2Y9IZF5_ENHLU/228-353  AC A0A2Y9IZF5.1
#=GS A0A3Q2CER8_CYPVA/241-392  AC A0A3Q2CER8.1
#=GS A0A3P9N7Z9_POERE/204-285  AC A0A3P9N7Z9.1
#=GS A0A2K6CP29_MACNE/335-487  AC A0A2K6CP29.1
#=GS G3P7Y0_GASAC/336-475      AC G3P7Y0.1
#=GS A0A3Q7R311_VULVU/391-516  AC A0A3Q7R311.1
#=GS A0A2U3ZJV2_ODORO/397-522  AC A0A2U3ZJV2.1
#=GS A0A2K6JRA5_RHIBE/321-473  AC A0A2K6JRA5.1
#=GS A0A401PX63_SCYTO/53-164   AC A0A401PX63.1
#=GS A0A3P8WW05_CYNSE/348-472  AC A0A3P8WW05.1
#=GS A0A3B3Y0G8_9TELE/311-445  AC A0A3B3Y0G8.1
#=GS W5NG70_LEPOC/271-397      AC W5NG70.1
#=GS A0A2Y9NA17_DELLE/381-506  AC A0A2Y9NA17.1
#=GS A0A2Y9IYR3_ENHLU/381-506  AC A0A2Y9IYR3.1
#=GS A0A3Q3AQZ0_KRYMA/268-410  AC A0A3Q3AQZ0.1
#=GS A0A2Y9N0U2_DELLE/397-522  AC A0A2Y9N0U2.1
#=GS A0A337S0Z4_FELCA/386-541  AC A0A337S0Z4.1
#=GS A0A3Q7V753_URSAR/391-516  AC A0A3Q7V753.1
#=GS A0A1S3GG95_DIPOR/327-469  AC A0A1S3GG95.1
#=GS F6RM40_MACMU/236-388      AC F6RM40.1
#=GS A0A2I4BXD1_9TELE/266-415  AC A0A2I4BXD1.1
#=GS A0A2K5IEN4_COLAP/388-513  AC A0A2K5IEN4.1
#=GS A0A3B3XDU9_9TELE/244-370  AC A0A3B3XDU9.1
#=GS A0A2Y9FPM5_PHYMC/290-415  AC A0A2Y9FPM5.1
#=GS A0A1U7TUS0_TARSY/225-344  AC A0A1U7TUS0.1
#=GS A0A2U3V0J9_TURTR/290-415  AC A0A2U3V0J9.1
#=GS A0A3Q4IFF1_NEOBR/303-450  AC A0A3Q4IFF1.1
#=GS A0A0P7TZG4_SCLFO/358-542  AC A0A0P7TZG4.1
#=GS A0A3B4C0W6_PYGNA/359-491  AC A0A3B4C0W6.1
#=GS A0A1S3A503_ERIEU/394-538  AC A0A1S3A503.1
#=GS A0A2K6T3V4_SAIBB/391-516  AC A0A2K6T3V4.1
#=GS A0A3P8WQV8_CYNSE/379-503  AC A0A3P8WQV8.1
#=GS G3TPP3_LOXAF/397-522      AC G3TPP3.1
#=GS A0A3Q1HY08_ANATE/302-445  AC A0A3Q1HY08.1
#=GS A0A340WGD9_LIPVE/189-314  AC A0A340WGD9.1
#=GS A0A2K6JRE1_RHIBE/236-388  AC A0A2K6JRE1.1
#=GS A0A3B4AP91_9GOBI/281-403  AC A0A3B4AP91.1
#=GS A0A3P8V1X3_CYNSE/301-484  AC A0A3P8V1X3.1
#=GS A0A2K6GN67_PROCO/339-464  AC A0A2K6GN67.1
#=GS A0A1U7T3D4_TARSY/228-353  AC A0A1U7T3D4.1
#=GS A0A2D0RW63_ICTPU/253-382  AC A0A2D0RW63.1
#=GS A0A2I0MJ87_COLLI/318-437  AC A0A2I0MJ87.1
#=GS A0A3P8V3U2_CYNSE/330-513  AC A0A3P8V3U2.1
#=GS A0A1S3WBH1_ERIEU/356-481  AC A0A1S3WBH1.1
#=GS A0A1U7TNJ4_TARSY/277-396  AC A0A1U7TNJ4.1
#=GS A0A2D0PMK7_ICTPU/324-496  AC A0A2D0PMK7.1
#=GS A0A2K5ETJ9_AOTNA/399-551  AC A0A2K5ETJ9.1
#=GS A0A1S3SG05_SALSA/257-402  AC A0A1S3SG05.1
#=GS F7BRE1_XENTR/253-364      AC F7BRE1.1
#=GS A0A1S3P2R5_SALSA/304-447  AC A0A1S3P2R5.1
#=GS A0A2R9BLL0_PANPA/397-549  AC A0A2R9BLL0.1
#=GS A0A2I3SAN6_PANTR/335-487  AC A0A2I3SAN6.1
#=GS H0WFM0_OTOGA/376-501      AC H0WFM0.1
#=GS G3SRM5_LOXAF/319-474      AC G3SRM5.1
#=GS A0A2Y9P583_DELLE/196-315  AC A0A2Y9P583.1
#=GS A0A2Y9FMW2_PHYMC/284-409  AC A0A2Y9FMW2.1
#=GS A0A2I2YXN7_GORGO/397-522  AC A0A2I2YXN7.1
#=GS A0A3Q2HU13_HORSE/338-493  AC A0A3Q2HU13.1
#=GS K9L437_ORYLA/276-402      AC K9L437.1
#=GS A0A3P8VT10_CYNSE/299-451  AC A0A3P8VT10.1
#=GS A0A3Q3M4E3_9TELE/499-605  AC A0A3Q3M4E3.1
#=GS L5JNG9_PTEAL/289-405      AC L5JNG9.1
#=GS A0A2I2V3G1_FELCA/332-487  AC A0A2I2V3G1.2
#=GS A0A3P8VMY4_CYNSE/336-485  AC A0A3P8VMY4.1
#=GS A0A1S3FGT4_DIPOR/156-275  AC A0A1S3FGT4.1
#=GS A0A3B4ANS5_9GOBI/386-508  AC A0A3B4ANS5.1
#=GS A0A3Q3LU36_9TELE/242-395  AC A0A3Q3LU36.1
#=GS A0A3Q3G3W3_9LABR/248-373  AC A0A3Q3G3W3.1
#=GS A0A1U7U6Q5_TARSY/158-277  AC A0A1U7U6Q5.1
#=GS A0A3B4TWL9_SERDU/252-382  AC A0A3B4TWL9.1
#=GS A0A2I0MJ86_COLLI/194-313  AC A0A2I0MJ86.1
#=GS F1RW57_PIG/432-574        AC F1RW57.1
#=GS A0A384DB60_URSMA/262-381  AC A0A384DB60.1
#=GS A0A226NQX8_COLVI/315-452  AC A0A226NQX8.1
#=GS A0A3Q3EG63_9LABR/252-403  AC A0A3Q3EG63.1
#=GS A0A2K6R672_RHIRO/334-486  AC A0A2K6R672.1
#=GS A0A2R8P1K6_CALJA/290-415  AC A0A2R8P1K6.1
#=GS G3GS56_CRIGR/345-470      AC G3GS56.1
#=GS A0A3Q2V6Z9_HAPBU/356-479  AC A0A3Q2V6Z9.1
#=GS A0A384DAI2_URSMA/260-379  AC A0A384DAI2.1
#=GS A0A3Q1FPE1_9TELE/336-520  AC A0A3Q1FPE1.1
#=GS A0A3Q2EF98_CYPVA/272-396  AC A0A3Q2EF98.1
#=GS A0A3B3RPA7_9TELE/330-469  AC A0A3B3RPA7.1
#=GS A0A3Q1F5M9_9TELE/245-371  AC A0A3Q1F5M9.1
#=GS A0A3P9BYG6_9CICH/251-407  AC A0A3P9BYG6.1
#=GS A0A2D0PIF9_ICTPU/352-524  AC A0A2D0PIF9.1
#=GS F6QN42_XENTR/202-317      AC F6QN42.1
#=GS K7EV11_PONAB/154-296      AC K7EV11.1
#=GS A0A2K6A4Z6_MANLE/400-552  AC A0A2K6A4Z6.1
#=GS A0A2K5I0Z7_COLAP/157-276  AC A0A2K5I0Z7.1
#=GS A0A2K5V9X1_MACFA/196-315  AC A0A2K5V9X1.1
#=GS A0A2I4BB22_9TELE/276-402  AC A0A2I4BB22.1
#=GS A0A3P8XGR8_ESOLU/328-453  AC A0A3P8XGR8.1
#=GS A0A2K6V532_SAIBB/432-574  AC A0A2K6V532.1
#=GS A0A3Q0CRP1_MESAU/345-470  AC A0A3Q0CRP1.1
#=GS A0A3Q1IBR3_ANATE/328-472  AC A0A3Q1IBR3.1
#=GS A0A2Y9IYR5_ENHLU/397-522  AC A0A2Y9IYR5.1
#=GS A0A3Q2X428_HAPBU/303-450  AC A0A3Q2X428.1
#=GS A0A2I2Z2L0_GORGO/158-277  AC A0A2I2Z2L0.1
#=GS A0A3P8NWT9_ASTCA/330-513  AC A0A3P8NWT9.1
#=GS H0VBE7_CAVPO/179-329      AC H0VBE7.2
#=GS A0A3B5B5C3_9TELE/188-302  AC A0A3B5B5C3.1
#=GS A0A3Q1EWS0_9TELE/276-431  AC A0A3Q1EWS0.1
#=GS A0A1S3P4D7_SALSA/314-486  AC A0A1S3P4D7.1
#=GS G3TIJ0_LOXAF/137-256      AC G3TIJ0.1
#=GS A0A3Q0GTS5_ALLSI/310-452  AC A0A3Q0GTS5.1
#=GS A0A1L8GU88_XENLA/188-301  AC A0A1L8GU88.1
#=GS A0A1S3P2L8_SALSA/279-401  AC A0A1S3P2L8.1
#=GS A0A3B4XXA3_SERLL/252-419  AC A0A3B4XXA3.1
#=GS A0A2K6R655_RHIRO/236-388  AC A0A2K6R655.1
#=GS A0A226MVW0_CALSU/244-362  AC A0A226MVW0.1
#=GS A0A1S3P2P2_SALSA/287-409  AC A0A1S3P2P2.1
#=GS A0A1S3SG12_SALSA/177-322  AC A0A1S3SG12.1
#=GS G1NY73_MYOLU/375-500      AC G1NY73.1
#=GS A0A3Q7SG80_VULVU/290-415  AC A0A3Q7SG80.1
#=GS A0A1U8BQC9_MESAU/391-516  AC A0A1U8BQC9.1
#=GS A0A3P8ZFG8_ESOLU/283-408  AC A0A3P8ZFG8.1
#=GS A0A3P9ASQ4_9CICH/330-513  AC A0A3P9ASQ4.1
#=GS F7ENZ1_XENTR/309-432      AC F7ENZ1.1
#=GS A0A3P8WW10_CYNSE/449-573  AC A0A3P8WW10.1
#=GS A0A3L8SQC0_CHLGU/146-265  AC A0A3L8SQC0.1
#=GS A0A2K5EA47_AOTNA/225-344  AC A0A2K5EA47.1
#=GS A0A2I3MZP5_PAPAN/366-491  AC A0A2I3MZP5.1
#=GS G3URR7_MELGA/284-409      AC G3URR7.1
#=GS A0A3Q7W6Q0_URSAR/434-559  AC A0A3Q7W6Q0.1
#=GS A0A2K5IEY8_COLAP/390-515  AC A0A2K5IEY8.1
#=GS A0A384BE32_BALAS/320-475  AC A0A384BE32.1
#=GS A0A2K5I152_COLAP/196-315  AC A0A2K5I152.1
#=GS A0A2U4CCZ3_TURTR/397-522  AC A0A2U4CCZ3.1
#=GS A0A3B3IKI2_ORYLA/253-402  AC A0A3B3IKI2.1
#=GS A0A3P8PSN0_ASTCA/389-517  AC A0A3P8PSN0.1
#=GS A0A3Q4G505_NEOBR/239-398  AC A0A3Q4G505.1
#=GS A0A091F945_CORBR/259-378  AC A0A091F945.1
#=GS A0A060XBH9_ONCMY/392-510  AC A0A060XBH9.1
#=GS A0A2D0R0Y3_ICTPU/320-463  AC A0A2D0R0Y3.1
#=GS A0A3B3Y9E2_9TELE/251-403  AC A0A3B3Y9E2.1
#=GS I3NH56_ICTTR/351-475      AC I3NH56.2
#=GS Q8R2J8_MESAU/284-409      AC Q8R2J8.1
#=GS A0A091GGY0_9AVES/259-371  AC A0A091GGY0.1
#=GS G3UPF9_MELGA/339-464      AC G3UPF9.1
#=GS A0A1S3MYS4_SALSA/266-410  AC A0A1S3MYS4.1
#=GS A0A2K6V520_SAIBB/481-623  AC A0A2K6V520.1
#=GS A0A3B4A119_9GOBI/246-356  AC A0A3B4A119.1
#=GS A0A3P8YUK1_ESOLU/434-580  AC A0A3P8YUK1.1
#=GS A0A2K6A501_MANLE/236-388  AC A0A2K6A501.1
#=GS A0A3P8VWF2_CYNSE/270-420  AC A0A3P8VWF2.1
#=GS F7DUX6_MONDO/158-277      AC F7DUX6.1
#=GS A0A1S3WBL3_ERIEU/381-506  AC A0A1S3WBL3.1
#=GS U3KG16_FICAL/419-544      AC U3KG16.1
#=GS A0A0Q3PJ16_AMAAE/276-394  AC A0A0Q3PJ16.1
#=GS A0A2R9C597_PANPA/390-515  AC A0A2R9C597.1
#=GS A0A3M0JWL1_HIRRU/315-454  AC A0A3M0JWL1.1
#=GS A0A1S3LLK7_SALSA/392-510  AC A0A1S3LLK7.1
#=GS H2PN98_PONAB/225-344      AC H2PN98.1
#=GS W5PJC4_SHEEP/391-516      AC W5PJC4.1
#=GS A0A2K6P6Q8_RHIRO/388-513  AC A0A2K6P6Q8.1
#=GS A0A3B3QJ74_9TELE/301-415  AC A0A3B3QJ74.1
#=GS A9UJR8_HAPBU/271-397      AC A9UJR8.1
#=GS A0A3Q2V1Z7_HAPBU/251-404  AC A0A3Q2V1Z7.1
#=GS A0A2R8RZ90_DANRE/306-419  AC A0A2R8RZ90.1
#=GS A0A1V4JSV0_PATFA/170-248  AC A0A1V4JSV0.1
#=GS H2MMD1_ORYLA/387-508      AC H2MMD1.2
#=GS A0A3B3YQA6_9TELE/266-392  AC A0A3B3YQA6.1
#=GS A0A1S3LCI7_SALSA/222-347  AC A0A1S3LCI7.1
#=GS A0A3Q2HDJ1_HORSE/315-434  AC A0A3Q2HDJ1.1
#=GS A0A3P8ZI65_ESOLU/251-391  AC A0A3P8ZI65.1
#=GS A0A2Y9N0U7_DELLE/345-470  AC A0A2Y9N0U7.1
#=GS G3NGM0_GASAC/368-489      AC G3NGM0.1
#=GS W5PJC8_SHEEP/375-500      AC W5PJC8.1
#=GS A0A2I3M2E5_PAPAN/391-516  AC A0A2I3M2E5.1
#=GS A0A096NI31_PAPAN/335-487  AC A0A096NI31.2
#=GS A0A2K6P6Q6_RHIRO/397-522  AC A0A2K6P6Q6.1
#=GS A0A3B3QUC7_9TELE/394-522  AC A0A3B3QUC7.1
#=GS A0A2U4AI54_TURTR/158-277  AC A0A2U4AI54.1
#=GS A0A2K6U7U6_SAIBB/319-471  AC A0A2K6U7U6.1
#=GS A0A091G7D9_9AVES/339-464  AC A0A091G7D9.1
#=GS G1MFG8_AILME/397-522      AC G1MFG8.1
#=GS A0A2I3HSZ4_NOMLE/388-513  AC A0A2I3HSZ4.1
#=GS A0A060WS80_ONCMY/367-488  AC A0A060WS80.1
#=GS H0X1V5_OTOGA/136-255      AC H0X1V5.1
#=GS A0A3Q0CS06_MESAU/341-466  AC A0A3Q0CS06.1
#=GS A0A1S2ZRB8_ERIEU/391-516  AC A0A1S2ZRB8.1
#=GS A0A3Q1J997_ANATE/387-510  AC A0A3Q1J997.1
#=GS A0A2R9BLL6_PANPA/236-388  AC A0A2R9BLL6.1
#=GS A0A3B3Y9V8_9TELE/218-370  AC A0A3B3Y9V8.1
#=GS A0A2U3VP30_ODORO/327-468  AC A0A2U3VP30.1
#=GS B0QYS7_HUMAN/407-559      AC B0QYS7.1
#=GS A0A452EM33_CAPHI/320-475  AC A0A452EM33.1
#=GS D3ZAW6_RAT/431-572        AC D3ZAW6.1
#=GS K7FFG4_PELSI/271-333      AC K7FFG4.1
#=GS A0A3B3HNN5_ORYLA/384-507  AC A0A3B3HNN5.1
#=GS A0A3Q7REU2_VULVU/397-522  AC A0A3Q7REU2.1
#=GS A0A3P9DK28_9CICH/356-479  AC A0A3P9DK28.1
#=GS A0A087XLL3_POEFO/266-394  AC A0A087XLL3.2
#=GS A0A2K5IBV5_COLAP/335-487  AC A0A2K5IBV5.1
#=GS A0A2R8N2I1_CALJA/195-314  AC A0A2R8N2I1.1
#=GS A0A3Q3M1Z1_9LABR/357-480  AC A0A3Q3M1Z1.1
#=GS F7GCE6_MONDO/329-483      AC F7GCE6.2
#=GS A0A2K6ALP0_MACNE/196-315  AC A0A2K6ALP0.1
#=GS H2SM24_TAKRU/347-517      AC H2SM24.2
#=GS A0A2K6RDG6_RHIRO/315-434  AC A0A2K6RDG6.1
#=GS A0A498LRF0_LABRO/403-540  AC A0A498LRF0.1
#=GS A0A402F426_9SAUR/230-356  AC A0A402F426.1
#=GS A0A3P9A371_ESOLU/327-473  AC A0A3P9A371.1
#=GS F1ML66_BOVIN/196-314      AC F1ML66.1
#=GS A0A091V5V3_NIPNI/259-378  AC A0A091V5V3.1
#=GS A0A3Q7WED9_URSAR/318-473  AC A0A3Q7WED9.1
#=GS A0A3B3QIY7_9TELE/332-446  AC A0A3B3QIY7.1
#=GS A0A2U3ZP33_ODORO/312-431  AC A0A2U3ZP33.1
#=GS A0A3B3VVT7_9TELE/251-400  AC A0A3B3VVT7.1
#=GS A0A1S3LM00_SALSA/224-342  AC A0A1S3LM00.1
#=GS M9MM95_DANRE/402-538      AC M9MM95.1
#=GS A0A2K5LC86_CERAT/397-539  AC A0A2K5LC86.1
#=GS A0A3P9DLQ0_9CICH/369-492  AC A0A3P9DLQ0.1
#=GS A0A3Q4H839_NEOBR/332-408  AC A0A3Q4H839.1
#=GS A0A3Q7WKF3_URSAR/225-344  AC A0A3Q7WKF3.1
#=GS A0A1V4KWW3_PATFA/378-515  AC A0A1V4KWW3.1
#=GS G5AVQ1_HETGA/396-521      AC G5AVQ1.1
#=GS A0A2K6GN93_PROCO/390-515  AC A0A2K6GN93.1
#=GS A0A3B5QUR7_XIPMA/327-508  AC A0A3B5QUR7.1
#=GS A0A2R9A329_PANPA/432-574  AC A0A2R9A329.1
#=GS A0A3Q2U6P0_CHICK/362-487  AC A0A3Q2U6P0.1
#=GS A0A2K5ETJ8_AOTNA/319-471  AC A0A2K5ETJ8.1
#=GS A0A3P9DL36_9CICH/387-510  AC A0A3P9DL36.1
#=GS H3AZE8_LATCH/287-426      AC H3AZE8.1
#=GS A0A3B5QPL5_XIPMA/266-394  AC A0A3B5QPL5.1
#=GS A0A2K6T5U8_SAIBB/225-344  AC A0A2K6T5U8.1
#=GS A0A060VWF9_ONCMY/286-431  AC A0A060VWF9.1
#=GS A0A2K6JXR7_RHIBE/388-513  AC A0A2K6JXR7.1
#=GS A0A2K6CPW0_MACNE/388-513  AC A0A2K6CPW0.1
#=GS A0A2I3HVZ7_NOMLE/397-522  AC A0A2I3HVZ7.1
#=GS A0A2K6P6S0_RHIRO/375-500  AC A0A2K6P6S0.1
#=GS F7F5J1_RAT/321-473        AC F7F5J1.1
#=GS H9GTC2_ANOCA/385-522      AC H9GTC2.1
#=GS A0A286XLR1_CAVPO/315-465  AC A0A286XLR1.1
#=GS A0A455BBQ6_PHYMC/314-469  AC A0A455BBQ6.1
#=GS A0A2R9C5E7_PANPA/381-506  AC A0A2R9C5E7.1
#=GS A0A3Q3F4U3_9LABR/385-508  AC A0A3Q3F4U3.1
#=GS A0A3Q3T4A1_9TELE/369-492  AC A0A3Q3T4A1.1
#=GS F7FWD8_ORNAN/280-442      AC F7FWD8.1
#=GS A0A3Q1LPT6_BOVIN/297-422  AC A0A3Q1LPT6.1
#=GS A0A2Y9NU69_DELLE/314-469  AC A0A2Y9NU69.1
#=GS A0A3Q7X4H2_URSAR/327-468  AC A0A3Q7X4H2.1
#=GS A0A2I4BB26_9TELE/270-396  AC A0A2I4BB26.1
#=GS A0A2K5ETI0_AOTNA/336-488  AC A0A2K5ETI0.1
#=GS S4RJL8_PETMA/98-233       AC S4RJL8.1
#=GS K7FWC9_PELSI/315-477      AC K7FWC9.1
#=GS TFEC_PANTR/225-344        AC A2T713.1
#=GS A0A3P9QEF5_POERE/277-395  AC A0A3P9QEF5.1
#=GS A0A3Q1LFW9_BOVIN/229-347  AC A0A3Q1LFW9.1
#=GS A0A3P9A4A5_ESOLU/152-258  AC A0A3P9A4A5.1
#=GS A0A1S3MZ56_SALSA/281-425  AC A0A1S3MZ56.1
#=GS L5JWL4_PTEAL/432-574      AC L5JWL4.1
#=GS A0A3B4ZZE1_9TELE/215-366  AC A0A3B4ZZE1.1
#=GS A0A3Q0R0Y1_AMPCI/365-493  AC A0A3Q0R0Y1.1
#=GS A0A3B3U123_9TELE/386-510  AC A0A3B3U123.1
#=GS A0A2K5MGY8_CERAT/196-315  AC A0A2K5MGY8.1
#=GS W5MV93_LEPOC/379-505      AC W5MV93.1
#=GS D2JUK3_PIG/290-415        AC D2JUK3.1
#=GS A0A1S3N051_SALSA/204-348  AC A0A1S3N051.1
#=GS A0A3B4WYC4_SERLL/321-447  AC A0A3B4WYC4.1
#=GS I2CV82_MACMU/375-500      AC I2CV82.1
#=GS A0A452IN12_9SAUR/316-456  AC A0A452IN12.1
#=GS A0A087XNE6_POEFO/387-511  AC A0A087XNE6.1
#=GS A0A3Q2GUC0_HORSE/286-405  AC A0A3Q2GUC0.1
#=GS A0A3B4UJQ2_SERDU/305-452  AC A0A3B4UJQ2.1
#=GS A0A2K5EDV5_AOTNA/390-515  AC A0A2K5EDV5.1
#=GS A0A3P8YWU1_ESOLU/392-523  AC A0A3P8YWU1.1
#=GS A0A1S3LE15_SALSA/304-449  AC A0A1S3LE15.1
#=GS A0A3B3WU61_9TELE/439-513  AC A0A3B3WU61.1
#=GS A0A3P9DNI9_9CICH/389-517  AC A0A3P9DNI9.1
#=GS A0A2G8LRA6_STIJA/383-512  AC A0A2G8LRA6.1
#=GS A0A455ATT0_PHYMC/391-516  AC A0A455ATT0.1
#=GS A0A3B4VAB8_SERDU/314-441  AC A0A3B4VAB8.1
#=GS A0A2K5ZRN7_MANLE/397-522  AC A0A2K5ZRN7.1
#=GS G3I106_CRIGR/321-473      AC G3I106.1
#=GS A0A2R8MDP8_CALJA/158-277  AC A0A2R8MDP8.1
#=GS A0A2U3WID4_ODORO/196-315  AC A0A2U3WID4.1
#=GS I3LTE0_PIG/381-506        AC I3LTE0.2
#=GS A0A2K5X0E0_MACFA/236-388  AC A0A2K5X0E0.1
#=GS L5KAF4_PTEAL/345-470      AC L5KAF4.1
#=GS M3Y783_MUSPF/225-344      AC M3Y783.1
#=GS O73871_CHICK/339-464      AC O73871.1
#=GS A0A3Q2KVB6_HORSE/250-369  AC A0A3Q2KVB6.1
#=GS A0A2I3GTG1_NOMLE/196-315  AC A0A2I3GTG1.1
#=GS A0A1A6HTS2_NEOLE/277-417  AC A0A1A6HTS2.1
#=GS A0A0P7TBM8_SCLFO/269-389  AC A0A0P7TBM8.1
#=GS A0A2K5I0Y2_COLAP/225-344  AC A0A2K5I0Y2.1
#=GS A0A2K6JXR8_RHIBE/290-415  AC A0A2K6JXR8.1
#=GS G3TYD4_LOXAF/436-576      AC G3TYD4.1
#=GS A0A2U9C4B8_SCOMX/299-460  AC A0A2U9C4B8.1
#=GS A0A3B3BDJ8_ORYME/354-477  AC A0A3B3BDJ8.1
#=GS A0A3P8U489_AMPPE/322-448  AC A0A3P8U489.1
#=GS G3UT98_MELGA/246-365      AC G3UT98.1
#=GS A0A3Q4H256_NEOBR/369-492  AC A0A3Q4H256.1
#=GS A0A0A0APJ8_CHAVO/259-378  AC A0A0A0APJ8.1
#=GS A0A3B3QV65_9TELE/380-508  AC A0A3B3QV65.1
#=GS A0A3P8U309_AMPPE/244-370  AC A0A3P8U309.1
#=GS A0A1U8CKF4_MESAU/345-486  AC A0A1U8CKF4.1
#=GS A0A2K6R648_RHIRO/321-473  AC A0A2K6R648.1
#=GS A0A3Q0CUA6_MESAU/328-478  AC A0A3Q0CUA6.1
#=GS G1R928_NOMLE/432-574      AC G1R928.1
#=GS A0A3Q4H839_NEOBR/398-515  AC A0A3Q4H839.1
#=GS M7B5S2_CHEMY/266-386      AC M7B5S2.1
#=GS A0A3P8UF29_AMPPE/280-390  AC A0A3P8UF29.1
#=GS A0A3Q1J9G9_ANATE/436-559  AC A0A3Q1J9G9.1
#=GS A0A3Q1JVT2_ANATE/331-477  AC A0A3Q1JVT2.1
#=GS H3CPA2_TETNG/316-451      AC H3CPA2.1
#=GS M3VYS0_FELCA/429-570      AC M3VYS0.1
#=GS H2U0V1_TAKRU/283-403      AC H2U0V1.2
#=GS TFE3_BOVIN/430-572        AC Q05B92.1
#=GS A0A2K6RDM0_RHIRO/225-344  AC A0A2K6RDM0.1
#=GS A0A2R9BLK6_PANPA/324-476  AC A0A2R9BLK6.1
#=GS A0A3Q2X406_HAPBU/357-486  AC A0A3Q2X406.1
#=GS A0A3B3WU72_9TELE/409-483  AC A0A3B3WU72.1
#=GS A0A2K5EDY0_AOTNA/284-409  AC A0A2K5EDY0.1
#=GS MITF_MOUSE/397-522        AC Q08874.4
#=GS MITF_MOUSE/397-522        DR PDB; 6FX5 A; 290-294;
#=GS MITF_MOUSE/397-522        DR PDB; 4ATH A; 290-295;
#=GS MITF_MOUSE/397-522        DR PDB; 6FX5 B; 290-293;
#=GS MITF_MOUSE/397-522        DR PDB; 4ATH B; 290-295;
#=GS F6U056_CALJA/391-543      AC F6U056.2
#=GS A0A3Q2I9X0_HORSE/250-369  AC A0A3Q2I9X0.1
#=GS A0A3Q0SS68_AMPCI/275-401  AC A0A3Q0SS68.1
#=GS A0A2I2UYM0_FELCA/225-344  AC A0A2I2UYM0.1
#=GS A0A455AFT3_PHYMC/396-521  AC A0A455AFT3.1
#=GS A0A3B4AQB2_9GOBI/340-462  AC A0A3B4AQB2.1
#=GS A0A2K6GQ57_PROCO/119-238  AC A0A2K6GQ57.1
#=GS A0A2K5QJW7_CEBCA/432-574  AC A0A2K5QJW7.1
#=GS A0A1S3LG10_SALSA/372-519  AC A0A1S3LG10.1
#=GS A0A0N4SV79_MOUSE/228-353  AC A0A0N4SV79.1
#=GS A0A2I3LZI3_PAPAN/335-487  AC A0A2I3LZI3.1
#=GS A0A3Q4IG93_NEOBR/268-394  AC A0A3Q4IG93.1
#=GS A0A3Q2VEY7_HAPBU/387-510  AC A0A3Q2VEY7.1
#=GS G1QPX2_NOMLE/375-500      AC G1QPX2.2
#=GS A0A401S833_CHIPU/298-418  AC A0A401S833.1
#=GS A0A498LAB3_LABRO/118-243  AC A0A498LAB3.1
#=GS A0A087YGF2_POEFO/328-509  AC A0A087YGF2.2
#=GS G3TZZ1_LOXAF/291-416      AC G3TZZ1.1
#=GS A0A384AYX0_BALAS/375-500  AC A0A384AYX0.1
#=GS A0A3Q3WE09_MOLML/269-396  AC A0A3Q3WE09.1
#=GS E9QC93_DANRE/222-347      AC E9QC93.2
#=GS A0A2R8ZEX6_PANPA/196-315  AC A0A2R8ZEX6.1
#=GS A0A060XDP0_ONCMY/327-472  AC A0A060XDP0.1
#=GS A0A060WAU6_ONCMY/308-423  AC A0A060WAU6.1
#=GS H2QSZ5_PANTR/321-473      AC H2QSZ5.1
#=GS W5NUB2_SHEEP/229-348      AC W5NUB2.1
#=GS E9PZ28_MOUSE/372-497      AC E9PZ28.1
#=GS A0A1S3SG03_SALSA/319-464  AC A0A1S3SG03.1
#=GS A0A2U3XD63_LEPWE/171-326  AC A0A2U3XD63.1
#=GS A0A1V4KY25_PATFA/423-560  AC A0A1V4KY25.1
#=GS A0A3Q3WAK1_MOLML/248-373  AC A0A3Q3WAK1.1
#=GS A0A3B3R177_9TELE/252-379  AC A0A3B3R177.1
#=GS A0A3P9BQ61_9CICH/266-392  AC A0A3P9BQ61.1
#=GS A0A096MFL0_POEFO/272-400  AC A0A096MFL0.1
#=GS A0A3P9QCD2_POERE/244-372  AC A0A3P9QCD2.1
#=GS A0A2R8Q945_DANRE/246-398  AC A0A2R8Q945.1
#=GS A0A3Q3VWX9_MOLML/335-517  AC A0A3Q3VWX9.1
#=GS A0A2Y9MQP2_DELLE/327-469  AC A0A2Y9MQP2.1
#=GS A0A1D5PQJ4_CHICK/315-452  AC A0A1D5PQJ4.1
#=GS A0A087Y975_POEFO/252-404  AC A0A087Y975.2
#=GS A0A1S2ZW17_ERIEU/195-314  AC A0A1S2ZW17.1
#=GS A0A452FLL9_CAPHI/375-499  AC A0A452FLL9.1
#=GS A0A3B5KL38_TAKRU/359-479  AC A0A3B5KL38.1
#=GS A0A1S3ENQ4_DIPOR/397-522  AC A0A1S3ENQ4.1
#=GS A0A3B4BA99_9GOBI/312-457  AC A0A3B4BA99.1
#=GS A0A3Q1I6A6_ANATE/276-420  AC A0A3Q1I6A6.1
#=GS A0A3B4DJ39_PYGNA/283-411  AC A0A3B4DJ39.1
#=GS A0A3Q1KGS9_ANATE/398-581  AC A0A3Q1KGS9.1
#=GS A0A3Q7WUT5_URSAR/313-432  AC A0A3Q7WUT5.1
#=GS A0A3Q3WK53_MOLML/386-508  AC A0A3Q3WK53.1
#=GS A0A2K5Q0R8_CEBCA/158-277  AC A0A2K5Q0R8.1
#=GS A0A226PFJ2_COLVI/87-205   AC A0A226PFJ2.1
#=GS A0A2K6CFN6_MACNE/397-539  AC A0A2K6CFN6.1
#=GS A0A2Y9IZF1_ENHLU/390-515  AC A0A2Y9IZF1.1
#=GS A0A226MIU8_CALSU/315-452  AC A0A226MIU8.1
#=GS TFEC_RAT/196-314          AC Q63302.2
#=GS A0A093PR34_9PASS/344-372  AC A0A093PR34.1
#=GS A0A2K6EJZ9_PROCO/234-386  AC A0A2K6EJZ9.1
#=GS A0A2U9BHP6_SCOMX/763-908  AC A0A2U9BHP6.1
#=GS A0A2R9BLI2_PANPA/321-473  AC A0A2R9BLI2.1
#=GS H2MMD1_ORYLA/323-401      AC H2MMD1.2
#=GS A0A2Y9JRJ6_ENHLU/429-571  AC A0A2Y9JRJ6.1
#=GS A0A2Y9FSG8_PHYMC/158-277  AC A0A2Y9FSG8.1
#=GS A0A455AG86_PHYMC/390-515  AC A0A455AG86.1
#=GS G3HNC3_CRIGR/432-573      AC G3HNC3.1
#=GS G3RDS0_GORGO/432-574      AC G3RDS0.2
#=GS A0A3Q2DMH3_CYPVA/335-444  AC A0A3Q2DMH3.1
#=GS H3D4U4_TETNG/339-462      AC H3D4U4.1
#=GS A0A2K5RBR5_CEBCA/381-506  AC A0A2K5RBR5.1
#=GS A0A0P7UF86_SCLFO/373-514  AC A0A0P7UF86.1
#=GS A0A3B5R7D7_XIPMA/383-466  AC A0A3B5R7D7.1
#=GS G5BNI2_HETGA/550-583      AC G5BNI2.1
#=GS A0A3Q1MD59_BOVIN/225-343  AC A0A3Q1MD59.1
#=GS A0A2U3VPB4_ODORO/429-570  AC A0A2U3VPB4.1
#=GS A0A2Y9FMV2_PHYMC/397-522  AC A0A2Y9FMV2.1
#=GS A0A3B3WZM2_9TELE/330-511  AC A0A3B3WZM2.1
#=GS A0A2K5ETI6_AOTNA/361-513  AC A0A2K5ETI6.1
#=GS A0A3Q1GB84_9TELE/242-397  AC A0A3Q1GB84.1
#=GS A0A452SCZ0_URSAM/397-521  AC A0A452SCZ0.1
#=GS G3P7Y4_GASAC/278-417      AC G3P7Y4.1
#=GS A0A3Q2WKJ3_HAPBU/320-446  AC A0A3Q2WKJ3.1
#=GS A0A3P8VQT9_CYNSE/277-427  AC A0A3P8VQT9.1
#=GS A0A3Q7SW86_VULVU/318-473  AC A0A3Q7SW86.1
#=GS A0A3B3QJH8_9TELE/330-457  AC A0A3B3QJH8.1
#=GS A0A401PCP5_SCYTO/364-485  AC A0A401PCP5.1
#=GS H2LD91_ORYLA/248-374      AC H2LD91.2
#=GS A0A2Y9N258_DELLE/391-516  AC A0A2Y9N258.1
#=GS A0A3Q2U8M4_CHICK/365-490  AC A0A3Q2U8M4.1
#=GS M3YQT2_MUSPF/429-571      AC M3YQT2.1
#=GS A0A2K6RDH8_RHIRO/158-277  AC A0A2K6RDH8.1
#=GS A0A3B4GMG4_9CICH/357-480  AC A0A3B4GMG4.1
#=GS A0A2K6JR82_RHIBE/335-487  AC A0A2K6JR82.1
#=GS G3WZ06_SARHA/397-522      AC G3WZ06.1
#=GS M3WXG8_FELCA/314-433      AC M3WXG8.2
#=GS G3WZ07_SARHA/290-415      AC G3WZ07.1
#=GS A0A2K5X0Z4_MACFA/321-473  AC A0A2K5X0Z4.1
#=GS G1SQP6_RABIT/267-386      AC G1SQP6.2
#=GS A0A0R4IX50_DANRE/249-393  AC A0A0R4IX50.2
#=GS A0A2K6JRD7_RHIBE/334-486  AC A0A2K6JRD7.1
#=GS A0A3P9QCP2_POERE/272-400  AC A0A3P9QCP2.1
#=GS A0A3Q3MST6_9LABR/302-445  AC A0A3Q3MST6.1
#=GS H3CPE5_TETNG/309-436      AC H3CPE5.1
#=GS A0A3Q1C0D7_AMPOC/272-398  AC A0A3Q1C0D7.1
#=GS A0A091DVH3_FUKDA/314-432  AC A0A091DVH3.1
#=GS A0A1S3ERD2_DIPOR/391-516  AC A0A1S3ERD2.1
#=GS A0A0D9REW8_CHLSB/158-277  AC A0A0D9REW8.1
#=GS A0A3Q3ABC8_KRYMA/392-514  AC A0A3Q3ABC8.1
#=GS A0A3Q3W3R3_MOLML/238-358  AC A0A3Q3W3R3.1
#=GS A0A2U3W8K3_ODORO/375-500  AC A0A2U3W8K3.1
#=GS A0A2K6T5V0_SAIBB/196-315  AC A0A2K6T5V0.1
#=GS A0A2I4BF38_9TELE/387-500  AC A0A2I4BF38.1
#=GS H3AHG2_LATCH/251-369      AC H3AHG2.1
#=GS A0A1L8F5F4_XENLA/309-415  AC A0A1L8F5F4.1
#=GS A0A3P8ND66_ASTCA/252-407  AC A0A3P8ND66.1
#=GS A0A3L8Q7K3_CHLGU/353-484  AC A0A3L8Q7K3.1
#=GS A0A3Q7W6Q5_URSAR/370-495  AC A0A3Q7W6Q5.1
#=GS A0A1S3LMW3_SALSA/247-365  AC A0A1S3LMW3.1
#=GS A0A384D2S5_URSMA/309-434  AC A0A384D2S5.1
#=GS A0A401PDV1_SCYTO/312-440  AC A0A401PDV1.1
#=GS A0A2K5IBY1_COLAP/323-475  AC A0A2K5IBY1.1
#=GS A0A2D0RW60_ICTPU/251-380  AC A0A2D0RW60.1
#=GS TFEC_MOUSE/196-314        AC Q9WTW4.1
#=GS I3KJ79_ORENI/276-428      AC I3KJ79.1
#=GS A0A2U4AIL8_TURTR/315-434  AC A0A2U4AIL8.1
#=GS A0A340XA22_LIPVE/232-387  AC A0A340XA22.1
#=GS H2V581_TAKRU/226-373      AC H2V581.2
#=GS A0A3Q7X323_URSAR/440-565  AC A0A3Q7X323.1
#=GS A0A096MME4_PAPAN/432-545  AC A0A096MME4.2
#=GS A0A1S3LMV8_SALSA/391-509  AC A0A1S3LMV8.1
#=GS F7DUA0_ORNAN/105-230      AC F7DUA0.1
#=GS A0A402FP47_9SAUR/415-547  AC A0A402FP47.1
#=GS A0A340X2F8_LIPVE/196-315  AC A0A340X2F8.1
#=GS A0A3Q2I593_HORSE/480-605  AC A0A3Q2I593.1
#=GS I3KT53_ORENI/332-484      AC I3KT53.1
#=GS A0A2K5F4E9_AOTNA/432-574  AC A0A2K5F4E9.1
#=GS A0A2I3GFL8_NOMLE/290-415  AC A0A2I3GFL8.1
#=GS A0A2I3M436_PAPAN/290-415  AC A0A2I3M436.1
#=GS A0A3B1IZ96_ASTMX/215-369  AC A0A3B1IZ96.1
#=GS A0A3B3BES9_ORYME/385-508  AC A0A3B3BES9.1
#=GS G5BNI2_HETGA/579-615      AC G5BNI2.1
#=GS A0A2K5ZD31_MANLE/432-574  AC A0A2K5ZD31.1
#=GS A0A3Q1I978_ANATE/268-355  AC A0A3Q1I978.1
#=GS A0A2R8MPG5_CALJA/224-343  AC A0A2R8MPG5.1
#=GS MITF_RAT/397-522          AC O88368.2
#=GS A0A3B3UW21_9TELE/305-440  AC A0A3B3UW21.1
#=GS A0A2K5SBS3_CEBCA/350-502  AC A0A2K5SBS3.1
#=GS A0A1L8GI33_XENLA/370-493  AC A0A1L8GI33.1
#=GS A0A2Y9FND0_PHYMC/391-516  AC A0A2Y9FND0.1
#=GS A0A3Q0E8A5_TARSY/327-469  AC A0A3Q0E8A5.1
#=GS A0A3Q1JF74_ANATE/369-492  AC A0A3Q1JF74.1
#=GS A0A384B6K7_BALAS/225-344  AC A0A384B6K7.1
#=GS G3QJP3_GORGO/320-472      AC G3QJP3.2
#=GS A0A2I4BF40_9TELE/386-499  AC A0A2I4BF40.1
#=GS A0A3B4GMW2_9CICH/303-450  AC A0A3B4GMW2.1
#=GS A0A060WBS2_ONCMY/279-400  AC A0A060WBS2.1
#=GS H2RU81_TAKRU/248-371      AC H2RU81.2
#=GS A0A3Q3W8E4_MOLML/361-486  AC A0A3Q3W8E4.1
#=GS H3ATZ0_LATCH/309-434      AC H3ATZ0.1
#=GS F7C2T4_CALJA/332-484      AC F7C2T4.1
#=GS A0A2D0RXP9_ICTPU/279-408  AC A0A2D0RXP9.1
#=GS A0A091JPP8_EGRGA/259-378  AC A0A091JPP8.1
#=GS G1M398_AILME/304-459      AC G1M398.1
#=GS A0A0J9YJK3_DANRE/170-299  AC A0A0J9YJK3.3
#=GS F7FA62_MONDO/264-383      AC F7FA62.1
#=GS A0A2Y9NZV7_DELLE/225-344  AC A0A2Y9NZV7.1
#=GS A0A3P9N650_POERE/338-519  AC A0A3P9N650.1
#=GS A0A1S3LLL2_SALSA/277-395  AC A0A1S3LLL2.1
#=GS A0A1S3LD38_SALSA/274-419  AC A0A1S3LD38.1
#=GS A0A2D0QYF8_ICTPU/417-560  AC A0A2D0QYF8.1
#=GS A0A2K6KIH3_RHIBE/165-284  AC A0A2K6KIH3.1
#=GS A0A093Q0A4_9PASS/339-464  AC A0A093Q0A4.1
#=GS A0A452GK47_9SAUR/380-498  AC A0A452GK47.1
#=GS A0A3B3QJB8_9TELE/220-334  AC A0A3B3QJB8.1
#=GS A0A384AZM1_BALAS/372-497  AC A0A384AZM1.1
#=GS A0A3Q2CCL1_CYPVA/386-508  AC A0A3Q2CCL1.1
#=GS A0A2I0M9R5_COLLI/311-436  AC A0A2I0M9R5.1
#=GS A0A1U8C191_MESAU/290-415  AC A0A1U8C191.1
#=GS A0A1U8BQQ1_MESAU/381-506  AC A0A1U8BQQ1.1
#=GS A0A2K5SBX6_CEBCA/318-470  AC A0A2K5SBX6.1
#=GS K7G9S5_PELSI/259-378      AC K7G9S5.1
#=GS A0A2U3XC89_LEPWE/225-344  AC A0A2U3XC89.1
#=GS A0A1S3LCQ2_SALSA/306-451  AC A0A1S3LCQ2.1
#=GS A0A340WDQ6_LIPVE/375-500  AC A0A340WDQ6.1
#=GS A0A1S3MG25_SALSA/390-522  AC A0A1S3MG25.1
#=GS A0A3P8XF29_ESOLU/313-453  AC A0A3P8XF29.1
#=GS H3DME4_TETNG/252-368      AC H3DME4.1
#=GS A0A2D0R090_ICTPU/425-568  AC A0A2D0R090.1
#=GS F1SFN4_PIG/360-485        AC F1SFN4.3
#=GS A0A2R9A1Y5_PANPA/397-539  AC A0A2R9A1Y5.1
#=GS D2HNA1_AILME/225-344      AC D2HNA1.1
#=GS A0A2I4BF25_9TELE/387-500  AC A0A2I4BF25.1
#=GS A0A287DDQ2_ICTTR/327-469  AC A0A287DDQ2.1
#=GS A0A3B5QMV3_XIPMA/356-480  AC A0A3B5QMV3.1
#=GS A0A3Q2W9S7_HAPBU/354-483  AC A0A3Q2W9S7.1
#=GS A0A096NU84_PAPAN/196-315  AC A0A096NU84.2
#=GS A0A1L8GPZ9_XENLA/266-389  AC A0A1L8GPZ9.1
#=GS A0A0J9YJ85_DANRE/182-288  AC A0A0J9YJ85.3
#=GS K7G040_PELSI/312-430      AC K7G040.1
#=GS H0Z4F9_TAEGU/257-376      AC H0Z4F9.1
#=GS TFEB_HUMAN/321-473        AC P19484.3
#=GS A0A3P9N819_POERE/209-290  AC A0A3P9N819.1
#=GS A0A2K5ZD08_MANLE/397-539  AC A0A2K5ZD08.1
#=GS F1R1N1_DANRE/312-450      AC F1R1N1.2
#=GS U3C9W3_CALJA/432-574      AC U3C9W3.1
#=GS A0A091WRE9_OPIHO/252-371  AC A0A091WRE9.1
#=GS M7AKC5_CHEMY/226-345      AC M7AKC5.1
#=GS A0A1S3LLZ4_SALSA/390-508  AC A0A1S3LLZ4.1
#=GS H0ZHV0_TAEGU/339-464      AC H0ZHV0.1
#=GS A0A151NDZ6_ALLMI/452-520  AC A0A151NDZ6.1
#=GS A0A1S3MYS0_SALSA/319-463  AC A0A1S3MYS0.1
#=GS A0A2I2YS93_GORGO/432-574  AC A0A2I2YS93.1
#=GS A0A2K6A4X5_MANLE/334-486  AC A0A2K6A4X5.1
#=GS A0A340WJG5_LIPVE/391-516  AC A0A340WJG5.1
#=GS A0A1S3MGL3_SALSA/383-515  AC A0A1S3MGL3.1
#=GS A0A3B3VXJ1_9TELE/244-372  AC A0A3B3VXJ1.1
#=GS A0A087X6N9_POEFO/409-483  AC A0A087X6N9.2
#=GS A0A2I3TF99_PANTR/322-474  AC A0A2I3TF99.1
#=GS A0A3B4GK85_9CICH/386-509  AC A0A3B4GK85.1
#=GS F1MCS8_BOVIN/284-409      AC F1MCS8.1
#=GS F6ZKQ4_HORSE/290-415      AC F6ZKQ4.1
#=GS A0A2U9BH63_SCOMX/293-429  AC A0A2U9BH63.1
#=GS A0A452FLE6_CAPHI/284-408  AC A0A452FLE6.1
#=GS A0A2D0T5J5_ICTPU/269-420  AC A0A2D0T5J5.1
#=GS A0A384D3J5_URSMA/345-470  AC A0A384D3J5.1
#=GS I3MMJ4_ICTTR/397-539      AC I3MMJ4.2
#=GS A0A2K5ZRN0_MANLE/390-515  AC A0A2K5ZRN0.1
#=GS A0A2D0QYG2_ICTPU/421-564  AC A0A2D0QYG2.1
#=GS A0A1U7TSJ2_TARSY/230-382  AC A0A1U7TSJ2.1
#=GS A0A2I3MQL1_PAPAN/390-515  AC A0A2I3MQL1.1
#=GS A0A3B4VBH2_SERDU/386-509  AC A0A3B4VBH2.1
#=GS A0A2R8Q839_DANRE/381-428  AC A0A2R8Q839.1
#=GS A0A2K6JXN7_RHIBE/375-500  AC A0A2K6JXN7.1
#=GS A0A3B5BK74_9TELE/296-422  AC A0A3B5BK74.1
#=GS A0A2I2UHM0_FELCA/290-415  AC A0A2I2UHM0.2
#=GS A0A3B3UST0_9TELE/277-405  AC A0A3B3UST0.1
#=GS A0A3B4TVN6_SERDU/251-419  AC A0A3B4TVN6.1
#=GS A0A2D0T5B1_ICTPU/206-357  AC A0A2D0T5B1.1
#=GS A0A2I3S4B4_PANTR/236-388  AC A0A2I3S4B4.1
#=GS F7FXN6_MACMU/335-487      AC F7FXN6.2
#=GS A0A1S2ZRD7_ERIEU/375-500  AC A0A1S2ZRD7.1
#=GS A0A3B3D2S0_ORYME/386-509  AC A0A3B3D2S0.1
#=GS B1AKB5_HUMAN/179-331      AC B1AKB5.1
#=GS A0A2U9B247_SCOMX/273-390  AC A0A2U9B247.1
#=GS H0X1Z8_OTOGA/327-479      AC H0X1Z8.1
#=GS A0A3B3WXU7_9TELE/356-480  AC A0A3B3WXU7.1
#=GS A0A3B3WZF4_9TELE/330-490  AC A0A3B3WZF4.1
#=GS A0A2Y9FSE4_PHYMC/225-344  AC A0A2Y9FSE4.1
#=GS A0A3Q2I5C5_HORSE/364-519  AC A0A3Q2I5C5.1
#=GS A0A340WTP5_LIPVE/432-574  AC A0A340WTP5.1
#=GS A0A2K5EA43_AOTNA/317-436  AC A0A2K5EA43.1
#=GS A0A2Y9FQE9_PHYMC/375-500  AC A0A2Y9FQE9.1
#=GS A0A3P8VTL4_CYNSE/335-484  AC A0A3P8VTL4.1
#=GS A0A2Y9SA46_PHYMC/458-600  AC A0A2Y9SA46.1
#=GS A0A3Q3WBK2_MOLML/335-484  AC A0A3Q3WBK2.1
#=GS A0A2U3W8L7_ODORO/391-516  AC A0A2U3W8L7.1
#=GS A0A2K6T5W2_SAIBB/158-277  AC A0A2K6T5W2.1
#=GS A0A151MKJ3_ALLMI/396-505  AC A0A151MKJ3.1
#=GS A0A3Q4I8I7_NEOBR/243-369  AC A0A3Q4I8I7.1
#=GS A0A3B3C1R4_ORYME/251-401  AC A0A3B3C1R4.1
#=GS A0A2K5LC64_CERAT/432-574  AC A0A2K5LC64.1
#=GS A0A3P9NBI1_POERE/356-480  AC A0A3P9NBI1.1
#=GS A0A3Q3APF9_KRYMA/252-374  AC A0A3Q3APF9.1
#=GS A0A2K5WMF9_MACFA/381-506  AC A0A2K5WMF9.1
#=GS A0A3P8QQX8_ASTCA/303-450  AC A0A3P8QQX8.1
#=GS A0A452SCY6_URSAM/290-414  AC A0A452SCY6.1
#=GS A0A3Q3B5C0_KRYMA/285-469  AC A0A3Q3B5C0.1
#=GS A0A4D9DZX2_9SAUR/319-459  AC A0A4D9DZX2.1
#=GS A0A3B3U917_9TELE/146-327  AC A0A3B3U917.1
#=GS M3YZV7_MUSPF/391-516      AC M3YZV7.1
#=GS A0A3Q7WS33_URSAR/397-522  AC A0A3Q7WS33.1
#=GS A0A1S2ZRC0_ERIEU/284-409  AC A0A1S2ZRC0.1
#=GS A0A2R8RRI1_DANRE/331-490  AC A0A2R8RRI1.1
#=GS A0A2I2UUF2_FELCA/285-404  AC A0A2I2UUF2.1
#=GS I3KWS2_ORENI/309-456      AC I3KWS2.1
#=GS A0A2I2Y6F0_GORGO/397-539  AC A0A2I2Y6F0.1
#=GS A0A3P8YT87_ESOLU/421-567  AC A0A3P8YT87.1
#=GS A0A2K5RBV2_CEBCA/290-415  AC A0A2K5RBV2.1
#=GS A0A2K5IEL2_COLAP/290-415  AC A0A2K5IEL2.1
#=GS A0A2I4BXE1_9TELE/252-401  AC A0A2I4BXE1.1
#=GS A0A3P9DH70_9CICH/228-382  AC A0A3P9DH70.1
#=GS A0A3B4X6X5_SERLL/276-402  AC A0A3B4X6X5.1
#=GS A0A2K5WMD0_MACFA/366-491  AC A0A2K5WMD0.1
#=GS A0A2I4BF31_9TELE/386-499  AC A0A2I4BF31.1
#=GS A0A2U4C179_TURTR/241-383  AC A0A2U4C179.1
#=GS A0A452SQA9_URSAM/384-564  AC A0A452SQA9.1
#=GS A0A2U3W8K5_ODORO/290-415  AC A0A2U3W8K5.1
#=GS A0A2K5MJV1_CERAT/290-415  AC A0A2K5MJV1.1
#=GS A0A0A0AQZ7_CHAVO/345-484  AC A0A0A0AQZ7.1
#=GS A0A2R9CFP5_PANPA/366-491  AC A0A2R9CFP5.1
#=GS A0A498MFP5_LABRO/814-956  AC A0A498MFP5.1
#=GS A0A1S3FFX9_DIPOR/226-345  AC A0A1S3FFX9.1
#=GS A0A3Q0TCQ7_AMPCI/327-493  AC A0A3Q0TCQ7.1
#=GS A0A087RGR0_APTFO/259-378  AC A0A087RGR0.1
#=GS A0A3B4CRI9_PYGNA/240-387  AC A0A3B4CRI9.1
#=GS A0A3Q7WKC5_URSAR/315-434  AC A0A3Q7WKC5.1
#=GS A0A384D3P4_URSMA/339-464  AC A0A384D3P4.1
#=GS A0A2I3GJ87_NOMLE/390-515  AC A0A2I3GJ87.1
#=GS A0A2I3RP34_PANTR/158-277  AC A0A2I3RP34.1
#=GS H2M3V1_ORYLA/252-401      AC H2M3V1.2
#=GS A0A3Q2DS07_CYPVA/328-509  AC A0A3Q2DS07.1
#=GS A0A3B3DEK3_ORYME/375-488  AC A0A3B3DEK3.1
#=GS A0A455AI20_PHYMC/380-505  AC A0A455AI20.1
#=GS A0A452SCW4_URSAM/373-497  AC A0A452SCW4.1
#=GS A0A3P8VGC7_CYNSE/248-373  AC A0A3P8VGC7.1
#=GS A0A452F9T1_CAPHI/196-315  AC A0A452F9T1.1
#=GS A0A2K5JG66_COLAP/432-574  AC A0A2K5JG66.1
#=GS Q3UKG7_MOUSE/379-531      AC Q3UKG7.1
#=GS F6WH91_ORNAN/229-350      AC F6WH91.1
#=GS A0A096MHP8_POEFO/330-511  AC A0A096MHP8.1
#=GS A0A2Y9QNU1_TRIMA/372-497  AC A0A2Y9QNU1.1
#=GS M3YQ82_MUSPF/320-475      AC M3YQ82.1
#=GS A0A2K5Q0P8_CEBCA/196-315  AC A0A2K5Q0P8.1
#=GS A0A151PEX7_ALLMI/143-262  AC A0A151PEX7.1
#=GS A0A3B1JUD6_ASTMX/425-572  AC A0A3B1JUD6.1
#=GS A0A0D9RKQ6_CHLSB/432-574  AC A0A0D9RKQ6.1
#=GS F7E1U7_HORSE/320-475      AC F7E1U7.2
#=GS L9J913_TUPCH/288-382      AC L9J913.1
#=GS A0A2K6EJZ5_PROCO/319-471  AC A0A2K6EJZ5.1
#=GS W5NG68_LEPOC/315-441      AC W5NG68.1
#=GS A0A2R8Q378_DANRE/353-462  AC A0A2R8Q378.1
#=GS A0A151MKD0_ALLMI/396-517  AC A0A151MKD0.1
#=GS A0A2D0QYQ1_ICTPU/413-556  AC A0A2D0QYQ1.1
#=GS A0A3Q3RWW1_9TELE/327-408  AC A0A3Q3RWW1.1
#=GS A0A3Q2WJV8_HAPBU/358-481  AC A0A3Q2WJV8.1
#=GS H1A498_TAEGU/138-183      AC H1A498.1
#=GS A0A2I4BXD4_9TELE/276-425  AC A0A2I4BXD4.1
#=GS A0A2K6PBJ5_RHIRO/397-539  AC A0A2K6PBJ5.1
#=GS A0A3B3QFI1_9TELE/237-351  AC A0A3B3QFI1.1
#=GS A0A1S3SG07_SALSA/254-399  AC A0A1S3SG07.1
#=GS A0A2K6ALQ3_MACNE/225-344  AC A0A2K6ALQ3.1
#=GS F6S413_CALJA/375-500      AC F6S413.2
#=GS M3ZJ12_XIPMA/272-400      AC M3ZJ12.2
#=GS F7FA74_CALJA/391-516      AC F7FA74.2
#=GS A0A3B4X030_SERLL/252-375  AC A0A3B4X030.1
#=GS U3KG20_FICAL/278-403      AC U3KG20.1
#=GS G1N9V6_MELGA/257-376      AC G1N9V6.2
#=GS A0A2D0PJW7_ICTPU/355-527  AC A0A2D0PJW7.1
#=GS A0A3P9A3Z0_ESOLU/261-407  AC A0A3P9A3Z0.1
#=GS A0A1S3LCV8_SALSA/283-408  AC A0A1S3LCV8.1
#=GS A0A3Q0SYK4_AMPCI/247-373  AC A0A3Q0SYK4.1
#=GS F6R8X8_MONDO/487-555      AC F6R8X8.2
#=GS A0A3B4AQ36_9GOBI/274-396  AC A0A3B4AQ36.1
#=GS A0A2U3Y3Z5_LEPWE/429-570  AC A0A2U3Y3Z5.1
#=GS TFEC_CHICK/255-374        AC Q5XFQ6.1
#=GS A0A0D9RFT9_CHLSB/320-472  AC A0A0D9RFT9.1
#=GS G1SH07_RABIT/397-522      AC G1SH07.1
#=GS F6UXW1_MACMU/290-415      AC F6UXW1.2
#=GS A0A3P8U8Q1_AMPPE/272-398  AC A0A3P8U8Q1.1
#=GS F1Q885_DANRE/381-496      AC F1Q885.2
#=GS A0A2Y9J775_ENHLU/396-521  AC A0A2Y9J775.1
#=GS F1MX26_BOVIN/320-475      AC F1MX26.3
#=GS A0A2U3W8M2_ODORO/284-409  AC A0A2U3W8M2.1
#=GS A0A1D5NZC5_CHICK/353-490  AC A0A1D5NZC5.1
#=GS A0A287D1E0_ICTTR/319-471  AC A0A287D1E0.1
#=GS A0A2D0T5A6_ICTPU/293-444  AC A0A2D0T5A6.1
#=GS A0A286Y3C9_CAVPO/381-506  AC A0A286Y3C9.1
#=GS A0A2I3M228_PAPAN/321-473  AC A0A2I3M228.1
#=GS A0A099Z8L4_TINGU/339-464  AC A0A099Z8L4.1
#=GS A0A2U4CCZ7_TURTR/228-353  AC A0A2U4CCZ7.1
#=GS A0A286XDK3_CAVPO/290-415  AC A0A286XDK3.1
#=GS A0A493TBY9_ANAPP/346-471  AC A0A493TBY9.1
#=GS A0A287CTT0_ICTTR/263-387  AC A0A287CTT0.1
#=GS A0A3B4APL2_9GOBI/269-391  AC A0A3B4APL2.1
#=GS A0A3Q3M635_9LABR/429-611  AC A0A3Q3M635.1
#=GS A0A287BAS8_PIG/192-311    AC A0A287BAS8.1
#=GS A0A3Q7R342_VULVU/284-409  AC A0A3Q7R342.1
#=GS A0A3B4BUW4_PYGNA/301-439  AC A0A3B4BUW4.1
#=GS A0A3Q2C8H9_CYPVA/344-453  AC A0A3Q2C8H9.1
#=GS A0A099YZY9_TINGU/258-377  AC A0A099YZY9.1
#=GS A0A1S3SG09_SALSA/244-389  AC A0A1S3SG09.1
#=GS A0A384AYN5_BALAS/397-522  AC A0A384AYN5.1
#=GS A0A3Q3LEZ8_9TELE/276-429  AC A0A3Q3LEZ8.1
#=GS A0A2K5F4M1_AOTNA/397-539  AC A0A2K5F4M1.1
#=GS A0A3P8Y3V8_ESOLU/317-481  AC A0A3P8Y3V8.1
#=GS A0A2U4CCY7_TURTR/391-516  AC A0A2U4CCY7.1
#=GS A0A3B3CVU7_ORYME/370-514  AC A0A3B3CVU7.1
#=GS I3LP73_PIG/366-491        AC I3LP73.2
#=GS A0A2Y9QMG9_TRIMA/210-329  AC A0A2Y9QMG9.1
#=GS A0A2K6A510_MANLE/335-487  AC A0A2K6A510.1
#=GS A0A3Q0GKJ6_ALLSI/157-276  AC A0A3Q0GKJ6.1
#=GS A0A401TCP5_CHIPU/2-83     AC A0A401TCP5.1
#=GS A0A2R9BVK9_PANPA/335-487  AC A0A2R9BVK9.1
#=GS A0A1S3LLL8_SALSA/362-480  AC A0A1S3LLL8.1
#=GS A0A3Q2WFB4_HAPBU/394-513  AC A0A3Q2WFB4.1
#=GS A0A2Y9NR18_DELLE/227-382  AC A0A2Y9NR18.1
#=GS H2M3V0_ORYLA/251-400      AC H2M3V0.2
#=GS A0A0G2K5U8_RAT/381-506    AC A0A0G2K5U8.1
#=GS A0A3Q4H6R5_NEOBR/387-510  AC A0A3Q4H6R5.1
#=GS A0A3P9P2W5_POERE/252-400  AC A0A3P9P2W5.1
#=GS A0A3Q1CZU0_AMPOC/349-472  AC A0A3Q1CZU0.1
#=GS A0A1S3A5R7_ERIEU/322-477  AC A0A1S3A5R7.1
#=GS G1KP22_ANOCA/291-417      AC G1KP22.1
#=GS A0A2Y9J239_ENHLU/290-415  AC A0A2Y9J239.1
#=GS A0A0Q3MSB2_AMAAE/75-124   AC A0A0Q3MSB2.1
#=GS A0A2K6AJE3_MANLE/158-277  AC A0A2K6AJE3.1
#=GS A0A3Q1MCQ1_BOVIN/375-500  AC A0A3Q1MCQ1.1
#=GS G1NSU4_MYOLU/330-485      AC G1NSU4.1
#=GS A0A2U3V0J3_TURTR/284-409  AC A0A2U3V0J3.1
#=GS A0A1U7TL51_TARSY/315-467  AC A0A1U7TL51.1
#=GS A0A2K6CFN5_MACNE/432-574  AC A0A2K6CFN5.1
#=GS A0A2I4BF20_9TELE/388-501  AC A0A2I4BF20.1
#=GS A0A384C5V7_URSMA/255-395  AC A0A384C5V7.1
#=GS A0A2Y9NG72_DELLE/375-500  AC A0A2Y9NG72.1
#=GS A0A3Q2WFB4_HAPBU/330-406  AC A0A3Q2WFB4.1
#=GS A0A2I3MYK3_PAPAN/375-500  AC A0A2I3MYK3.1
#=GS A0A1V4J957_PATFA/195-314  AC A0A1V4J957.1
#=GS A0A384AYJ4_BALAS/335-460  AC A0A384AYJ4.1
#=GS A0A493SYK3_ANAPP/319-438  AC A0A493SYK3.1
#=GS A0A0A0AC37_CHAVO/339-464  AC A0A0A0AC37.1
#=GS A0A2Y9FQF6_PHYMC/341-466  AC A0A2Y9FQF6.1
#=GS A0A452R665_URSAM/318-473  AC A0A452R665.1
#=GS A0A1L8H6Y2_XENLA/317-432  AC A0A1L8H6Y2.1
#=GS A0A3Q0G279_ALLSI/380-505  AC A0A3Q0G279.1
#=GS A0A3Q0HG50_ALLSI/445-476  AC A0A3Q0HG50.1
#=GS A0A2U3W8L3_ODORO/390-515  AC A0A2U3W8L3.1
#=GS A0A3B4XI65_SERLL/241-408  AC A0A3B4XI65.1
#=GS TFE3_HUMAN/432-574        AC P19532.4
#=GS A0A3P8YCU0_ESOLU/253-399  AC A0A3P8YCU0.1
#=GS I3KWP5_ORENI/273-399      AC I3KWP5.1
#=GS F7BMF4_HORSE/225-344      AC F7BMF4.1
#=GS A0A452FLC8_CAPHI/350-474  AC A0A452FLC8.1
#=GS A0A3Q1D9I8_AMPOC/251-412  AC A0A3Q1D9I8.1
#=GS A0A340X954_LIPVE/158-277  AC A0A340X954.1
#=GS A0A2Y9DLR4_TRIMA/432-572  AC A0A2Y9DLR4.1
#=GS A0A3Q3AGP5_KRYMA/275-401  AC A0A3Q3AGP5.1
#=GS A0A096N6Y8_PAPAN/388-513  AC A0A096N6Y8.2
#=GS A0A384AYP0_BALAS/341-466  AC A0A384AYP0.1
#=GS A0A2K5WMM0_MACFA/290-415  AC A0A2K5WMM0.1
#=GS E7FEM8_DANRE/329-488      AC E7FEM8.1
#=GS A0A2K6CPA0_MACNE/334-486  AC A0A2K6CPA0.1
#=GS A0A1S3MYX3_SALSA/346-490  AC A0A1S3MYX3.1
#=GS A0A3Q0ST48_AMPCI/228-379  AC A0A3Q0ST48.1
#=GS A0A3B4VBK0_SERDU/356-479  AC A0A3B4VBK0.1
#=GS H2U9F8_TAKRU/305-459      AC H2U9F8.2
#=GS A0A2K6ALQ4_MACNE/158-277  AC A0A2K6ALQ4.1
#=GS A0A1S2ZRE1_ERIEU/339-464  AC A0A1S2ZRE1.1
#=GS H2PAA2_PONAB/391-516      AC H2PAA2.2
#=GS A0A3B3QJG8_9TELE/332-459  AC A0A3B3QJG8.1
#=GS A0A3Q2C8H0_CYPVA/364-473  AC A0A3Q2C8H0.1
#=GS A0A3B3DU86_ORYME/353-536  AC A0A3B3DU86.1
#=GS I4EC02_BOVIN/339-464      AC I4EC02.1
#=GS A0A3B3R5V8_9TELE/251-365  AC A0A3B3R5V8.1
#=GS A0A3B3CZR6_ORYME/248-374  AC A0A3B3CZR6.1
#=GS A0A3Q2CCN8_CYPVA/356-478  AC A0A3Q2CCN8.1
#=GS A0A2I3M4I2_PAPAN/236-388  AC A0A2I3M4I2.1
#=GS A0A091E4V7_FUKDA/345-470  AC A0A091E4V7.1
#=GS A0A2K5M018_CERAT/236-388  AC A0A2K5M018.1
#=GS A0A3B3VF37_9TELE/356-480  AC A0A3B3VF37.1
#=GS A0A1D5QF51_MACMU/397-539  AC A0A1D5QF51.1
#=GS A0A2R9C5U0_PANPA/290-415  AC A0A2R9C5U0.1
#=GS A0A2I3MX05_PAPAN/154-273  AC A0A2I3MX05.1
#=GS A0A3B4VBH4_SERDU/359-482  AC A0A3B4VBH4.1
#=GS A0A3B5AVM1_9TELE/381-504  AC A0A3B5AVM1.1
#=GS A0A3P9N848_POERE/253-329  AC A0A3P9N848.1
#=GS I3IWQ3_ORENI/415-543      AC I3IWQ3.1
#=GS A0A218UDM5_9PASE/176-295  AC A0A218UDM5.1
#=GS F6RZV7_XENTR/357-480      AC F6RZV7.1
#=GS A0A2Y9DDU9_TRIMA/391-516  AC A0A2Y9DDU9.1
#=GS A0A3B3WXW3_9TELE/386-510  AC A0A3B3WXW3.1
#=GS A0A1S3MYP6_SALSA/276-420  AC A0A1S3MYP6.1
#=GS U3IXD9_ANAPP/337-456      AC U3IXD9.2
#=GS TFEC_HUMAN/225-344        AC O14948.1
#=GS A0A498LEN3_LABRO/227-398  AC A0A498LEN3.1
#=GS A0A3B4GLB5_9CICH/394-513  AC A0A3B4GLB5.1
#=GS A0A3B4DTJ7_PYGNA/331-515  AC A0A3B4DTJ7.1
#=GS F6WU39_XENTR/289-404      AC F6WU39.1
#=GS A0A286Y0A7_CAVPO/429-571  AC A0A286Y0A7.1
#=GS A0A1S3WBN2_ERIEU/228-353  AC A0A1S3WBN2.1
#=GS G3Q544_GASAC/252-406      AC G3Q544.1
#=GS A0A2K6CPR8_MACNE/290-415  AC A0A2K6CPR8.1
#=GS F7HP56_CALJA/390-515      AC F7HP56.1
#=GS H3CPI2_TETNG/276-399      AC H3CPI2.1
#=GS MITF_HUMAN/397-522        AC O75030.2
#=GS MITF_HUMAN/397-522        DR PDB; 4C7N A; 43-48;
#=GS A0A3Q0G5P8_ALLSI/374-499  AC A0A3Q0G5P8.1
#=GS A0A1L8F5E4_XENLA/410-516  AC A0A1L8F5E4.1
#=GS R7VY95_COLLI/339-464      AC R7VY95.1
#=GS A0A091E0D5_FUKDA/151-301  AC A0A091E0D5.1
#=GS A0A151NBM7_ALLMI/310-452  AC A0A151NBM7.1
#=GS A0A2Y9IYS2_ENHLU/375-500  AC A0A2Y9IYS2.1
#=GS G1PCK6_MYOLU/141-258      AC G1PCK6.1
#=GS A0A3P8VN16_CYNSE/302-451  AC A0A3P8VN16.1
#=GS A0A2K5M007_CERAT/334-486  AC A0A2K5M007.1
#=GS A0A2I3T7T7_PANTR/390-515  AC A0A2I3T7T7.1
#=GS A0A3Q7W7X2_URSAR/429-570  AC A0A3Q7W7X2.1
#=GS A0A3Q2EF89_CYPVA/244-368  AC A0A3Q2EF89.1
#=GS G5BJJ2_HETGA/250-453      AC G5BJJ2.1
#=GS A0A2K6U831_SAIBB/234-386  AC A0A2K6U831.1
#=GS A0A1S2ZRB4_ERIEU/290-415  AC A0A1S2ZRB4.1
#=GS R0KB61_ANAPL/258-377      AC R0KB61.1
#=GS A0A3B3I0H0_ORYLA/382-531  AC A0A3B3I0H0.1
#=GS A0A1U7R0U3_MESAU/431-572  AC A0A1U7R0U3.1
#=GS A0A3Q3BFZ3_KRYMA/252-400  AC A0A3Q3BFZ3.1
#=GS G3S312_GORGO/375-500      AC G3S312.2
#=GS A0A340WL13_LIPVE/284-409  AC A0A340WL13.1
#=GS A0A096M293_POEFO/329-510  AC A0A096M293.1
#=GS A0A3Q1JB46_ANATE/343-456  AC A0A3Q1JB46.1
#=GS A0A226PQ91_COLVI/295-420  AC A0A226PQ91.1
#=GS A0A2K5EA62_AOTNA/158-277  AC A0A2K5EA62.1
#=GS A0A452SD32_URSAM/214-338  AC A0A452SD32.1
#=GS G3U5V9_LOXAF/330-485      AC G3U5V9.1
#=GS E2R7M9_CANLF/315-434      AC E2R7M9.2
#=GS A0A3P8ND63_ASTCA/251-406  AC A0A3P8ND63.1
#=GS A0A2Y9FVG2_TRIMA/397-522  AC A0A2Y9FVG2.1
#=GS A0A2K6GN98_PROCO/290-415  AC A0A2K6GN98.1
#=GS A0A3Q3AM57_CHICK/390-515  AC A0A3Q3AM57.1
#=GS A0A2I3RWW4_PANTR/290-415  AC A0A2I3RWW4.1
#=GS A0A3Q2UV91_HAPBU/348-474  AC A0A3Q2UV91.1
#=GS F6WCA4_MACMU/328-480      AC F6WCA4.2
#=GS G3WFS0_SARHA/326-445      AC G3WFS0.1
#=GS A0A3Q1B6Y6_AMPOC/320-487  AC A0A3Q1B6Y6.1
#=GS G3PDP9_GASAC/276-400      AC G3PDP9.1
#=GS W5PND3_SHEEP/430-572      AC W5PND3.1
#=GS A0A093GVW4_STRCA/259-378  AC A0A093GVW4.1
#=GS A0A2R9A6G5_PANPA/432-574  AC A0A2R9A6G5.1
#=GS A0A3Q3NFL1_9TELE/248-374  AC A0A3Q3NFL1.1
#=GS G1NB70_MELGA/384-509      AC G1NB70.2
#=GS A0A498ND01_LABRO/373-521  AC A0A498ND01.1
#=GS A0A3B3D1K9_ORYME/272-398  AC A0A3B3D1K9.1
#=GS A0A3P9BQX7_9CICH/315-441  AC A0A3P9BQX7.1
#=GS A0A0P7V3S6_SCLFO/339-468  AC A0A0P7V3S6.1
#=GS A0A3P8XJ32_ESOLU/323-463  AC A0A3P8XJ32.1
#=GS A0A2I3HYI0_NOMLE/397-539  AC A0A2I3HYI0.1
#=GS A0A3Q2X3Y3_HAPBU/355-484  AC A0A3Q2X3Y3.1
#=GS A0A3Q3LU27_9TELE/275-428  AC A0A3Q3LU27.1
#=GS A0A218UVT9_9PASE/390-515  AC A0A218UVT9.1
#=GS A0A2R8Z8L4_PANPA/158-277  AC A0A2R8Z8L4.1
#=GS G1M0Z6_AILME/429-570      AC G1M0Z6.1
#=GS A0A2U9BGC5_SCOMX/330-515  AC A0A2U9BGC5.1
#=GS A0A3P8ZGK9_ESOLU/256-381  AC A0A3P8ZGK9.1
#=GS A0A2K6AJD3_MANLE/225-344  AC A0A2K6AJD3.1
#=GS A0A2K6CPU0_MACNE/375-500  AC A0A2K6CPU0.1
#=GS A0A3B3C0Q2_ORYME/252-402  AC A0A3B3C0Q2.1
#=GS M3ZMX0_XIPMA/409-483      AC M3ZMX0.2
#=GS A0A2I3SJV1_PANTR/196-315  AC A0A2I3SJV1.1
#=GS A0A452SQE6_URSAM/351-526  AC A0A452SQE6.1
#=GS A0A2K6JXP2_RHIBE/350-475  AC A0A2K6JXP2.1
#=GS A0A3P9BPZ9_9CICH/343-469  AC A0A3P9BPZ9.1
#=GS A0A3Q3WS11_MOLML/303-452  AC A0A3Q3WS11.1
#=GS A0A3L8Q7A5_CHLGU/316-447  AC A0A3L8Q7A5.1
#=GS A0A3B3QRV6_9TELE/401-560  AC A0A3B3QRV6.1
#=GS A0A3B5B7J9_9TELE/333-516  AC A0A3B5B7J9.1
#=GS M4APX2_XIPMA/369-493      AC M4APX2.2
#=GS A0A1S3SG11_SALSA/233-378  AC A0A1S3SG11.1
#=GS A0A1S3FDY4_DIPOR/321-472  AC A0A1S3FDY4.1
#=GS A0A1S3MYX6_SALSA/252-396  AC A0A1S3MYX6.1
#=GS A0A1D5RIV3_MACMU/158-277  AC A0A1D5RIV3.1
#=GS A0A3P8U2H3_AMPPE/302-449  AC A0A3P8U2H3.1
#=GS A0A1S3MFR0_SALSA/360-492  AC A0A1S3MFR0.1
#=GS A0A1S3MG37_SALSA/391-523  AC A0A1S3MG37.1
#=GS A0A452GK69_9SAUR/339-461  AC A0A452GK69.1
#=GS I3MPL2_ICTTR/179-331      AC I3MPL2.2
#=GS A0A2K5WMY5_MACFA/388-513  AC A0A2K5WMY5.1
#=GS A0A1U8BTW6_MESAU/397-522  AC A0A1U8BTW6.1
#=GS I3KJT4_ORENI/387-510      AC I3KJT4.1
#=GS A0A452GJT9_9SAUR/371-489  AC A0A452GJT9.1
#=GS A0A3B3R600_9TELE/238-352  AC A0A3B3R600.1
#=GS A0A3Q4MP35_NEOBR/356-479  AC A0A3Q4MP35.1
#=GS A0A384DAD1_URSMA/233-352  AC A0A384DAD1.1
#=GS A0A2K6LR71_RHIBE/397-539  AC A0A2K6LR71.1
#=GS A0A1V4K931_PATFA/362-487  AC A0A1V4K931.1
#=GS A0A3Q0T747_AMPCI/317-476  AC A0A3Q0T747.1
#=GS A0A2K5ZRS8_MANLE/388-513  AC A0A2K5ZRS8.1
#=GS A0A2K5QJT2_CEBCA/397-539  AC A0A2K5QJT2.1
#=GS A0A3Q2V1R0_HAPBU/252-405  AC A0A3Q2V1R0.1
#=GS A0A3B4BYC3_PYGNA/390-522  AC A0A3B4BYC3.1
#=GS A0A1S3P2W1_SALSA/286-408  AC A0A1S3P2W1.1
#=GS M3ZZN9_XIPMA/305-439      AC M3ZZN9.2
#=GS TFEC_BOVIN/196-314        AC A4IFU7.1
#=GS Q864F3_CANLF/290-415      AC Q864F3.1
#=GS A0A1S2ZRB0_ERIEU/397-522  AC A0A1S2ZRB0.1
#=GS A0A1S3LDH1_SALSA/358-529  AC A0A1S3LDH1.1
#=GS A0A1S3SG14_SALSA/249-394  AC A0A1S3SG14.1
#=GS A0A2I4BF27_9TELE/386-499  AC A0A2I4BF27.1
#=GS A0A2U3ZJU0_ODORO/381-506  AC A0A2U3ZJU0.1
#=GS A0A2K5IEH1_COLAP/381-506  AC A0A2K5IEH1.1
#=GS U3IWY7_ANAPP/365-490      AC U3IWY7.2
#=GS A0A340XDT8_LIPVE/317-472  AC A0A340XDT8.1
#=GS A0A2Y9FPL9_PHYMC/345-470  AC A0A2Y9FPL9.1
#=GS A0A3Q1HH80_9TELE/302-449  AC A0A3Q1HH80.1
#=GS H2MGI4_ORYLA/365-511      AC H2MGI4.2
#=GS A0A3Q1K765_ANATE/374-487  AC A0A3Q1K765.1
#=GS A0A3P9BYU8_9CICH/252-408  AC A0A3P9BYU8.1
#=GS A0A2K5X0B1_MACFA/335-487  AC A0A2K5X0B1.1
#=GS A0A091CXQ7_FUKDA/431-573  AC A0A091CXQ7.1
#=GS A0A0D9RGQ2_CHLSB/391-516  AC A0A0D9RGQ2.1
#=GS A0A093T1Q9_9PASS/259-378  AC A0A093T1Q9.1
#=GS A0A3P9BUX0_9CICH/303-450  AC A0A3P9BUX0.1
#=GS A0A091VIN9_NIPNI/315-440  AC A0A091VIN9.1
#=GS A0A2D0T5B4_ICTPU/245-396  AC A0A2D0T5B4.1
#=GS A0A1D5P4F2_CHICK/318-437  AC A0A1D5P4F2.3
#=GS A0A3B3BDH2_ORYME/282-405  AC A0A3B3BDH2.1
#=GS A0A2Y9JHV6_ENHLU/234-389  AC A0A2Y9JHV6.1
#=GS A0A3B4EIF5_PYGNA/416-558  AC A0A3B4EIF5.1
#=GS A0A3B4UH05_SERDU/317-431  AC A0A3B4UH05.1
#=GS A0A1S3LCI1_SALSA/367-492  AC A0A1S3LCI1.1
#=GS A0A3Q0GP80_ALLSI/346-488  AC A0A3Q0GP80.1
#=GS A0A2K5IEP4_COLAP/397-522  AC A0A2K5IEP4.1
#=GS G3NGM3_GASAC/335-456      AC G3NGM3.1
#=GS A0A2Y9FEK3_PHYMC/432-574  AC A0A2Y9FEK3.1
#=GS A0A2I4BXG3_9TELE/277-426  AC A0A2I4BXG3.1
#=GS A0A2K5MJT8_CERAT/390-515  AC A0A2K5MJT8.1
#=GS H3ATZ1_LATCH/357-482      AC H3ATZ1.1
#=GS A0A2U4CCZ9_TURTR/341-466  AC A0A2U4CCZ9.1
#=GS A0A0P7VII7_SCLFO/260-388  AC A0A0P7VII7.1
#=GS A0A2U3W8L8_ODORO/228-353  AC A0A2U3W8L8.1
#=GS A0A455AFT7_PHYMC/360-485  AC A0A455AFT7.1
#=GS A0A3Q3EFL7_9LABR/306-457  AC A0A3Q3EFL7.1
#=GS A0A402EH99_9SAUR/258-376  AC A0A402EH99.1
#=GS A0A2Y9FN16_PHYMC/381-506  AC A0A2Y9FN16.1
#=GS A0A2U3ZNL1_ODORO/313-468  AC A0A2U3ZNL1.1
#=GS L9KY47_TUPCH/332-484      AC L9KY47.1
#=GS H2QMX3_PANTR/381-506      AC H2QMX3.2
#=GS A0A2K5EDW0_AOTNA/374-499  AC A0A2K5EDW0.1
#=GS F7E2P9_MACMU/432-574      AC F7E2P9.1
#=GS J9NT96_CANLF/350-475      AC J9NT96.1
#=GS A0A287D994_ICTTR/343-467  AC A0A287D994.1
#=GS A0A2Y9J234_ENHLU/391-516  AC A0A2Y9J234.1
#=GS A0A2K5MJU0_CERAT/381-506  AC A0A2K5MJU0.1
#=GS A0A2Y9JYW2_ENHLU/315-434  AC A0A2Y9JYW2.1
#=GS G3IKG7_CRIGR/146-185      AC G3IKG7.1
#=GS A0A3Q0SNN5_AMPCI/249-400  AC A0A3Q0SNN5.1
#=GS A0A2K6P6R5_RHIRO/390-515  AC A0A2K6P6R5.1
#=GS A0A0P7VLP6_SCLFO/333-474  AC A0A0P7VLP6.1
#=GS A0A091KDI0_EGRGA/339-464  AC A0A091KDI0.1
#=GS A0A2I4APU7_9TELE/348-530  AC A0A2I4APU7.1
#=GS F6T5E1_HORSE/432-574      AC F6T5E1.1
#=GS G1KFM3_ANOCA/193-311      AC G1KFM3.2
#=GS A0A2K6PBB9_RHIRO/432-574  AC A0A2K6PBB9.1
#=GS F1RUY2_PIG/318-473        AC F1RUY2.3
#=GS A0A1S3MG41_SALSA/358-490  AC A0A1S3MG41.1
#=GS A0A2K6CP54_MACNE/236-388  AC A0A2K6CP54.1
#=GS A0A2K5ZRU7_MANLE/290-415  AC A0A2K5ZRU7.1
#=GS F1PC33_CANLF/317-472      AC F1PC33.2
#=GS A0A2I2ZZ24_GORGO/235-387  AC A0A2I2ZZ24.1
#=GS H0VLA3_CAVPO/224-342      AC H0VLA3.1
#=GS A0A1S2ZW25_ERIEU/224-343  AC A0A1S2ZW25.1
#=GS A0A1A6GTJ4_NEOLE/4-129    AC A0A1A6GTJ4.1
#=GS A0A3Q3BHV3_KRYMA/250-398  AC A0A3Q3BHV3.1
#=GS A0A2Y9R941_TRIMA/324-479  AC A0A2Y9R941.1
#=GS W5N2T2_LEPOC/319-485      AC W5N2T2.1
#=GS A0A093G807_DRYPU/259-378  AC A0A093G807.1
#=GS A0A3P8ND57_ASTCA/249-404  AC A0A3P8ND57.1
#=GS F6PGK5_CALJA/233-385      AC F6PGK5.2
#=GS A0A091GL13_9AVES/345-484  AC A0A091GL13.1
#=GS A0A3P8SC09_AMPPE/336-520  AC A0A3P8SC09.1
#=GS A0A1U8C3V3_MESAU/319-469  AC A0A1U8C3V3.1
#=GS A0A3Q2H7T7_HORSE/487-612  AC A0A3Q2H7T7.1
#=GS A0A3B4H0H2_9CICH/389-517  AC A0A3B4H0H2.1
#=GS A0A452F9S1_CAPHI/225-344  AC A0A452F9S1.1
#=GS A0A1V4KX42_PATFA/401-538  AC A0A1V4KX42.1
#=GS F7DV34_MONDO/397-522      AC F7DV34.1
#=GS A0A2Y9JY43_ENHLU/225-344  AC A0A2Y9JY43.1
#=GS A0A2U3W8M0_ODORO/339-464  AC A0A2U3W8M0.1
#=GS A0A401SIU1_CHIPU/367-491  AC A0A401SIU1.1
#=GS A0A3B5B5K3_9TELE/324-450  AC A0A3B5B5K3.1
#=GS A0A2K5IC55_COLAP/236-388  AC A0A2K5IC55.1
#=GS K7G049_PELSI/329-447      AC K7G049.1
#=GS A0A455AHL6_PHYMC/416-541  AC A0A455AHL6.1
#=GS A0A060X9E9_ONCMY/391-523  AC A0A060X9E9.1
#=GS A0A060XNT6_ONCMY/113-273  AC A0A060XNT6.1
#=GS A0A3B5R978_XIPMA/251-399  AC A0A3B5R978.1
#=GS A0A2Y9JY38_ENHLU/286-405  AC A0A2Y9JY38.1
#=GS A0A3L8SCE4_CHLGU/475-600  AC A0A3L8SCE4.1
#=GS A0A3B1JLY2_ASTMX/327-523  AC A0A3B1JLY2.1
#=GS A0A1D5QUV2_MACMU/225-344  AC A0A1D5QUV2.1
#=GS A0A498P5Z4_LABRO/8-133    AC A0A498P5Z4.1
#=GS A0A4D9F0Y1_9SAUR/396-514  AC A0A4D9F0Y1.1
#=GS A0A2I2Y5Q4_GORGO/334-486  AC A0A2I2Y5Q4.1
#=GS A0A091E7V9_CORBR/339-464  AC A0A091E7V9.1
#=GS A0A2K5SBU0_CEBCA/331-483  AC A0A2K5SBU0.1
#=GS G3VKS4_SARHA/420-532      AC G3VKS4.1
#=GS A0A2K6RDG9_RHIRO/196-315  AC A0A2K6RDG9.1
#=GS A0A3Q7VWL5_URSAR/396-521  AC A0A3Q7VWL5.1
#=GS A0A3Q7R569_VULVU/381-506  AC A0A3Q7R569.1
#=GS H2ME84_ORYLA/354-477      AC H2ME84.2
#=GS G1N3A1_MELGA/250-383      AC G1N3A1.2
#=GS A0A3Q3BEN5_KRYMA/304-410  AC A0A3Q3BEN5.1
#=GS A0A3B5KP13_TAKRU/326-503  AC A0A3B5KP13.1
#=GS A0A2Y9K2X7_ENHLU/250-369  AC A0A2Y9K2X7.1
#=GS A0A3P9DLA8_9CICH/358-481  AC A0A3P9DLA8.1
#=GS A0A3Q2I515_HORSE/390-515  AC A0A3Q2I515.1
#=GS A0A3B4FLV4_9CICH/252-405  AC A0A3B4FLV4.1
#=GS A0A091ISK0_CALAN/259-378  AC A0A091ISK0.1
#=GS A0A151MKS6_ALLMI/290-399  AC A0A151MKS6.1
#=GS A0A096M2H9_POEFO/407-481  AC A0A096M2H9.1
#=GS Q9PWC2_DANRE/285-410      AC Q9PWC2.1
#=GS F1RUW6_PIG/292-447        AC F1RUW6.2
#=GS A0A2K5LZY5_CERAT/335-487  AC A0A2K5LZY5.1
#=GS H0VLD5_CAVPO/394-536      AC H0VLD5.2
#=GS G1Q720_MYOLU/431-573      AC G1Q720.1
#=GS A0A3Q1HZA3_ANATE/248-370  AC A0A3Q1HZA3.1
#=GS A0A096NU85_PAPAN/225-344  AC A0A096NU85.2
#=GS A0A1S3FHJ0_DIPOR/225-344  AC A0A1S3FHJ0.1
#=GS A0A340WKU2_LIPVE/290-415  AC A0A340WKU2.1
#=GS A0A2K5ZRR0_MANLE/375-500  AC A0A2K5ZRR0.1
#=GS U3K6B7_FICAL/284-403      AC U3K6B7.1
#=GS A0A2K5X0Y5_MACFA/334-486  AC A0A2K5X0Y5.1
#=GS U3JKB4_FICAL/315-454      AC U3JKB4.1
#=GS A0A3Q1IA37_ANATE/275-419  AC A0A3Q1IA37.1
#=GS A0A3B3R5X3_9TELE/237-351  AC A0A3B3R5X3.1
#=GS G3RXC5_GORGO/396-548      AC G3RXC5.2
#=GS H2U0V2_TAKRU/355-475      AC H2U0V2.2
#=GS A0A2I3G980_NOMLE/158-277  AC A0A2I3G980.1
#=GS A0A1U8CVW0_MESAU/473-614  AC A0A1U8CVW0.1
#=GS A0A3P8QW18_ASTCA/348-474  AC A0A3P8QW18.1
#=GS W5KIZ0_ASTMX/311-452      AC W5KIZ0.2
#=GS G1M3A1_AILME/311-466      AC G1M3A1.1
#=GS A0A2K5V9Z3_MACFA/158-277  AC A0A2K5V9Z3.1
#=GS A0A2U3Z7J0_LEPWE/52-177   AC A0A2U3Z7J0.1
#=GS A0A2K6T440_SAIBB/290-415  AC A0A2K6T440.1
#=GS A0A3Q4HFS1_NEOBR/358-481  AC A0A3Q4HFS1.1
#=GS K7FWC1_PELSI/339-453      AC K7FWC1.1
#=GS A0A3P9QE27_POERE/357-489  AC A0A3P9QE27.1
#=GS A0A3Q2TT68_CHICK/224-343  AC A0A3Q2TT68.1
#=GS A0A2K5LZZ5_CERAT/321-473  AC A0A2K5LZZ5.1
#=GS A0A2U3Y4C3_LEPWE/327-468  AC A0A2U3Y4C3.1
#=GS A0A2D0T5A8_ICTPU/318-469  AC A0A2D0T5A8.1
#=GS F6UXU7_MACMU/375-500      AC F6UXU7.2
#=GS A0A3Q1B2R1_AMPOC/469-579  AC A0A3Q1B2R1.1
#=GS A0A3Q1CWH3_AMPOC/244-370  AC A0A3Q1CWH3.1
#=GS H0VS91_CAVPO/397-522      AC H0VS91.2
#=GS A0A3Q1CG76_AMPOC/318-474  AC A0A3Q1CG76.1
#=GS A0A3Q1JPW1_ANATE/329-512  AC A0A3Q1JPW1.1
#=GS A0A2Y9FNE0_PHYMC/228-353  AC A0A2Y9FNE0.1
#=GS A0A3Q0D489_MESAU/196-314  AC A0A3Q0D489.1
#=GS A0A3Q7S9Z0_VULVU/327-468  AC A0A3Q7S9Z0.1
#=GS A0A3Q3AH24_CHICK/342-479  AC A0A3Q3AH24.1
#=GS A0A452FLK6_CAPHI/375-499  AC A0A452FLK6.1
#=GS A0A340WDR3_LIPVE/339-464  AC A0A340WDR3.1
#=GS A0A2I4CRT2_9TELE/306-450  AC A0A2I4CRT2.1
#=GS G3TRU7_LOXAF/427-567      AC G3TRU7.1
#=GS A0A3B3UD48_9TELE/406-483  AC A0A3B3UD48.1
#=GS A0A455AI17_PHYMC/410-535  AC A0A455AI17.1
#=GS F7C2Z2_CALJA/397-539      AC F7C2Z2.2
#=GS A0A3P8WVZ5_CYNSE/398-522  AC A0A3P8WVZ5.1
#=GS A0A3B3WXV6_9TELE/368-492  AC A0A3B3WXV6.1
#=GS W5NWB4_SHEEP/334-445      AC W5NWB4.1
#=GS A0A452GJU4_9SAUR/352-470  AC A0A452GJU4.1
#=GS A0A3B4BS06_PYGNA/256-384  AC A0A3B4BS06.1
#=GS A0A3P8YVL2_ESOLU/394-525  AC A0A3P8YVL2.1
#=GS A0A2K6KIG0_RHIBE/158-277  AC A0A2K6KIG0.1
#=GS A0A2D0T642_ICTPU/270-421  AC A0A2D0T642.1
#=GS A0A3Q4GPS7_NEOBR/352-480  AC A0A3Q4GPS7.1
#=GS M3XD75_FELCA/376-501      AC M3XD75.2
#=GS L5KRU2_PTEAL/225-344      AC L5KRU2.1
#=GS A0A3Q1CVH3_AMPOC/304-449  AC A0A3Q1CVH3.1
#=GS A0A3B4ANV4_9GOBI/367-489  AC A0A3B4ANV4.1
#=GS A0A3Q1GHQ8_9TELE/383-506  AC A0A3Q1GHQ8.1
#=GS A0A340WN55_LIPVE/327-469  AC A0A340WN55.1
#=GS A0A2I4APU5_9TELE/346-528  AC A0A2I4APU5.1
#=GS A0A3B4CRJ9_PYGNA/280-427  AC A0A3B4CRJ9.1
#=GS TFEB_MOUSE/320-472        AC Q9R210.2
#=GS A0A3B5KJ49_TAKRU/415-541  AC A0A3B5KJ49.1
#=GS A0A452FM93_CAPHI/391-515  AC A0A452FM93.1
#=GS A0A087XPS1_POEFO/309-444  AC A0A087XPS1.2
#=GS G3P7X1_GASAC/314-453      AC G3P7X1.1
#=GS A0A3Q3NP06_9TELE/387-510  AC A0A3Q3NP06.1
#=GS A0A2I2UES6_FELCA/157-276  AC A0A2I2UES6.2
#=GS A0A3Q2HHQ5_HORSE/430-555  AC A0A3Q2HHQ5.1
#=GS W5UDU2_ICTPU/278-407      AC W5UDU2.1
#=GS A0A2K5MJT1_CERAT/372-497  AC A0A2K5MJT1.1
#=GS A0A2K6LR77_RHIBE/432-574  AC A0A2K6LR77.1
#=GS A0A3B3I884_ORYLA/335-458  AC A0A3B3I884.1
#=GS A0A3B3VMK7_9TELE/432-509  AC A0A3B3VMK7.1
#=GS A0A2K5MGZ3_CERAT/158-277  AC A0A2K5MGZ3.1
#=GS A0A3P8TEY6_AMPPE/251-410  AC A0A3P8TEY6.1
#=GS G3W772_SARHA/333-485      AC G3W772.1
#=GS A0A3Q7TDR0_VULVU/225-344  AC A0A3Q7TDR0.1
#=GS A0A2K5SBU5_CEBCA/233-385  AC A0A2K5SBU5.1
#=GS A0A3B3YA37_9TELE/252-404  AC A0A3B3YA37.1
#=GS A0A3B5Q5N0_XIPMA/252-400  AC A0A3B5Q5N0.1
#=GS W5NBS7_LEPOC/437-589      AC W5NBS7.1
#=GS A0A2K6EK02_PROCO/327-479  AC A0A2K6EK02.1
#=GS A0A2K5EA08_AOTNA/196-315  AC A0A2K5EA08.1
#=GS A0A3B4F555_9CICH/243-369  AC A0A3B4F555.1
#=GS A0A3B3R457_9TELE/272-386  AC A0A3B3R457.1
#=GS A0A093FWR9_DRYPU/339-464  AC A0A093FWR9.1
#=GS A0A1A6GK01_NEOLE/319-471  AC A0A1A6GK01.1
#=GS A0A3Q3N7Y4_9TELE/360-483  AC A0A3Q3N7Y4.1
#=GS Q9IAU0_CHICK/256-381      AC Q9IAU0.1
#=GS A0A2K6U7Z4_SAIBB/332-484  AC A0A2K6U7Z4.1
#=GS A0A1U7TH36_TARSY/290-415  AC A0A1U7TH36.1
#=GS A0A2K6GN74_PROCO/397-522  AC A0A2K6GN74.1
#=GS A0A452F9Y3_CAPHI/158-277  AC A0A452F9Y3.1
#=GS A0A3Q0QQ07_AMPCI/356-479  AC A0A3Q0QQ07.1
#=GS A0A151MKB9_ALLMI/390-499  AC A0A151MKB9.1
#=GS A0A2K5RBQ3_CEBCA/390-515  AC A0A2K5RBQ3.1
#=GS G3UUK0_MELGA/256-381      AC G3UUK0.1
#=GS A0A2I3GG15_NOMLE/331-483  AC A0A2I3GG15.1
#=GS A0A3Q2IHR8_HORSE/326-483  AC A0A3Q2IHR8.1
#=GS A0A2I2YDB9_GORGO/323-475  AC A0A2I2YDB9.1
#=GS I3KT52_ORENI/330-513      AC I3KT52.1
#=GS A0A401RTS5_CHIPU/131-260  AC A0A401RTS5.1
#=GS A0A2I0LMJ9_COLLI/157-294  AC A0A2I0LMJ9.1
#=GS H3AEP1_LATCH/381-501      AC H3AEP1.1
#=GS TFE3_MOUSE/431-571        AC Q64092.2
#=GS A0A452GK04_9SAUR/318-440  AC A0A452GK04.1
#=GS H0Y0F7_OTOGA/432-574      AC H0Y0F7.1
#=GS A0A3Q3FKH9_KRYMA/387-509  AC A0A3Q3FKH9.1
#=GS A0A2U3XCB5_LEPWE/196-315  AC A0A2U3XCB5.1
#=GS A0A2Y9JDZ6_ENHLU/319-474  AC A0A2Y9JDZ6.1
#=GS A0A2K5SBU2_CEBCA/332-484  AC A0A2K5SBU2.1
#=GS A0A1S2ZW41_ERIEU/158-277  AC A0A1S2ZW41.1
#=GS G7P2I1_MACFA/225-344      AC G7P2I1.1
#=GS A0A3B5R4G6_XIPMA/289-437  AC A0A3B5R4G6.1
#=GS A0A3Q2DE40_CYPVA/276-400  AC A0A3Q2DE40.1
#=GS A0A1D5R887_MACMU/339-464  AC A0A1D5R887.1
#=GS A0A087RBZ2_APTFO/339-464  AC A0A087RBZ2.1
#=GS A0A1U8C1U8_MESAU/228-353  AC A0A1U8C1U8.1
#=GS A0A384B688_BALAS/158-277  AC A0A384B688.1
#=GS A0A3P8YER7_ESOLU/251-397  AC A0A3P8YER7.1
#=GS A0A091WBC3_OPIHO/339-464  AC A0A091WBC3.1
#=GS A0A2K6T408_SAIBB/381-506  AC A0A2K6T408.1
#=GS A0A1U7QQD1_MESAU/378-528  AC A0A1U7QQD1.1
#=GS A0A2I3TFC5_PANTR/395-547  AC A0A2I3TFC5.1
#=GS A0A2K5RBQ6_CEBCA/397-522  AC A0A2K5RBQ6.1
#=GS A0A498N1Q2_LABRO/373-524  AC A0A498N1Q2.1
#=GS B5X456_SALSA/345-480      AC B5X456.1
#=GS A0A1S3GGI4_DIPOR/432-574  AC A0A1S3GGI4.1
#=GS A0A3Q7X328_URSAR/390-515  AC A0A3Q7X328.1
#=GS A0A3Q7XGM5_URSAR/262-381  AC A0A3Q7XGM5.1
#=GS A0A3Q2LBG1_HORSE/269-388  AC A0A3Q2LBG1.1
#=GS A0A3P8QTW4_ASTCA/271-397  AC A0A3P8QTW4.1
#=GS A0A3B4CTH8_PYGNA/241-388  AC A0A3B4CTH8.1
#=GS R0LNY2_ANAPL/364-489      AC R0LNY2.1
#=GS A0A2U4AI59_TURTR/196-315  AC A0A2U4AI59.1
#=GS A0A3M0JCX1_HIRRU/353-478  AC A0A3M0JCX1.1
#=GS A0A2I3GHW4_NOMLE/233-385  AC A0A2I3GHW4.1
#=GS A0A3Q1GKA7_9TELE/365-488  AC A0A3Q1GKA7.1
#=GS A0A1U7SWQ4_TARSY/284-409  AC A0A1U7SWQ4.1
#=GS A0A1S3MYP2_SALSA/328-472  AC A0A1S3MYP2.1
#=GS A0A3B5BK81_9TELE/244-370  AC A0A3B5BK81.1
#=GS A0A2K5X911_MACFA/397-539  AC A0A2K5X911.1
#=GS A0A401NR04_SCYTO/348-464  AC A0A401NR04.1
#=GS A0A3B4B6P2_9GOBI/328-483  AC A0A3B4B6P2.1
#=GS A0A384AYI9_BALAS/391-516  AC A0A384AYI9.1
#=GS A0A2U9C2R2_SCOMX/455-580  AC A0A2U9C2R2.1
#=GS F6TIG8_ORNAN/319-469      AC F6TIG8.2
#=GS H2ME80_ORYLA/367-490      AC H2ME80.2
#=GS A0A3Q3NDX1_9TELE/302-449  AC A0A3Q3NDX1.1
#=GS A0A2K6R668_RHIRO/335-487  AC A0A2K6R668.1
#=GS A0A3P8TMY9_AMPPE/349-472  AC A0A3P8TMY9.1
#=GS A0A1L8GYW0_XENLA/255-366  AC A0A1L8GYW0.1
#=GS A0A3B4X206_SERLL/248-374  AC A0A3B4X206.1
#=GS A0A3B4XW15_SERLL/319-453  AC A0A3B4XW15.1
#=GS I3LY70_ICTTR/196-315      AC I3LY70.2
#=GS G3R351_GORGO/225-344      AC G3R351.1
#=GS A0A402EJR4_9SAUR/335-477  AC A0A402EJR4.1
#=GS F6W7D6_MOUSE/179-331      AC F6W7D6.1
#=GS A0A2K5WM80_MACFA/390-515  AC A0A2K5WM80.1
#=GS A0A452G230_CAPHI/430-572  AC A0A452G230.1
#=GS H2PJ06_PONAB/426-578      AC H2PJ06.2
#=GS A0A2U3WIF6_ODORO/225-344  AC A0A2U3WIF6.1
#=GS B0QYS6_HUMAN/335-487      AC B0QYS6.1
#=GS A0A3B4T9H3_SERDU/329-510  AC A0A3B4T9H3.1
#=GS A0A3Q0RTE4_AMPCI/237-384  AC A0A3Q0RTE4.1
#=GS A0A0Q3WUL3_AMAAE/315-454  AC A0A0Q3WUL3.1
#=GS A0A384B619_BALAS/196-315  AC A0A384B619.1
#=GS A0A226NL66_CALSU/280-405  AC A0A226NL66.1
#=GS A0A3Q2DKX1_CYPVA/300-447  AC A0A3Q2DKX1.1
#=GS G1TA90_RABIT/432-575      AC G1TA90.1
#=GS A0A2I3SN03_PANTR/366-491  AC A0A2I3SN03.1
#=GS A0A3B4WVH0_SERLL/329-510  AC A0A3B4WVH0.1
#=GS A0A093IYB9_DRYPU/249-414  AC A0A093IYB9.1
#=GS A0A3B3R4C2_9TELE/238-352  AC A0A3B3R4C2.1
#=GS I3M6U9_ICTTR/354-478      AC I3M6U9.2
#=GS A0A2I2Y530_GORGO/196-315  AC A0A2I2Y530.1
#=GS A0A287B431_PIG/391-516    AC A0A287B431.1
#=GS A0A2U4AI38_TURTR/225-344  AC A0A2U4AI38.1
#=GS A0A1S3MG30_SALSA/352-484  AC A0A1S3MG30.1
#=GS A0A2Y9MKB2_DELLE/432-574  AC A0A2Y9MKB2.1
#=GS A0A2I4D0A8_9TELE/382-490  AC A0A2I4D0A8.1
#=GS W5LNJ1_ASTMX/366-500      AC W5LNJ1.2
#=GS A0A3Q2X1U7_HAPBU/369-498  AC A0A3Q2X1U7.1
#=GS A0A2R8Z8K1_PANPA/225-344  AC A0A2R8Z8K1.1
#=GS A0A2R8Z8J6_PANPA/315-434  AC A0A2R8Z8J6.1
#=GS A0A3Q4G502_NEOBR/250-409  AC A0A3Q4G502.1
#=GS A0A452QSM2_URSAM/158-277  AC A0A452QSM2.1
#=GS A0A3Q4I4B7_NEOBR/271-397  AC A0A3Q4I4B7.1
#=GS A0A3B4GLB5_9CICH/330-406  AC A0A3B4GLB5.1
#=GS A0A3B3QUD7_9TELE/363-491  AC A0A3B3QUD7.1
#=GS G1TNA4_RABIT/328-480      AC G1TNA4.1
#=GS A0A384AYL3_BALAS/381-506  AC A0A384AYL3.1
#=GS A0A2K5MGY3_CERAT/225-344  AC A0A2K5MGY3.1
#=GS F6UXQ5_MACMU/390-515      AC F6UXQ5.2
#=GS A0A2D0RW61_ICTPU/280-409  AC A0A2D0RW61.1
#=GS A0A3B3CJ40_ORYME/325-508  AC A0A3B3CJ40.1
#=GS A0A060Y6H8_ONCMY/304-447  AC A0A060Y6H8.1
#=GS A0A3Q7QVJ8_VULVU/429-570  AC A0A3Q7QVJ8.1
#=GS A0A2K5Q0R2_CEBCA/225-344  AC A0A2K5Q0R2.1
#=GS A0A2Y9T6Y9_PHYMC/196-315  AC A0A2Y9T6Y9.1
#=GS A0A1S3MYX4_SALSA/279-423  AC A0A1S3MYX4.1
#=GS G1KB16_ANOCA/316-471      AC G1KB16.1
#=GS F6Y0V4_CANLF/429-570      AC F6Y0V4.1
#=GS A0A3P8QVG5_ASTCA/320-446  AC A0A3P8QVG5.1
#=GS A0A2I2ZPE6_GORGO/390-515  AC A0A2I2ZPE6.1
#=GS A0A3Q0S0J6_AMPCI/307-454  AC A0A3Q0S0J6.1
#=GS F7FDI1_MONDO/270-389      AC F7FDI1.2
#=GS A0A498N5F5_LABRO/346-471  AC A0A498N5F5.1
#=GS A0A3B5Q6U7_XIPMA/244-372  AC A0A3B5Q6U7.1
#=GS A0A093JJ64_STRCA/321-446  AC A0A093JJ64.1
#=GS A0A1V4K929_PATFA/390-515  AC A0A1V4K929.1
#=GS G3N598_GASAC/315-386      AC G3N598.1
#=GS I3LH97_PIG/279-437        AC I3LH97.2
#=GS A0A1S3SG08_SALSA/252-397  AC A0A1S3SG08.1
#=GS A0A493SXR2_ANAPP/337-462  AC A0A493SXR2.1
#=GS A0A1U8CN32_MESAU/326-467  AC A0A1U8CN32.1
#=GS A0A1S3P4H3_SALSA/317-489  AC A0A1S3P4H3.1
#=GS A0A340X334_LIPVE/225-344  AC A0A340X334.1
#=GS A0A3Q2DE18_CYPVA/235-359  AC A0A3Q2DE18.1
#=GS A0A096LQ59_POEFO/325-506  AC A0A096LQ59.1
#=GS A0A3Q1F6I2_9TELE/352-475  AC A0A3Q1F6I2.1
#=GS A0A3P8XF41_ESOLU/300-411  AC A0A3P8XF41.1
#=GS A0A3B4XDL4_SERLL/251-418  AC A0A3B4XDL4.1
#=GS A0A3B5PNX6_XIPMA/387-511  AC A0A3B5PNX6.1
#=GS A0A0R4IU64_DANRE/158-291  AC A0A0R4IU64.1
#=GS A0A383ZZ28_BALAS/432-574  AC A0A383ZZ28.1
#=GS A0A3B3ILR6_ORYLA/338-449  AC A0A3B3ILR6.1
#=GS I3KWP4_ORENI/348-474      AC I3KWP4.1
#=GS A0A3B4A4G0_9GOBI/252-397  AC A0A3B4A4G0.1
#=GS A0A2K6CP35_MACNE/321-473  AC A0A2K6CP35.1
#=GS A0A3B5B6E5_9TELE/305-452  AC A0A3B5B6E5.1
#=GS A0A1U7RIP0_ALLSI/302-427  AC A0A1U7RIP0.1
#=GS A0A2K5JG89_COLAP/397-539  AC A0A2K5JG89.1
#=GS A0A0Q3URF6_AMAAE/488-613  AC A0A0Q3URF6.1
#=GS A0A2K6U7Y4_SAIBB/333-485  AC A0A2K6U7Y4.1
#=GS A0A2K6P6V8_RHIRO/290-415  AC A0A2K6P6V8.1
#=GS A0A3B4UE90_SERDU/248-374  AC A0A3B4UE90.1
#=GS A0A2I3S1P9_PANTR/334-486  AC A0A2I3S1P9.1
#=GS A0A2K6V509_SAIBB/397-539  AC A0A2K6V509.1
#=GS A0A3B3SLL4_9TELE/301-443  AC A0A3B3SLL4.1
#=GS G1QYE3_NOMLE/332-484      AC G1QYE3.3
#=GS A0A1L8EZJ2_XENLA/395-512  AC A0A1L8EZJ2.1
#=GS A0A493TU12_ANAPP/305-424  AC A0A493TU12.1
#=GS A0A1U8D2E2_ALLSI/262-381  AC A0A1U8D2E2.1
#=GS A0A3Q3RWW1_9TELE/396-522  AC A0A3Q3RWW1.1
#=GS A0A3Q7R5Q7_VULVU/375-500  AC A0A3Q7R5Q7.1
A0A1S3SG10_SALSA/239-384             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A2K6EK08_PROCO/370-522             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpgeegpgetl..............................mlgaevpdpeplP--.--.---.---..........................-ALPPQ...APL....................GP...................................................PAQppSP..FH..........HLDFSHSLSF...........AGGDDEGP..pGY.P.E..AL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
F7A3Z7_HORSE/375-500                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...TCT....................TT...................................................L-D..LT..DG..........TISFNNNLGT...........--GTESNQ...AY.S.I..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A2AEW1_MOUSE/431-571                 ..................................................................................................LQAQIHGLP...VP...PN..P..GLlsLT.TS..S.V..S.DSLKPE.....................................................---.--.-QL.DIEeegrps.............ttfhvsgGPAQNA...PPQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegmvg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A1D5QQI9_MACMU/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A384DAD5_URSMA/225-344             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q1MKP6_BOVIN/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
M7BF36_CHEMY/290-408                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..V.V..N.RVIKQE.....................................................PVI.DN.CNQ.DVL..........................QHHSDL...---....................--...................................................---..SC..TT..........TLDLTDGTIT...........--FNDNLG...TY.S.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A2AEW0_MOUSE/396-536                 ..................................................................................................LQAQIHGLP...VP...PN..P..GLlsLT.TS..S.V..S.DSLKPE.....................................................---.--.-QL.DIEeegrps.............ttfhvsgGPAQNA...PPQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegmvg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
G7Q2P5_MACFA/432-574                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q3NID2_9TELE/356-479             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CT.AE..L.G..T.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPQ...HQH....................-H...................................................PAC..TP..EP..........PGSLELNEVH...........SNFQEG--...HY.S.T..HN.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
H2ME82_ORYLA/283-406                 ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RAIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EQp........gTLELNDGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLAPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2K6AJJ3_MANLE/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
F7ADK8_XENTR/167-282                 .................................................................................................r-QAQMHGLP...AS...SP..H..GL..SP.AD..H.-..-.--MKQE.....................................................SNS.IP.SIQ.---..........................---QQL...VAT....................SQ...................................................ASF..QM..DY..........PAPLGYQSNT...........--SVDT--...SF.P.S..-L.-....SR......TELDLM......................LMEDt............mlTSDPLM.aCDPVMST.LS..PD..TSK.A..S.S.RR...S.S.F..S.IDE-v.............
W5NBT1_LEPOC/388-540                 ..................................................................................................MQARLHGLA...TP...AS..S.iGT.ePA.VS..L.L..Q.PQQKQG....................................................gQQL.EP.SSG.DALsasllpassl......gggaalpfpsSYISPP...PST....................SP...................................................GGV..AM..NS..........PHDLG-SLSF...........AELDDSAA...AF.N.S..AL.M....SD......VGLGDI......................LMDDg.............gALSPVG.aADPLLCS.VS..PG..ASK.S..S.S.RR...S.S.F..S.MEED..............
G1RL61_NOMLE/225-344                 ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAVAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1S3MFQ0_SALSA/359-491             ..................................................................................................MQARAHGLT...TD...TS..A..-L..CS.TE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYh........................vH-SQHQ..hHPA....................CT...................................................PDQ..VQ..YT..........TLELNDGASPyt......kghGGVSGDQR...PY.G.G..HL.-....-K......GALMDI......................LMDD...............TLSPVR.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.K..S.MEEN..............
A0A3B5B5V1_9TELE/350-473             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RAIKQE.....................................................PSL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EPp........gALELSEGHSN...........--FPE--G...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2Y9J780_ENHLU/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
G3H9I5_CRIGR/1-110                   ...............................................................................................mla---------...--...--..-..SL..GT.AD..F.S..P.YITKQQ.....................................................--A.HP.EKN.SVGc........................cQQLTPS...---....................--...................................................-QG..TS..PE..........FCEQAVAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLSD...............TICPFG..TDPFLSA.TS..PA..VSK.A..N.S.R-...S.S.F..S.SED-s.............
A0A2R8QFU5_DANRE/386-458             .................................................................................fiqnqllqpnasmqagt---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........-------FSF...........TE-----L..dEH.A.S..DL.Y....PD......VGLSDI......................LMDD...............V---RG..SDVLFSP.MS..PG..ASK.T..S.S.QG...S.S.I..N.MEDD..............
H3AZE9_LATCH/317-456                 ..................................................................................................MQAQAHGLA...TI...SP..A..GI..ST.TE..L.A..R.QIVKQEsase.............................................espsPGF.QP.LPR.---..........................QHQQQQ...PPP....................PA...................................................AAA..AS..QQ..........PLDFTQTLEL...........---CDDAM...GY.Q.D..PL.-....--......AQLDDLayasgs.........kkeldfmLLDD...............MLSPLG..ADPLLSA.MS..PQ..TSK.P..S.S.RR...S.S.F..S.MED-s.............
A0A2I2YQK2_GORGO/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2Y9IZF5_ENHLU/228-353             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A3Q2CER8_CYPVA/241-392             ..................................................................................................IQARAHGLP...NM...AT..S..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.SPP.QAQ..........................QQQQPP..qPPL....................YQedpnsdylqr..............................lavvtgvpsitTAS..GP..QD..........HIQRTDACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3P9N7Z9_POERE/204-285             .....................................................................................qtllspllpnpsl---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..-S..........FMDLDDSHQA...........------SA...VF.S.T..DL.V....AEl....gAGLSDLga..................glLMEE...............DGGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2K6CP29_MACNE/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
G3P7Y0_GASAC/336-475                 ..................................................................................................MQARHHSLS...PD...PS..L..-L..HQ.QQ..-.-..-.---VQHg...................................................gPSL.PQ.GAD.GVSsqnllsmga........sgigqplpaS-----...--Flsp.............pssdSP...................................................AGV..TI..SS..........PLDLG-GLSF...........AELDDDSA...--.-.S..GL.Y....PD......VGLGDF......................LMDEv.............yTLSPER.mAEPLFSP.LS..PG..ASK.G..S.S.RR...S.S.L..E.MDED..............
A0A3Q7R311_VULVU/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...P--....................--...................................................---..-C..TT..........TLDLTDGSITfn......nnlGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2U3ZJV2_ODORO/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2K6JRA5_RHIBE/321-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A401PX63_SCYTO/53-164              ..................................................................................................IQARVHGLS...LS...SP..S..GL..NT.AQ..L.A..A.QVIKQE.....................................................-SQ.PS.QHG.G--..........................ECLQLP...SLT....................QA...................................................AGP..SF..GL..........GLDLG-LLDQ...........PLAFDSMS...DF.P.F..PL.K....LD......SGLGDV......................LMDD...............SLSPVA.aADPLLSS.VS..PG..---.-..-.-.--...-.-.-..-.----ffs...........
A0A3P8WW05_CYNSE/348-472             ..................................................................................................MQARAHGLA...IS...SS..A..-L..CS.SD..L.G..P.RSIKQE.....................................................PTL.DD.CHQ.DLYs.......................yhLHHQHH...PDC....................--...................................................-TP..EP..PG..........ALEPNEGHSN...........----YPES...HY.S.S..AHnK....AG......SKLNDI......................LMED...............TISPVR.gGDPLLSS.VS..PD..TSK.G..S.S.RK...S.S.V..S.MDEN..............
A0A3B3Y0G8_9TELE/311-445             ..................................................................................................MQARLHGLP...AA...QQ..Q..--..QQ.AA..V.A..V.PHAGQNpgaa............................................ttlnlS--.--.---.--Al........................gAIAQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDP--...-T.T.S..AL.Y....PD......VGLGDI......................LMDDg.............cALSPER.mGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
W5NG70_LEPOC/271-397                 ..................................................................................................IQARAHGLP...TM...AS..S..-L..GA.VE..L.S..S.HLMKQP.....................................................-HQ.PQ.QQP.--Y..........................QEELNG...LYV....................QQ...................................................AAG..PP..MP..........GVDHGDGSTTfs......dplSHFTDF--...SF.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.TS..PV..ASK.G..S.S.RR...S.S.F..S.TDDG..............
A0A2Y9NA17_DELLE/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2Y9IYR3_ENHLU/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A3Q3AQZ0_KRYMA/268-410             .......................................................................rasveyikrmqkdvqrsrevennfkrm---------...--...--..-..--..--.-E..M.A..N.KQ---Ll...................................................lRIQ.VT.HPQ.AHH..........................QHQHQH...Q-H....................LP...................................................HNQ..AH..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgelgflMMDE...............PLSPIS..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2Y9N0U2_DELLE/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A337S0Z4_FELCA/386-541             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsdegpgeal..............................lleaevpdpeplPAL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHGLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....sSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q7V753_URSAR/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A1S3GG95_DIPOR/327-469             ..................................................................................................LQAQIHGLP...VP...PT..P..GL..--.LS..L.A..T.TSTSDS.....................................................--L.KP.EQL.DIEeegrssa............atfhvggGPAQSA...VHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsgvALSPLRatSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
F6RM40_MACMU/236-388                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I4BXD1_9TELE/266-415             ..................................................................................................IQARAHGLP...NM...AN..T..-L..GT.VD..L.S..S.HLLKQQ.....................................................QQQ.QQ.QSP.--S..........................QAQQPQ...QPP....................LYqedpnsdylqr.............................iavltgvpsitAVS..GT..QD..........HIQGADAGTTfs......dplSHFTDF--...-F.A.S..TL.K....EE......NQLNEI......................LMDD...............PLSPFG..TDPLLSA.SS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A2K5IEN4_COLAP/388-513             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......snlGAGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3XDU9_9TELE/244-370             ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfn......hmpADAGDS-A...HY.G.-..-S.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..ISN.P.vS.G.RH..sS.S.S..S.MEE-k.............
A0A2Y9FPM5_PHYMC/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1U7TUS0_TARSY/225-344             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.ID..L.G..A.HITKQH.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-L...................................................SQG..PS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2U3V0J9_TURTR/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q4IFF1_NEOBR/303-450             ..................................................................................................MQARLHGLS...NS...NS..I..--..SA.LS..S.D..P.SLLQQQ.....................................................STV.PQ.SSQ.SLApntggas...........nqnllgpaAIGQPL...PASflsp............pssdSP...................................................AGL..TI..SS..........PLDLG-SLSF...........AELDDPPA...--.-.S..VL.Y....SD......MGLGDI......................LMDDg.............cTLSPER.iGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A0P7TZG4_SCLFO/358-542             .................................................................................................t-QARLHGLC...TA...AS..T..-T..SA.PE..-.S..D.RLSQQQ.....................................................QQQ.QQ.QQQ.QXXxxx....................xxqQ-QQQQ...QQQ....................QQhqlagqslgsgssdvlahsllnmagpgigggpvsvhatspsflslatsaspVGV..PI..SS..........PLDLG-SLTF...........AELDNPTS..nTF.D.P..SL.M....SD......MGLGDI......................LMDDg.............cALSPVG.gADPLLSS.VS..PG..ASK.A..S.S.RR...S.S.V..S.MEED..............
A0A3B4C0W6_PYGNA/359-491             ..................................................................................................MQARAHGLA...VA...SS..A..-L..CS.PD..L.S..A.RPIKQE.....................................................PML.GD.CTR.DMY..........................PHQNPH...QTG....................--...................................................PDI..TR..ST..........TLDLTDGTISfs......dghAPTSSDPG...AY.G.V..IS.K....VT.....gAKLDNI......................LMDA..............eTLSPVA.tGDPLLSS.VS..PG..ASK.D..S.S.RK...S.S.I..S.MEE-s.............
A0A1S3A503_ERIEU/394-538             ..................................................................................................LQAQIHGLP...VS...PN..P..GL.lSL.AT.tA.A..S.DSLKPE.....................................................-QL.DV.EEE.GRSggaa.................pfhagGAAGPS...---....................VP...................................................PQQ..GP..VP..........PSDTLLDLHFp.........sDHLGDLGD...PF.H.L..--.-....--......-GLEDIlmeeee..........gavggpLSGD...............ALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K6T3V4_SAIBB/391-516             ..................................................................................................MQARAHGLS...LI...PT..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGAEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3P8WQV8_CYNSE/379-503             ..................................................................................................MQARAHGLA...IS...SS..A..-L..CS.SD..L.G..P.RSIKQE.....................................................PTL.DD.CHQ.DLYs.......................yhLHHQHH...PDC....................--...................................................-TP..EP..PG..........ALEPNEGHSN...........----YPES...HY.S.S..AHnK....AG......SKLNDI......................LMED...............TISPVR.gGDPLLSS.VS..PD..TSK.G..S.S.RK...S.S.V..S.MDEN..............
G3TPP3_LOXAF/397-522                 ..................................................................................................MQARAHGLS...LL...PS..T..GL..CS.PD..V.V..N.RVIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTESNQ...AY.C.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q1HY08_ANATE/302-445             ..................................................................................................MQARLHGLS...TS...IG..V..PS..DP.SL..L.Q..Q.HAVPQS....................................................sQSL.PP.NAG.GAStqnl..................lslgALGQPL...PASflsp............pssdSP...................................................AGV..TL..SS..........PLDLG-SLSF...........AELDDTSA...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cTLSPER.vAEPLFSP.LS..PG..ASK.N..S.S.RR...S.S.L..E.MDED..............
A0A340WGD9_LIPVE/189-314             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K6JRE1_RHIBE/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B4AP91_9GOBI/281-403             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RQIKQE.....................................................PTM.ED.CHQ.DIY..........................-TLHPQ...H--....................-H...................................................QAC..TP..DHp........tSLELSDGHGN...........---YQESS...HY.S.V..HN.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASQ.D..S.S.RK...S.S.V..S.MDEN..............
A0A3P8V1X3_CYNSE/301-484             ..................................................................................................MQAHLHGLP...NT...SP..S..GL..NL.AD..L.M..A.SYIKQEispeeklshpqiqvhhppqqlpq......nqsqplthqhlfmpqnhlqpqshaQ--.--.---.--Pqprh.................lpplpQHLHQQ...PPI....................QL...................................................PTV..GS..SQ..........PFDYAQSMDL...........----CDGI..pGF.S.D..DL.S....GL......AELGGMdgqerr..........sdlgflMMEE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IDDG..............
A0A2K6GN67_PROCO/339-464             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGPGTEGSQ...VY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1U7T3D4_TARSY/228-353             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGSEASQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2D0RW63_ICTPU/253-382             ..................................................................................................MQARAHGLA...VG...GS..S..AL..CS.TE..L.V..A.CAIKEE.....................................................PISyTS.CSS.---..........................-DLYTR...SHL....................SS...................................................PDH..SR..PT..........TLDLNNGTISy........sdSTTEEAET..eLY.A.S..HK.E....SS......TKLDDM......................FLEN...............TLSPVG.tSNLLLSS.GS..PT..HSN.D..S.S.RR...S.S.T..S.TEEQ..............
A0A2I0MJ87_COLLI/318-437             ..................................................................................................IQARAHGLP...IM...SS..L..--..GA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGPTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3P8V3U2_CYNSE/330-513             ..................................................................................................MQAHLHGLP...NT...SP..S..GL..NL.AD..L.M..A.SYIKQEispeeklshpqiqvhhppqqlpq......nqsqplthqhlfmpqnhlqpqshaQ--.--.---.--Pqprh.................lpplpQHLHQQ...PPI....................QL...................................................PTV..GS..SQ..........PFDYAQSMDL...........----CDGI..pGF.S.D..DL.S....GL......AELGGMdgqerr..........sdlgflMMEE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IDDG..............
A0A1S3WBH1_ERIEU/356-481             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1U7TNJ4_TARSY/277-396             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.ID..L.G..A.HITKQH.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-L...................................................SQG..PS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2D0PMK7_ICTPU/324-496             ..................................................................................................MQARMHGLP...ST...SP..S..GL..NN.IE..P.Q..N.QFVKQEnspdelhhqrppph.........................qpphlhsqppqlhpQQL.HP.---.--Qqlh....................pqaSQLPPQ...QPL....................QY...................................................SAV..GS..TQ..........PFNFSHSLDL...........---CDGGM..aGY.A.D..GM.-....--......GCLGDLgsiggtvggt.mvhagkksdmaWMDE...............ALSPLG..TDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IDD-s.............
A0A2K5ETJ9_AOTNA/399-551             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S3SG05_SALSA/257-402             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
F7BRE1_XENTR/253-364                 ..................................................................................................IQARAHGLP...MP...--..-..TL..CT.VE..I.A..S.QVIKQQ.....................................................TYG.ED.MSQ.DF-..........................------...--A....................SQ...................................................LPV..SI..GQ..........TADLCDVSTSfs......dplSHFTDL--...SF.S.A..AL.-....--......---KEQ......................ML-E...............EMSPYG..ADPFLSA.TS..PD..LSK.G..S.S.RR...S.S.F..S.TDDG..............
A0A1S3P2R5_SALSA/304-447             ..................................................................................................MQAQLHGLS...SP..mSP..G..LS..SD.PS..L.L..Q.QQHLQQg...................................................dHKL.GP.SAG.EACsqtfl................slgaaAMAQPV...--Ltssp............pssdSP...................................................VVV..NI..NS..........PLDLG-SVSF...........TELDDP--...-S.N.A..GL.Y....LD......VGLGDI......................IMDEg.............yTLSPER..VDPQF-F.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A2R9BLL0_PANPA/397-549             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDN...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I3SAN6_PANTR/335-487             ..................................................................................................MQARVHGLP...TA...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H0WFM0_OTOGA/376-501                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGPGTEGSQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
G3SRM5_LOXAF/319-474                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.T..Q.QVVKQElpsdegpgeal..............................llgaevpdpeplQAL.PP.QAP.---..........................---PPP...PAQ....................LP...................................................QQQ..SP..FH..........PLDFSHSLSF...........GGGGNEGP..pGY.S.E..AL.G....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2Y9P583_DELLE/196-315             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2Y9FMW2_PHYMC/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I2YXN7_GORGO/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q2HU13_HORSE/338-493             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAP.LPP..........................PAQPPQ...PP-....................--...................................................---..SS..FH..........HLDFSHSLSF...........GDGGDEGP..pGY.P.E..PL.G....PEh....gSLFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
K9L437_ORYLA/276-402                 ..................................................................................................IQARAHGLT...VA...AA..P..SI..CT.SE..L.L..A.RAIKQE.....................................................PIL.GE.CPP.EIY..........................QHC---...---....................SA...................................................PDM..SP..ST..........TMDLNNGIITfd......tipAEPGDS-S...SY.-.-..GI.S....RI......CKMKEM......................VRDK...............SFGPLS.pSKPLLSS.IP..PD..VSN.N..S.S.NHc.sS.N.A..S.MEEK..............
A0A3P8VT10_CYNSE/299-451             ..................................................................................................MQARLHGLP...SS...SS..A..SS..SL.SG..E.A..S.TLLQQAlsrggqafpata............................ggvggkgsssqniL--.--.---.--Tlggvg................qplqaSFLSPP...SSD....................SP...................................................AAV..TI..SS..........PLDLG-SLSF...........AELDDPSA...--.-.S..AL.Y....SS......VSLGDI......................LMGDg.............cTLSPER.eGDPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A3Q3M4E3_9TELE/499-605             .................................................................................................l-QARLHGVT...SS...--..T..-L..ES.QV..L.L..S.PTLPQP.....................................................---.--.-TS.SAL..........................-GLD--...---....................--...................................................--G..LN..FV..........ELDEPRGAST...........IFSPD--L...MS.D.V..GL.T....EL......HGLGDL......................LMEEg............sgQKGGVM..SDPLLSC.G-..--..ASK.T..S.S.QR...S.S.F..S.MDED..............
L5JNG9_PTEAL/289-405                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQE.....................................................--L.PS.EEG.---..........................----PG...EAL....................--...................................................---..--..--..........----FNSLSF...........GVGGDEGP..pGY.P.E..PL.G....PEh....gSMFPNLskkd..............ldlmLLDN...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I2V3G1_FELCA/332-487             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsdegpgeal..............................lleaevpdpeplPAL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHGLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....sSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3P8VMY4_CYNSE/336-485             ..................................................................................................IQARAHGLP...NM...TT..S..-Q..GT.VE..L.T..S.HLLKQQ.....................................................-QQ.QQ.QPQ.QRS..........................-PPQAQ..qPPL....................YQeepnndylqr..............................iaavagmpsipGAG..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....DE......QRLEEI......................LIDE...............ALSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
A0A1S3FGT4_DIPOR/156-275             ..................................................................................................IQARAHGLP...AL...TS..L..--..GM.VG..L.E..A.HLTKQQ.....................................................-SH.PE.QNS.V--..........................DYCQQL...NLF....................--...................................................-QR..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDSL......................LLED...............TISPFG..TDPLLSA.TS..PA..VSK.A..S.S.RR...S.S.F..S.SEDG..............
A0A3B4ANS5_9GOBI/386-508             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RQIKQE.....................................................PTM.ED.CHQ.DIY..........................-TLHPQ...H--....................-H...................................................QAC..TP..DHp........tSLELSDGHGN...........---YQESS...HY.S.V..HN.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASQ.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q3LU36_9TELE/242-395             ..................................................................................................IQARAHGLP...NM...TT..A..-L..GN.IE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQSs........................pQTQQPQ...QPP....................LYqedpnsdylqr.............................iaaaagvstipSAG..GP..QD..........QITGADSCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3Q3G3W3_9LABR/248-373             ..................................................................................................IQARAHGLT...LV...SS..S..SV..CA.TE..L.M..A.RAIKQE.....................................................PLL.SD.CPS.DLY..........................QQ--ST...---....................-T...................................................PDM..SP..PT..........TLDLNNGTITfd......qipADAGDP-G...HY.G.N..--.T....RT......CKMEEL......................VRDN...............TLSPIS.pNDPLFSS.MS..PD..CSN.N..S.S.HH..gS.S.S..G.MEE-n.............
A0A1U7U6Q5_TARSY/158-277             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.ID..L.G..A.HITKQH.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-L...................................................SQG..PS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3B4TWL9_SERDU/252-382             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..T.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQ..........................QQQQQQ..qQQQ....................QQ...................................................QQS..SP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
A0A2I0MJ86_COLLI/194-313             ..................................................................................................IQARAHGLP...IM...SS..L..--..GA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGPTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
F1RW57_PIG/432-574                   ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQSA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A384DB60_URSMA/262-381             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A226NQX8_COLVI/315-452             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEastd............................................egmleP--.--.LLP.TPD..........................PESQPV...--L....................PP...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGSQ...GF.P.D..NL.E....ASh....sSSFPSLskke..............ldlmLLQD...............TMLPLA..SDPLFSA.VS..PE..ASK.A..S.S.RR...S.S.F..S.LED-t.............
A0A3Q3EG63_9LABR/252-403             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.SSP..........................---QPQ...QPI....................QPplyqedpnsdyl..........................qriasvagvhsipSAA..GP..QD..........HIPGADGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.eASK.D..S.S.RR...S.S.F..S.SAED..............
A0A2K6R672_RHIRO/334-486             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2R8P1K6_CALJA/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3GS56_CRIGR/345-470                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPENNP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A3Q2V6Z9_HAPBU/356-479             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A384DAI2_URSMA/260-379             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q1FPE1_9TELE/336-520             ..................................................................................................MQARLHGLP...ST...SP..S..GL..NP.TD..M.M..A.SYIKQEtspednlshpqaqvhhqpqhlhh......nqaqpqaqqhhhylppthlhpqgqA--.--.---.--Qlqprq................lpmapQHLQPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFTQSLDL...........----CDGI..pGF.S.D..NM.-....--......SGLGDLggldvqg........rrselsfLMDE...............ALSPMG.gGDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3Q2EF98_CYPVA/272-396             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DIY..........................QHNCTP...---....................--...................................................-EM..SP..PT..........TLDLNNGTIT..........fDHIPADAG..dSY.G.-..-N.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSH.N.vS.S.RH...SsS.S..S.MDE-k.............
A0A3B3RPA7_9TELE/330-469             ..................................................................................................MQARLHGIP...SN...SP..S..GM..GG.AE..L.L..G.SYVKQEgspeealh.....................................qhppppapHQL.PP.LPG.---..........................-HGLVQ..pPSL....................QY...................................................PPM..GG..PQ..........HFDFAPSLDA...........---CDGGL...NY.P.P..PC.S....GSk....kGQLGFL......................LMD-...............ELSPLG.vGDPLLST.LS..PE..TSV.D..S.S.RR...S.S.F..S.MED-s.............
A0A3Q1F5M9_9TELE/245-371             ..................................................................................................MQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSLAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTISfd......hipAEAGDPG-...PY.G.-..-N.S....RT......CKMKEL......................VRDN...............GLGPVS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MDEK..............
A0A3P9BYG6_9CICH/251-407             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqq.....................sspQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2D0PIF9_ICTPU/352-524             ..................................................................................................MQARMHGLP...ST...SP..S..GL..NN.IE..P.Q..N.QFVKQEnspdelhhqrppph.........................qpphlhsqppqlhpQQL.HP.---.--Qqlh....................pqaSQLPPQ...QPL....................QY...................................................SAV..GS..TQ..........PFNFSHSLDL...........---CDGGM..aGY.A.D..GM.-....--......GCLGDLgsiggtvggt.mvhagkksdmaWMDE...............ALSPLG..TDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IDD-s.............
F6QN42_XENTR/202-317                 .................................................................................................r-QAQMHGLP...AS...SP..H..GL..SP.AD..H.-..-.--MKQE.....................................................SNS.IP.SIQ.---..........................---QQL...VAT....................SQ...................................................ASF..QM..DY..........PAPLGYQSNT...........--SVDT--...SF.P.S..-L.-....SR......TELDLM......................LMEDt............mlTSDPLM.aCDPVMST.LS..PD..TSK.A..S.S.RR...S.S.F..S.IDE-i.............
K7EV11_PONAB/154-296                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K6A4Z6_MANLE/400-552             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5I0Z7_COLAP/157-276             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2K5V9X1_MACFA/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2I4BB22_9TELE/276-402             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QHRCSP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......qipADTGDTD-...PY.G.-..-N.S....RT......CKMKEL......................VRDN...............SLGLIS.pSDPLLTS.MS..PDvsNNI.S..S.S.HS...S.C.S..S.MEEK..............
A0A3P8XGR8_ESOLU/328-453             ..................................................................................................MQARAHGLA...VL...PS..S..SL..CS.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QQSGPN...---....................--...................................................--M..SP..PT..........TLDLNNGTIHf........nnSPLGAGDP..gAY.S.S..-S.K....AS......GKLKDI......................LMDN...............TLSPIS.sNDPLLSS.VS..PD..TSN.S..S.S.RR...S.S.S..SgMEE-n.............
A0A2K6V532_SAIBB/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DS----.....................................................--L.KP.EQL.DIEeegrpga............atfhvagGPAQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q0CRP1_MESAU/345-470             ..................................................................................................MQARAHGLS...LI...PS..S..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPESNP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A3Q1IBR3_ANATE/328-472             ..................................................................................................IQARAHGLT...NM...PT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QS.SPQ.AQQp.......................llYQEDPN...SDYlqriav........vagvpsLP...................................................SAG..GP..QD..........HIAGADGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HQLDKI......................LMED...............PLSPFG..ADPLLSA.TS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2Y9IYR5_ENHLU/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A3Q2X428_HAPBU/303-450             ..................................................................................................MQARLHGLS...NS...NS..V..--..SA.LS..S.D..P.SLLQQQ.....................................................STV.PQ.SSQ.SLApntggas...........nqnllgpaAIGQPL...PASflsp............pssdSP...................................................AGL..TI..SS..........PLDLG-SLSF...........AELDDPPA...--.-.S..AL.Y....SD......MGLGDI......................LMDDg.............cTLSPER.iGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A2I2Z2L0_GORGO/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKRQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAVAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P8NWT9_ASTCA/330-513             ..................................................................................................MQAHLHGLP...SN...SP..S..GL..NT.GD..I.M..G.SYIKQEtsleenhshpqaqahhqhqhlphnq..ahpqaqqhqflshthfhpqgqaqpepR--.--.---.--Qlp.....................pvpQHLQPQ...PPI....................QY...................................................PAV..GS..SQ..........HFDFAQSLDL...........---CD-GI..sGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgdlgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
H0VBE7_CAVPO/179-329                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpgeeapgetl..............................mlgaevpepeplP--.--.---.---..........................-SLPPQ...APL....................PP...................................................PAEppSP..FH..........HLDFSHSLSF...........GDGGDEGP..sGY.P.D..PL.G....PE......HGFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B5B5C3_9TELE/188-302             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.---..........................-QSPPQ...EHI....................--...................................................--A..GA..DA..........CTTFS----Dp.........lSHFTDF--...-F.T.A..TL.K....EE......HPLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3Q1EWS0_9TELE/276-431             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqs......................ppQAQQPQ...QPP....................LYqedpngdylqr.............................iavvtgvpsiaTVS..GP..QD..........HIAGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......HPLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A1S3P4D7_SALSA/314-486             ..................................................................................................MQARLHGLP...SS...SP..S..GM..GS.GE..L.M..G.SYVKQEtspeeklqqqqqaqhqahaq.............gqqhlhhpqshhiqpqqgqpRQL.PP.LPP.---..........................-HLQPQ...LPL....................QY...................................................PAV..GS..SQ..........PFDFAQSLNL...........---CDG-V..pGY.P.E..GL.-....--......SGLGELgllgtqg.......rrgdlgflMMDE...............PLSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IED-t.............
G3TIJ0_LOXAF/137-256                 ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.MD..L.D..A.QVTKQQ.....................................................-TH.PE.QNS.---..........................-VDYCQ...QLT....................-L...................................................SQG..PS..PE..........LCDQVMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDVM......................LLDD...............TVSPFG..TDPLLSA.TS..PT..VSK.E..S.S.RK...S.S.F..S.SDDG..............
A0A3Q0GTS5_ALLSI/310-452             ..................................................................................................MQARIHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEvsrge..........................................dgstepQQR.QP.HPD.---..........................QETQPQ...PSL....................PP...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGPS...GF.H.D..QL.D....PGh....nASFPSLskke..............ldlmLMED...............TMLPLA..SDPLFSA.MS..PE..ASK.T..S.S.RR...S.S.F..S.MED-t.............
A0A1L8GU88_XENLA/188-301             ..............................................................................................iqvs---RAHGLP...MP...--..-..TL..CT.VE..I.A..S.QVIKQQ.....................................................-TY.GD.DMS.LDY..........................------...--A....................SQ...................................................LPV..SI..GQ..........TTDLCDVSTSfs......dplSHFTDL--...SF.S.A..AL.-....--......---KEQ......................ML-E...............EMSPYG..ADPFLSA.TS..PD..LSKgS..S.S.RR...S.S.F..S.TDDG..............
A0A1S3P2L8_SALSA/279-401             ..................................................................................................MQARAHGLA...VV...PS..P..SL..CS.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QKSGPD...---....................--...................................................--M..SP..TT..........TLDLNNGTIHf........ndSPLDAGEP..gAY.G.-..SN.K....AS......TKLKDI......................-IDN...............TLSPIS..--SLLSS.VS..PD..ASN.S..SsS.RR...S.SsS..S.MEE-n.............
A0A3B4XXA3_SERLL/252-419             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..T.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqqqqqq.............qqqqsspQ-----...---....................-Ahqaqqpqqpplyqedps.................sdylqrlavvagvpsipTAS..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
A0A2K6R655_RHIRO/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A226MVW0_CALSU/244-362             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..S.QVIKQQ.....................................................-SY.PE.NSV.E-Y..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..PSK.E..S.S.RR...S.S.F..S.TDDG..............
A0A1S3P2P2_SALSA/287-409             ..................................................................................................MQARAHGLA...VV...PS..P..SL..CS.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QKSGPD...---....................--...................................................--M..SP..TT..........TLDLNNGTIHf........ndSPLDAGEP..gAY.G.-..SN.K....AS......TKLKDI......................-IDN...............TLSPIS..--SLLSS.VS..PD..ASN.S..SsS.RR...S.SsS..S.MEE-n.............
A0A1S3SG12_SALSA/177-322             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
G1NY73_MYOLU/375-500                 ..................................................................................................MQARAHGLS...LL...PS..S..GL..CS.AD..L.V..N.RIIKQE.....................................................PSL.EN.CSQ.---..........................-DLPPR...---....................-H...................................................ADL..TC..TS..........TLDLTDGTISfs......sslGAGTEGSQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-p.............
A0A3Q7SG80_VULVU/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...P--....................--...................................................---..-C..TT..........TLDLTDGSITfn......nnlGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1U8BQC9_MESAU/391-516             ..................................................................................................MQARAHGLS...LI...PS..S..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPESNP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A3P8ZFG8_ESOLU/283-408             ..................................................................................................MQARAHGLA...VL...PS..S..SL..CS.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QQSGPN...---....................--...................................................--M..SP..PT..........TLDLNNGTIHf........nnSPLGAGDP..gAY.S.S..-S.K....AS......GKLKDI......................LMDN...............TLSPIS.sNDPLLSS.VS..PD..TSN.S..S.S.RR...S.S.S..SgMEE-n.............
A0A3P9ASQ4_9CICH/330-513             ..................................................................................................MQAHLHGLP...SN...SP..S..GL..NT.GD..I.M..G.SYIKQEtsleenhshpqaqahhqhqhlphnq..ahpqaqqhqflshthfhpqgqaqpepR--.--.---.--Qlp.....................pvpQHLQPQ...PPI....................QY...................................................PAV..GS..SQ..........HFDFAQSLDL...........---CD-GI..sGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgdlgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
F7ENZ1_XENTR/309-432                 ..................................................................................................MQARAHGLS...IM...PS..T..GL..CS.TD..L.V..N.RVIKQE.....................................................PML.DS.CNQ.EIL..........................SNHHDL...---....................--...................................................---..SG..TT..........TLDLTDGTITfs......nnlRNMTDSPT...AY.S.I..PT.K....LG......SKLEDM......................FMDD...............TLSPRV..NDP-HHT.IS..PG..ASR.T..N.S.RR...S.S.I..S.MEEN..............
A0A3P8WW10_CYNSE/449-573             ..................................................................................................MQARAHGLA...IS...SS..A..-L..CS.SD..L.G..P.RSIKQE.....................................................PTL.DD.CHQ.DLYs.......................yhLHHQHH...PDC....................--...................................................-TP..EP..PG..........ALEPNEGHSN...........----YPES...HY.S.S..AHnK....AG......SKLNDI......................LMED...............TISPVR.gGDPLLSS.VS..PD..TSK.G..S.S.RK...S.S.V..S.MDEN..............
A0A3L8SQC0_CHLGU/146-265             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.---..........................-VDYSQ...QMT....................--...................................................--L..VH..GQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLED...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A2K5EA47_AOTNA/225-344             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QTS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLHD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A2I3MZP5_PAPAN/366-491             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3URR7_MELGA/284-409                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A3Q7W6Q0_URSAR/434-559             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2K5IEY8_COLAP/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......snlGAGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A384BE32_BALAS/320-475             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpreal..............................llgaevpdpeplPAL.PA.QAQ.---..........................-LPPPA...QPA....................Q-...................................................-PP..SP..FH..........HLDFSHSLSF...........GGGGNEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5I152_COLAP/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2U4CCZ3_TURTR/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3IKI2_ORYLA/253-402             ..................................................................................................IQARAHGLP...NM...TT..A..-L..GT.VE..L.S..N.HLLKQP.....................................................QQQ.QQ.QSP.--P..........................QAPQPQ...QAT....................LYqedpnndylqr.............................iaavtaipsitAAG..PT..QD..........HISGGDACTTfs......dplSHFTDF--...-F.T.A..SL.K....EE......NQLDEI......................LMDE...............ALSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SGE-g.............
A0A3P8PSN0_ASTCA/389-517             ..................................................................................................LQACVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................spPLL.HP.FSS.---..........................----SS...SPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DEPQGAAT...VF.S.P..DL.M....SD......MGLTDLngl................gglLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3Q4G505_NEOBR/239-398             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQhqqq..................qsspQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A091F945_CORBR/259-378             ..................................................................................................IQARAHGLP...IM...SS..L..--..TA.VD..S.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................VHG..QN..SD..........VCDGSTGFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QCLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A060XBH9_ONCMY/392-510             ..................................................................................................MQARAHGLT...TD...SS..A..-L..CS.AE..L.S..A.RGIKQE.....................................................PAL.GD.FHQ.DLY..........................-PVDPQ...HQH....................--...................................................---..HP..AC..........TPDQVQSTTL...........-ELNDEAS...PY.T.E..GH.-....-G......GISGEL......................RMED...............TLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.I..S.MEEN..............
A0A2D0R0Y3_ICTPU/320-463             ..................................................................................................MQARLHGLV...PS...QV..S..D-..SI.VN..H.H..H.QQQQQQ.....................................................QQL.TS.VQH.TAEpvtttlltlg......gptlnhthvsSLLSPP...PSA....................SP...................................................VGG..AM..NV..........PLDLG-TLTF...........GELDDHAS..sIF.S.P..GL.M....AG.....eMGLSDI......................LMDD...............G----G..ADPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A3B3Y9E2_9TELE/251-403             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQS.PPQ.........................vQQQQPQ..qPPI....................YQedpnsdylqr..............................iavvtgvpsiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
I3NH56_ICTTR/351-475                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHQAEL...---....................--...................................................-AC..TS..LD..........LTDGTLAFSSs.........lGPTAEGAQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPAG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
Q8R2J8_MESAU/284-409                 ..................................................................................................MQARAHGLS...LI...PS..S..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPESNP...AY.G.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A091GGY0_9AVES/259-371             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..T.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.A.--...-.-.-..-.----las...........
G3UPF9_MELGA/339-464                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A1S3MYS4_SALSA/266-410             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A2K6V520_SAIBB/481-623             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DS----.....................................................--L.KP.EQL.DIEeegrpga............atfhvagGPAQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3B4A119_9GOBI/246-356             ..................................................................................................IQARAHGLT...LV...PT..P..SV..CT.SE..L.V..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................HHSSSP...---....................--...................................................-DM..SP..PT..........TLDLNNGTISf........drA------P...SA.D.A..GE.S....SM......YRSPRS......................CKQK...............DHCPSP..RTPLRSP.MS..PE..HNQ.H..G.S.--...-.-.-..-.----ta............
A0A3P8YUK1_ESOLU/434-580             ..................................................................................................MQARLHGIS...TP...AS..S..SL..GS.SS..-.S..H.LSISQS.....................................................--M.DP.STG.DVLsktllslgg........gsglqaassFMSPPP...SAS....................PV...................................................GLM..NM..AS..........PLDLD-SLSF...........SELDDPST..rAF.H.S..SL.L....PD......MGLGDI......................LMDDa............gmGMSPVG.gHDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A2K6A501_MANLE/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3P8VWF2_CYNSE/270-420             ..................................................................................................IQARAHGLP...NM...TT..S..-Q..GT.VE..L.T..S.HLLKQQ.....................................................-QQ.QQ.QPQ.QQR..........................SPPQAQ...QPP...................lYQeepnndylqr..............................iaavagmpsipGAG..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....DE......QRLEEI......................LIDE...............ALSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
F7DUX6_MONDO/158-277                 ..................................................................................................IQARAHGLP...VL...SS..H..--..SA.ID..L.A..A.HTTNHQ.....................................................TYV.ED.NSV.DYS..........................-----Q...---....................-E...................................................LTL..AP..RS..........RIDLCDGSTAfs......yplSHFTDL--...SF.S.A..AL.K....EE......QRLDDI......................LLDD...............SISPFG..TDPLLSA.TS..PT..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1S3WBL3_ERIEU/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
U3KG16_FICAL/419-544                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CSQ.DMM..........................PHHTDL...---....................--...................................................---..SC..TT..........TLDLTDGTISfs......dslGNVTDPAG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A0Q3PJ16_AMAAE/276-394             ..................................................................................................IQARAHGLP...VI...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQHMPL...---....................--...................................................-AH..EQ..NS..........DCDGPTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A2R9C597_PANPA/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3M0JWL1_HIRRU/315-454             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEasgd............................................egtpePLL.PS.LDP.---..........................-ESQPQ...PAP....................PA...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGSQ...GF.P.D..GL.E....PGh....sASFPSLskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A1S3LLK7_SALSA/392-510             ..................................................................................................MQARAHGLT...TD...SS..D..-L..CS.AE..L.S..A.RGIKQE.....................................................PAL.GD.FHQ.DLY..........................-PVDPQ...HQH....................--...................................................---..HP..AC..........TPDQVQSTTL...........-ELNDETS...PY.T.E..GH.-....-G......GFSGEL......................RMDD...............TLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.I..S.MEEN..............
H2PN98_PONAB/225-344                 ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
W5PJC4_SHEEP/391-516                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K6P6Q8_RHIRO/388-513             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3QJ74_9TELE/301-415             ..................................................................................................MQARAHGLA...LV...SP..T..AL..CP.SE..L.A..G.RVIKQE.....................................................PVL.GD.CLR.DPY..........................PH--PH...---....................HA...................................................SDM..SR..PT..........TLDLTDGTITy........sdGHGEPGES..aPY.T.R..PT.K....GA......SKLDDI......................LMDG...............SLSPVR.aGDPLLSS.SS..PG..---.-..-.-.--...-.-.-..-.----hac...........
A9UJR8_HAPBU/271-397                 ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpADAGEP-G...PY.G.S..S-.-....SA......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3Q2V1Z7_HAPBU/251-404             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQSs........................pQAQQPQ...QPTlyqed.........inndylQRiaaas........................................gvqstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2R8RZ90_DANRE/306-419             ..................................................................................................IQARHHGLN...AT...VS..P..GL..NT.EPnaS.M..Q.AAMAQT.....................................................---.SP.SPF.--L..........................SV-PP-...-SG....................SP...................................................AAV..AV..SG..........PLHLE-TFSF...........TELDEH--...--.A.S..DL.Y....PD......VGLSDI......................LMDD...............V---RG..SDVLFSP.MS..PG..ASK.T..S.S.QG...S.S.I..N.MEDD..............
A0A1V4JSV0_PATFA/170-248             ...................................................................pgdppftpgdpptpqclldlalgedlspglg---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..-L.S....LG......GALDDI......................LMDEg.............gPLSPLS.pPGALLA-.-S..PG..PSR.A..S.S.PR...S.S.L..S.MEDD..............
H2MMD1_ORYLA/387-508                 .......................................................................................hympqthlhpq---------...--...--..-..--..--.--..-.-..D.HMQPQT.....................................................RQL.PP.LPP.---..........................-HLQPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..pGF.S.D..GM.-....--......PGLGDLsgldvqm.......rrgdmgllMMDE...............PLSPMV..GDPLLSA.MS..PE..ASI.D..S.S.RR...S.S.F..G.IDDE..............
A0A3B3YQA6_9TELE/266-392             ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfn......hmpADAGDS-A...HY.G.-..-S.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..ISN.P.vS.G.RH..sS.S.S..S.MEE-k.............
A0A1S3LCI7_SALSA/222-347             ..................................................................................................MQARAHGLA...IL...PS..S..SL..CS.SE..L.I..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QQPGPD...--M....................--...................................................---..SP..PT..........TLDLNNGTIHf........ndSPLDAGDP..gVY.G.-..SS.K....AS......TKLKDI......................LMDN...............TLSPIS.sNDPLLSS.AS..PD..TSN.S..S.S.RR...S.S.S..SsMEE-n.............
A0A3Q2HDJ1_HORSE/315-434             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.QVTKQQ.....................................................THL.EQ.NSV.DYC..........................QQLT--...--I....................--...................................................SQG..TS..PE..........LSDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P8ZI65_ESOLU/251-391             ..................................................................................................MQARFHGLS...SS...MS..S..GL.cSD.PS..L.Q..Q.HVHQGG.....................................................PTL.GP.SAE.DQNlls...................lqaaAMAQPV...PTSflsp............ptsnSP...................................................VGV..PV..NS..........TLDLG-SLSF...........AELDETS-...--.N.A..GL.Y....TE......VGLGDI......................LMDEs.............cTLSPER..VGPLFS-.MS..PG..ASK.N..S.S.CR...S.S.F..S.MEED..............
A0A2Y9N0U7_DELLE/345-470             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3NGM0_GASAC/368-489                 ..................................................................................................MQARAHGLV...IA...PP..A..-L..CS.AE..L.C..A.RPIKQE.....................................................TAL.DD.CRS.ELY..........................ALHQHH...PAC....................TP...................................................EPP..GA..P-..........--ELSEGHGD...........--FSA-EG...HY.G.V..HV.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.IS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
W5PJC8_SHEEP/375-500                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I3M2E5_PAPAN/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A096NI31_PAPAN/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAT.LPL..........................-PTQ--...---....................--...................................................-PP..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PQh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K6P6Q6_RHIRO/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3QUC7_9TELE/394-522             ..................................................................................................MQARAHGLA...VV...AP..T..AL..CS.PE..L.A..N.RAIKQE.....................................................AVR.GD.CSQ.DLY..........................-HQQRH...AAS....................KP...................................................PGP..T-..--..........TLDLSDGTISf........snGPPTQGEP..sVY.S.I..AT.K....GS......SKLDSM......................LMDE...............AVSPAG.vEDPLLCC.VS..PG..VSK.D..N.S.RE...N.S.M..S.MEEN..............
A0A2U4AI54_TURTR/158-277             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2K6U7U6_SAIBB/319-471             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A091G7D9_9AVES/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEAAG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
G1MFG8_AILME/397-522                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-a.............
A0A2I3HSZ4_NOMLE/388-513             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................---QRH...---....................--...................................................ADL..TC..TT..........TLDLTDGTITfs......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVA.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A060WS80_ONCMY/367-488             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ....................................................kQQQ.QP.LAP.---..........................---QSL...QAM....................V-...................................................TGA..TD..QG..........QGVVDDSTTFsd.......plSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
H0X1V5_OTOGA/136-255                 ..................................................................................................IQARAHGLP...PL...AS..L..--..GT.ID..L.G..A.DVTKQQ.....................................................SHR.EQ.NSV.---..........................--DYCQ...-LL....................TL...................................................PQG..PS..LE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.IS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q0CS06_MESAU/341-466             ..................................................................................................MQARAHGLS...LI...PS..S..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPESNP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A1S2ZRB8_ERIEU/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q1J997_ANATE/387-510             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..N.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EP..........HGTLELSEDH...........SNFPEG--...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2R9BLL6_PANPA/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDN...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B3Y9V8_9TELE/218-370             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQS.PPQ.........................vQQQQPQ..qPPI....................YQedpnsdylqr..............................iavvtgvpsiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A2U3VP30_ODORO/327-468             ..................................................................................................LQAQIHGLP...VP...PS..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtap.................fpaagGSAQSA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeeggv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
B0QYS7_HUMAN/407-559                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A452EM33_CAPHI/320-475             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAP.LPP..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHNLSF...........GGGGNEGP..pGY.P.E..PL.G....PEh....aSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
D3ZAW6_RAT/431-572                   ..................................................................................................LQAQIHGLP...VP...PN..P..GL..--.LS..L.A..T.SSVSDS.....................................................--L.KP.EQL.DIEeegrpst............ttfhvsgGPTQNA...PPQ....................QP...................................................PAP..PS..DT..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegmvg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.S..S.S.RR...S.S.F..S.MEDE..............
K7FFG4_PELSI/271-333                 ....................................................................................sgrgapaapgglgr---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..-L.G....AD......RGLEDI......................LMEDg.............gPLSPLG.aSDPLLSS.LS..PG..ASK.G..S.S.RR...S.S.F..S.MEE-..............
A0A3B3HNN5_ORYLA/384-507             ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RAIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EQp........gTLELNDGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLAPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q7REU2_VULVU/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...P--....................--...................................................---..-C..TT..........TLDLTDGSITfn......nnlGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3P9DK28_9CICH/356-479             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A087XLL3_POEFO/266-394             ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfn......hmpADAGDS-A...HY.G.-..-S.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSN.P.vS.G.RHsssS.S.S..S.MEE-k.............
A0A2K5IBV5_COLAP/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2R8N2I1_CALJA/195-314             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........NPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A3Q3M1Z1_9LABR/357-480             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RTIKQE.....................................................TAL.ED.CHQ.DLY..........................-TLHPH...HQH...................hPA...................................................CTP..EP..PG..........TLDLNEGHSN...........--FPE--G...HY.S.V..HG.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
F7GCE6_MONDO/329-483                 ..................................................................................................MQARVHGLP...TA...SP..S..GV..NM.AE..L.A..Q.QVVKQElpseegl.......................................gepllptAEL.PD.QEP.SLTl.......................ppQPPPPP...PPP....................PL...................................................PPP..QS..PY..........QLDFSHNMSF...........-GGGEGPQ...GF.P.D..SL.G....PEh....gSLFPSLskke.............ldhlmLLDD...............TMLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K6ALP0_MACNE/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
H2SM24_TAKRU/347-517                 ......................................................ilkasvdyirklqkeqqrvremeerqrklenanhslllriqeleLQSRLHTAA...APl.pAS..T..SS..SS.SS..L.D..P.QVLLSP.....................................................-HL.PQ.PFS.---..........................-SSSPS...SS-....................SS...................................................SLV..TP..SL..........GLDALSFVEL...........EEPQRTST...VF.S.S..DL.M....SDvgltglHSLGDI......................LMEE...............VGRGAG..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2K6RDG6_RHIRO/315-434             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLTv.................sqGP...................................................APE..LC..DQ..........AIAFSDPLSY...........--FTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A498LRF0_LABRO/403-540             ..................................................................................................MQARLHGIS...SS...QI..-..--..SD.AA..L.T..Q.TQTLTLdhnpsa.........................................dlsktlLSL.NQ.TT-.--P.........................sTFLSPP...SST....................SS...................................................VGG..TV..TS..........PLDLG-TLSF...........SELDDPAA..sVF.N.P..AL.M....AD......MGLGDI......................LMDDs.............gALSPVG.gADPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A402F426_9SAUR/230-356             ..................................................................................................MQARAHGLS...II...PS..T..GL..CS.PE..M.V..N.RIIKQE.....................................................PVL.DN.CSQ.EVL..........................QHHPDL...SCT....................T-...................................................TLD..LT..DG..........TIRFNDSLAN...........--ATEAAA..gTY.T.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.V..S.MED-t.............
A0A3P9A371_ESOLU/327-473             ..................................................................................................IQALAHGLP...NM...AT..S..-L..GT.VE..L.S..S.HLLKQQ.....................................................-QQ.QH.QPQ.ASQp.......................eeTQKGPQ...PPM....................YQeevngeyl..................................qrtsmpamaPGA..TE..QG..........PGAVDGSTTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMED...............PLSPFA..TDPLLSA.GS..PA..TSK.D..S.S.QR...S.S.F..S.SDDE..............
F1ML66_BOVIN/196-314                 ..................................................................................................IQARAHGLP...TL...AS..L..--..VT.VD..L.G..A.HITKQT.....................................................-HL.EQ.NSG.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDNM......................LLDD...............TVSPFG..TDPLLSA.IS..PA..VSK.E..S.S.RR...S.S.F..S.SEDG..............
A0A091V5V3_NIPNI/259-378             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3Q7WED9_URSAR/318-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................lleaevpdpeplPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGEEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B3QIY7_9TELE/332-446             ..................................................................................................MQARAHGLA...LV...SP..T..AL..CP.SE..L.A..G.RVIKQE.....................................................PVL.GD.CLR.DPY..........................PH--PH...---....................HA...................................................SDM..SR..PT..........TLDLTDGTITy........sdGHGEPGES..aPY.T.R..PT.K....GA......SKLDDI......................LMDG...............SLSPVR.aGDPLLSS.SS..PG..---.-..-.-.--...-.-.-..-.----hac...........
A0A2U3ZP33_ODORO/312-431             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..V.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3B3VVT7_9TELE/251-400             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................-QQ.QQ.SPP.QVQ..........................-QQQPQ..qPPI....................YQedpngdylqr..............................iavvtgvpsiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLDEI......................LMDD...............PLSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A1S3LM00_SALSA/224-342             ..................................................................................................MQARAHGLT...TD...SS..D..-L..CS.AE..L.S..A.RGIKQE.....................................................PAL.GD.FHQ.DLY..........................-PVDPQ...HQH....................--...................................................---..HP..AC..........TPDQVQSTTL...........-ELNDETS...PY.T.E..GH.-....-G......GFSGEL......................RMDD...............TLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.I..S.MEEN..............
M9MM95_DANRE/402-538                 ..................................................................................................MQARLHGLS...SS...Q-..-..-L..SD.SL..T.Q..T.QTLTLEhnpn.............................................tdlsKTL.LS.ITQ.TTP.........................sSFLSPP...SST....................SS...................................................VGG..TV..TS..........PLELG-TLSF...........GELDDHTA..sVF.S.P..AL.M....AD......MGLGDI......................LMDDt.............gALSPVG.gADPLLSA.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A2K5LC86_CERAT/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3P9DLQ0_9CICH/369-492             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q4H839_NEOBR/332-408             ..................................................................................................MQARLHGLP...SN...SP..S..GL..NT.GD..I.M..G.SYIKQE.....................................................TSL.EE.NHS.HPQa........................qAHHQPQ...HLP....................HN...................................................QAH..PQ..AQ..........QHQFLSHTHF...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----hpqgqaq.......
A0A3Q7WKF3_URSAR/225-344             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1V4KWW3_PATFA/378-515             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEasgd............................................egtlePLL.PP.PDP.ESQ..........................LVLPPA...---....................--...................................................-PQ..SP..YH..........QLDFTHSLSF...........---DDGSR...GF.P.D..SL.E....PGh....sASFPALskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
G5AVQ1_HETGA/396-521                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.AD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DIL..........................Q-QHPD...LSC....................TT...................................................TLD..LT..DG..........TISFNSSLGT...........--GPESSP...AY.S.V..PM.K....MA......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K6GN93_PROCO/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGPGTEGSQ...VY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B5QUR7_XIPMA/327-508             ..................................................................................................MQAQIHGLP...GT...SP..S..AL..NQ.SE..M.M..P.PYIKQEtspeqnfshaqaqalhqsqhi...........phnqaqpqqhhflpqthlhpqSQL.QP.QVQ.QLPp.......................lsQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFAQSLDL...........---CD-GI..qGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2R9A329_PANPA/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.ESLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q2U6P0_CHICK/362-487             ..................................................................................................MQARAHGLS...LV...PS..T..GI..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2K5ETJ8_AOTNA/319-471             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3P9DL36_9CICH/387-510             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
H3AZE8_LATCH/287-426                 ..................................................................................................MQAQAHGLA...TI...SP..A..GI..ST.TE..L.A..R.QIVKQEsase.............................................espsPGF.QP.LPR.---..........................QHQQQQ...PPP....................PA...................................................AAA..AS..QQ..........PLDFTQTLEL...........---CDDAM...GY.Q.D..PL.-....--......AQLDDLayasgs.........kkeldfmLLDD...............MLSPLG..ADPLLSA.MS..PQ..TSK.P..S.S.RR...S.S.F..S.MED-s.............
A0A3B5QPL5_XIPMA/266-394             ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpADAGDS-A...HY.G.-..-N.S....RT......CKMKEL......................VRDN...............GLGPVS.pSDPLLSS.MS..PE..VSHpA..S.S.RH...S.S.S..S.S---ssmeek........
A0A2K6T5U8_SAIBB/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-I...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A060VWF9_ONCMY/286-431             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvAGV..TD..QG..........-QGVVDGSTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDD..............
A0A2K6JXR7_RHIBE/388-513             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K6CPW0_MACNE/388-513             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I3HVZ7_NOMLE/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................---QRH...---....................--...................................................ADL..TC..TT..........TLDLTDGTITfs......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVA.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K6P6S0_RHIRO/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
F7F5J1_RAT/321-473                   ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsednpgetl..............................mlgsevpdpepmPAL.PP.QAP.LP-..........................SAAQPQ...SPF....................--...................................................---..--..-H..........HLDFSHGLSF...........GGGGDEGP..aGY.P.D..PL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H9GTC2_ANOCA/385-522                 ...........................................................................ilkasvdyirklqkeqqrskeme---------...--...--..-..--..--.--..I.R..Q.R-----.....................................................-KL.EQ.ANR.SLQlrvqe...............lelqvqMHGLPL...TSM....................-T...................................................HSL..AG..DT..........VPPFADSLDL...........-PFSAEEL...GL.G.L..AL.G....SD.....gGALQDV......................LMDDg.............tALSPLG.aSDPLLSS.VS..PG..ASK.G..S.S.RR...S.S.F..S.MEDD..............
A0A286XLR1_CAVPO/315-465             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpgeeapgetl..............................mlgaevpepeplP--.--.---.---..........................-SLPPQ...APL....................PP...................................................PAEppSP..FH..........HLDFSHSLSF...........GDGGDEGP..sGY.P.D..PL.G....PE......HGFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A455BBQ6_PHYMC/314-469             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAQ.---..........................-LPPPA...QPA....................Q-...................................................-PP..SP..FH..........HLDFSHSLSF...........GGGGNEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2R9C5E7_PANPA/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q3F4U3_9LABR/385-508             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RTIKQE.....................................................TAL.ED.CHQ.DLY..........................-TLHPH...HQH...................hPA...................................................CTP..EP..PG..........TLDLNEGHSN...........--FPE--G...HY.S.V..HG.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q3T4A1_9TELE/369-492             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CT.AE..L.G..T.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPQ...HQH....................-H...................................................PAC..TP..EP..........PGSLELNEVH...........SNFQEG--...HY.S.T..HN.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
F7FWD8_ORNAN/280-442                 ....................................................gtilkasvdyirklqkeqqrskdmesrqrsleqanrslqlrvqeleLQAQIHGLL...PA...PP..P..--..-T.D-..-.-..-.-TLKPE.....................................................PGR.PE.EGG.PFL..........................AARPP-...---....................--...................................................PHP..PA..DS..........ILDLNFSSDP..........lGELGD---...PF.Q.L..GL.G....PD......TAIEDI......................LMEEgg...........paGLSPLG.aADPLLSS.VS..PG..ASK.G..S.S.RR...S.S.F..S.MEED..............
A0A3Q1LPT6_BOVIN/297-422             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2Y9NU69_DELLE/314-469             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAQ.---..........................-LPPPA...QPA....................Q-...................................................-PP..SP..FH..........HLDFSHSLSF...........GGGGNEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q7X4H2_URSAR/327-468             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgaap.................fhaagGPAQSA...PHQ....................HP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2I4BB26_9TELE/270-396             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QHRCSP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......qipADTGDTD-...PY.G.-..-N.S....RT......CKMKEL......................VRDN...............SLGLIS.pSDPLLTS.MS..PDvsNNI.S..S.S.HS...S.C.S..S.MEEK..............
A0A2K5ETI0_AOTNA/336-488             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
S4RJL8_PETMA/98-233                  ..................................................................................................MQARAHGLP...SS...SP..T..GL..TT.GD..L.N.gQ.QLIKAE.....................................................PDM.GG.LQR.LDFa........................lQHAETA...--Vs..................gVP...................................................DLG..GG..IT..........ILDLNEGTFGyt......dllTHLGDPAD...QF.A.EcyPF.T....NG......LRLRDF......................LLDD...............GLSPVG.gSDPLLSS.VS..PT..ASK.T..S.S.--...-.-.-..-.----fipcsdh.......
K7FWC9_PELSI/315-477                 .................................................................................................r-QAHLHGLP...AS...PP..S..GV..NV.DG..R.F..K.QXXXXXxxxxxxxxxxxxxxx.......................xxxxxxxxxxxxxxxX--.--.---.--Xxxxx..................xxxxA-----...--Trga..............rrpLP...................................................LPP..PS..PY..........QLDFSHSLSF...........---DDGSG...GF.H.D..HL.D....PSh....nVSFPSLskke..............ldlmLMED...............TMLPMA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
TFEC_PANTR/225-344                   ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYC-...---....................QQ...................................................LTV..SQ..RP..........SPEFCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P9QEF5_POERE/277-395             ..................................................................................................MQARLHGLP...AN...PG..A..A-..TT.LN..L.S..AlGAIAQP.....................................................---.--.LPA.---..........................SFLSPP...SSD....................SP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDPTA...--.-.S..AL.Y....PD......VGLGDI......................LMDDg.............cALSPER.mGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A3Q1LFW9_BOVIN/229-347             ..................................................................................................IQARAHGLP...TL...AS..L..--..VT.VD..L.G..A.HITKQT.....................................................-HL.EQ.NSG.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDNM......................LLDD...............TVSPFG..TDPLLSA.IS..PA..VSK.E..S.S.RR...S.S.F..S.SEDG..............
A0A3P9A4A5_ESOLU/152-258             ..................................................................................................IQALAHGLP...NM...AT..S..-L..GT.VE..L.S..S.HLLKQQ.....................................................Q--.--.---.---..........................QQHQPQ...GPG....................--...................................................---..--..--..........AVDGSTTFSDp.........lSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMED...............PLSPFA..TDPLLSA.GS..PA..TSK.D..S.S.QR...S.S.F..S.SDDE..............
A0A1S3MZ56_SALSA/281-425             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
L5JWL4_PTEAL/432-574                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhageGPAQG-...APH....................QQ...................................................PPV.pPS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLTDI......................LMEEeegvv....gglsggTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3B4ZZE1_9TELE/215-366             ........................................................asvdyirklqkeqqrtremeerqrrlentnrslllriqelev-QARLGGFS...SS...SP..L..--..--.PP..H.S..S.TPLAPP.....................................................PLL.SP.PLP.---..........................AFSSPS...SPL....................--...................................................---..--..VS..........PPLGLDALSFv........dlEDPQGASA...VF.S.P..DL.-....-L......PGLGGL......................LMED...............G-GGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3Q0R0Y1_AMPCI/365-493             .................................................................................................h-QARFHGVS...SS...SS..T..SP..PP.KS..S.S..S.SLDPQN.....................................................-LL.SPpLLH.P--..........................-FSSSS...SPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DDPRGASN...VF.S.P..DL.M....SD......MGLTDLhgl................gglLMEE..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3B3U123_9TELE/386-510             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..V.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................HP...................................................AGT.pEQ..PS..........TLDLTKGHSN...........--FPEG--...HYgS.V..HS.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2K5MGY8_CERAT/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGI......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
W5MV93_LEPOC/379-505                 ..................................................................................................MQARAHGLS...VV...AS..S..AL..CS.SE..L.A..A.RAIKQE.....................................................PVL.GD.CNQ.DMY..........................QHHSV-...---....................--...................................................PEM..SR..TT..........TLDLTDGTITfs......dglANVAE-ST...AY.S.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.H..S.S.RR...S.S.I..S.MEEN..............
D2JUK3_PIG/290-415                   ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGSEGNP...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1S3N051_SALSA/204-348             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A3B4WYC4_SERLL/321-447             ..................................................................................................LQARVHGLS...SS...SP..H..PN..SS.SS..S.L..D.PQALLS.....................................................PTL.PH.PFS.---..........................NSSSPA...SSL....................--...................................................--V..TP..SL..........GLDALNFVDL...........DEPQGAST...VF.S.P..DL.M....SD......VGLTELhgl................gdiLMDEg............ggGEGGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
I2CV82_MACMU/375-500                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A452IN12_9SAUR/316-456             ..................................................................................................MQARLHGLP...AS...SP..S..SV..NV.AE..L.V..Q.QVVKQEvtge............................................dgsmePQQ.PQ.LPP.DQE..........................--TQQQ...QPL....................-P...................................................LLP..PS..SY..........QLDFTHGLSF...........---DDGSR...GF.R.D..QL.D....PSh....nVSFPSLskke..............ldlmLMED...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A087XNE6_POEFO/387-511             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..A.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................-H...................................................PAG..TP..EQp........sTLELTKGHSN...........--FPEG--...HY.GsV..HG.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q2GUC0_HORSE/286-405             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.QVTKQQ.....................................................THL.EQ.NSV.DYC..........................QQLT--...--I....................--...................................................SQG..TS..PE..........LSDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3B4UJQ2_SERDU/305-452             ..................................................................................................MQARIHGLS...NSn.sIS..S..GL.gSD.PS..LlQ..Q.QHVPQS....................................................gQSL.PS.SAG.GASsqnl..................lslgAIGQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDTSA...--.-.S..AL.Y....PD......VGLGDI......................LMDDg.............cTLSPER.vGDPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A2K5EDV5_AOTNA/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3P8YWU1_ESOLU/392-523             ..................................................................................................MQARAHGLN...TA...SS..A..-L..SP.AE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYs........................vHPQHQH...HPA....................CT...................................................ADQ..AQ..SS..........TLELNDVACSy........teGHGSDP-G...PY.S.A..HT.K....RS......VKHNDI......................LMDD...............TLSQVG.aGDPLLSA.VS..PG..ASK.D..S.S.CS...G.S.V..S.MEEN..............
A0A1S3LE15_SALSA/304-449             ..................................................................................................VQAQLHGLS...SP...MS..Y..GL.sSD.PS..L.I..Q.QQHLQQgghilgprtgv..............................acsqtflslgdaA--.--.---.---..........................-MAQPI...PTSflsp............pstdSP...................................................VGV..TI..GS..........PLDLG-SLSF...........AELDDPS-...--.N.A..GL.F....PD......VGLGDI......................LMDEg.............cTLSPER..VDPLF-F.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A3B3WU61_9TELE/439-513             ...........................................................................................lpnpsls---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........FMDLDESHQA...........------SA...VF.S.T..DL.M....VEl....gAGLSGLga..................glLMEE...............DAGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3P9DNI9_9CICH/389-517             ..................................................................................................LQACVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................spPLL.HP.FSS.---..........................----SS...SPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DEPQGAAT...VF.S.P..DL.M....SD......MGLTDLngl................gglLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2G8LRA6_STIJA/383-512             .............................................................................................mvckk-----HNLD...VN...PY..S..LE.tNT.DA..L.A..T.QLISLN....................................................gQNL.DM.SM-.---..........................KVDAPQ..eSPM....................QT...................................................MGGfgPR..NQ..........SATLVNPNNQ...........LPNQN-SV..lNH.N.S..LT.G....NS......SSMLDD......................MIED...............SSSPVV..SDALLWH.NS..PM..ASH.H..S.S.RR...S.S.I.tS.MED-l.............
A0A455ATT0_PHYMC/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4VAB8_SERDU/314-441             ..................................................................................................LQARLHGLS...SS...SP..H..P-..-N.SS..S.S..S.SLDPQA.....................................................-LL.SP.TLPhPFS..........................NSSSPA...SSL....................--...................................................--V..TP..SL..........GLDALNFVDL...........DEPQGAST...VF.S.P..DL.M....SD......VGLTELhgl................gdiLMDEg............ggGEGGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2K5ZRN7_MANLE/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3I106_CRIGR/321-473                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpgedgpgeal..............................mlgpevpdpepmPAL.PP.QGP.LP-..........................PAAQPQ...SP-....................--...................................................---..--..FH..........HLDFSHSLSF...........GGGGDEGP..tGY.H.D..PL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2R8MDP8_CALJA/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........NPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A2U3WID4_ODORO/196-315             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..V.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
I3LTE0_PIG/381-506                   ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGSEGNP...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K5X0E0_MACFA/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
L5KAF4_PTEAL/345-470                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PSL.EN.CSQ.DLL..........................----PH...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnlGTGTESGQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
M3Y783_MUSPF/225-344                 ..................................................................................................IQARAHGLP...AL...AS..L..--..GA.VD..L.G..A.NVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.IS..PA..VSK.E..S.S.RR...S.S.F..S.SNDG..............
O73871_CHICK/339-464                 ..................................................................................................MQARAHGLS...LV...PS..T..GI..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A3Q2KVB6_HORSE/250-369             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.QVTKQQ.....................................................THL.EQ.NSV.DYC..........................QQLT--...--I....................--...................................................SQG..TS..PE..........LSDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2I3GTG1_NOMLE/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAVAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1A6HTS2_NEOLE/277-417             ..................................................................................................LQAQIHGLP...VP...PT..P..G-..-L.LS..L.A..T.SSVSDS.....................................................--L.KP.EQL.DIE..........................EEGRPS...TTFhvsggp.......vqnapqqQP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegvvg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A0P7TBM8_SCLFO/269-389             ..................................................................................................MQARAHGLQ...SV...AP..S..SL..AA.PE..L.P..S.HLQKQAp...................................................pP--.--.VYR.EEVgee...................ylqrSMAPPS...--G....................AP...................................................AAD..HA..GG..........PAAFS----Dp.........lSHFTDF--...-F.G.A..TL.K....DE......RRMDRI......................LMDG...............PLSPFG..DDPLLST.AS..PD..ESK.G..S.S.R-...-.-.-..-.----xxxx..........
A0A2K5I0Y2_COLAP/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2K6JXR8_RHIBE/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3TYD4_LOXAF/436-576                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-HL.DV.---.--Eeegrp...............gtfhveGARAPN...ASY...................qQP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeesvv....gglsggTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2U9C4B8_SCOMX/299-460             ..........................lngvknemcdvetktlikerqkkdshnlierrrrfnindrikelgalvpkstdlemrwnkgtilkasvdyir---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................KLQKEQ...QRA....................RE...................................................MAE..NQ..RR..........LENTNHSLLL...........-RIQGAPA...VF.H.P..DL.M....SDvgltelQGLGDI......................LMEE...............GGGGLM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3B3BDJ8_ORYME/354-477             ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RSIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................HP...................................................ACT.pEQ..QG..........TLELNEGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3P8U489_AMPPE/322-448             ..................................................................................................IQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTISfd......hipADAGDP-G...SY.G.-..-N.S....RT......CKMKEL......................VRDN...............GLGPIS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MDEK..............
G3UT98_MELGA/246-365                 ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVTKQR.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................VHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TISPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3Q4H256_NEOBR/369-492             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A0A0APJ8_CHAVO/259-378             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................SYA.EE.NSV.-DY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3B3QV65_9TELE/380-508             ..................................................................................................MQARAHGLA...VV...AP..T..AL..CS.PE..L.A..N.RAIKQE.....................................................AVR.GD.CSQ.DLY..........................-HQQRH...AAS....................KP...................................................PGP..T-..--..........TLDLSDGTISf........snGPPTQGEP..sVY.S.I..AT.K....GS......SKLDSM......................LMDE...............AVSPAG.vEDPLLCC.VS..PG..VSK.D..N.S.RE...N.S.M..S.MEEN..............
A0A3P8U309_AMPPE/244-370             ..................................................................................................IQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTISfd......hipADAGDP-G...SY.G.-..-N.S....RT......CKMKEL......................VRDN...............GLGPIS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MDEK..............
A0A1U8CKF4_MESAU/345-486             ..................................................................................................LQAQIHGLP...VP...PT..P..GLlsLA.TS..S.G..S.DSLKPE.....................................................-QL.DI.EEE.GRPntas.................fhvsgGPVQNT...PQQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegvmg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K6R648_RHIRO/321-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q0CUA6_MESAU/328-478             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsedgp.......................................gealmlgP--.--.EVP.DPEq........................mPTLPPQ...APP....................PP...................................................AAQ..SP..FH..........HLDFSHSLSF...........GGGGDEGP..tGY.H.D..PL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
G1R928_NOMLE/432-574                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgtat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q4H839_NEOBR/398-515             ......................................................................................hthfhpqgqaqp---------...--...--..-..--..--.--..-.-..-.----EP.....................................................RQL.PP.LPQ.---..........................-HLQPQ...PPI....................QY...................................................PAV..GS..SQ..........HFDFAQSLDF...........---CD-GI..sGL.S.D..GM.-....--......SGLGDLggldvqa.......rrgdlgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
M7B5S2_CHEMY/266-386                 ........................................................................nkgtilkasvdyirrmqkdlqrsrdl---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.--E..........................NHSRRL...EM-....................TN...................................................KQL..LI..RI..........QLDFTHGLSF...........---DDGSR...GF.R.D..QL.D....PSh....nVSFPSLskke..............ldlmLMED...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3P8UF29_AMPPE/280-390             ..................................................................................................VQARLHGFS...SS...AP..P..PP..SS.SP..L.A..P.PTLLSS.....................................................---.-P.LPP.---..........................-FSSPS...SPL....................--...................................................--V..TP..PL..........GLDALSFVEL...........EDPRGASA...VF.S.P..EL.L....PE......AGLQGV......................LLME...............D--GVI..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3Q1J9G9_ANATE/436-559             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..N.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EP..........HGTLELSEDH...........SNFPEG--...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q1JVT2_ANATE/331-477             ..................................................................................................MQAHLHGLP...NT...SP..S..GL..NP.SD..M.M..A.PYIKQEtsseenl.......................................sipqpqpRQL.PP.LPQ.---..........................-HLQPQ...PPI....................QF...................................................PAV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMG..RDPLLSA.MS..PE..ASV.N..S.S.RR...S.S.F..S.IEDG..............
H3CPA2_TETNG/316-451                 ..................................................................................................MQARLHGLH...GN...SP..T..GL..NS.AD..L.M..S.PYVKQE.....................................................SSL.EE.NLA.HPS..........................-HMQSH...PPI....................QY...................................................PAV..GS..SQ..........PFDFAPTLDF...........---SD-GI..pAF.S.D..GM.-....--......SGLGDLggldvqg.......rrdelgflMMGE...............PLSPIG..ADPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
M3VYS0_FELCA/429-570                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGSAQSA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
H2U0V1_TAKRU/283-403                 ..................................................................................................MQARAHGIS...IA...SS..A..-L..CS.AE..L.A..I.RSIKQE.....................................................TSL.ED.CHQ.DIY..........................T-LHPH..hPPC....................--...................................................-TP..ET..PG..........TLELNESHAN...........--F--PKG...HY.G.V..QG.K....PG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
TFE3_BOVIN/430-572                   ..................................................................................................LQAQIHGLP...VP...PT..P..GL..--.LS..L.A..A.TSASDS.....................................................--L.KP.EQL.DVE..........................EEGRPG...TAIfhatg..........glaqsAP...................................................HQQ..PP..PP..........PSDALLDLHFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K6RDM0_RHIRO/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLTv.................sqGP...................................................APE..LC..DQ..........AIAFSDPLSY...........--FTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2R9BLK6_PANPA/324-476             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDN...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q2X406_HAPBU/357-486             ..................................................................................................LQARVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................spPLL.HP.FSS.---..........................---SSS...PPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DEPQGAAT...VF.S.P..DL.M....SD......MGLTDLngl................gglLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3B3WU72_9TELE/409-483             ...........................................................................................lpnpsls---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........FMDLDESHQA...........------SA...VF.S.T..DL.M....VEl....gAGLSGLga..................glLMEE...............DAGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2K5EDY0_AOTNA/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
MITF_MOUSE/397-522                   ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITft......nnlGTMPESSP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
#=GR MITF_MOUSE/397-522        SS    ..................................................................................................HHHHH-XXX...XX...XX..X..XX..XX.XX..X.X..X.XXXXXX.....................................................XXX.XX.XXX.XXX..........................XXXXX-...---....................--...................................................--X..XX..XX..........XXXXXXXXXXXX......XXXXXXXXXXX...XX.X.X..XX.X....XX......XXXXXX......................XXXX...............XXXXXX.XXXXXXXX.XX..XX..XXX.X..X.X.XX...X.X.X..X.XXX-X.............
F6U056_CALJA/391-543                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q2I9X0_HORSE/250-369             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.QVTKQQ.....................................................THL.EQ.NSV.DYC..........................QQLT--...--I....................--...................................................SQG..TS..PE..........LSDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q0SS68_AMPCI/275-401             ..................................................................................................IQARAHGLT...VV...SS..T..SV..CA.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITf.........dQIPTDAGEp.gPY.G.S..S-.-....SA......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDvsSSI.D..S.H.HT...S.S.S..S.LDDK..............
A0A2I2UYM0_FELCA/225-344             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A455AFT3_PHYMC/396-521             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4AQB2_9GOBI/340-462             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RQIKQE.....................................................PTM.ED.CHQ.DIY..........................-TLHPQ...H--....................-H...................................................QAC..TP..DHp........tSLELSDGHGN...........---YQESS...HY.S.V..HN.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASQ.D..S.S.RK...S.S.V..S.MDEN..............
A0A2K6GQ57_PROCO/119-238             ..................................................................................................IQARAHGLP...TL...AS..L..--..GA.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QPT....................-L...................................................SQG..PS..PE..........LCDQAMAFSDp.........lSHFTNL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2K5QJW7_CEBCA/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DS----.....................................................--L.KP.EQL.DIEeegrpga............atfhvagGPAQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A1S3LG10_SALSA/372-519             ..................................................................................................IQARLHGLS...TP...AS..S..SQ..GS.-S..S.S..H.LSLSQS.....................................................--L.DP.STG.DALsrtllslsg........gqglqaaspP-----...--Flspp............psasPV...................................................GLM..TM..GS..........PLDLD-SLSF...........SDLDDPSA..aAF.H.A..SL.L....PD......MGLGDI......................LMDDr............glGMSSVG.gRDPLLSS.VS..PG..VSK.T..S.S.RR...S.S.F..S.MEED..............
A0A0N4SV79_MOUSE/228-353             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITft......nnlGTMPESSP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A2I3LZI3_PAPAN/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAT.LPL..........................-PTQ--...---....................--...................................................-PP..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PQh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q4IG93_NEOBR/268-394             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3Q2VEY7_HAPBU/387-510             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
G1QPX2_NOMLE/375-500                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................---QRH...---....................--...................................................ADL..TC..TT..........TLDLTDGTITfs......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVA.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A401S833_CHIPU/298-418             ..................................................................................................MQARVHGLP...TV...SS..A..-I..NP.TE..L.V..T.HIVKHE.....................................................SYQ.GD.NSP.DYL..........................--QQPS...-LS....................QM...................................................LSE..LN..EA..........SCN------Fld.......plSHFTDL--...SF.S.A..AL.K....PE......NRLDSI......................LLDN...............TISPLT..SDPLLST.TS..PP.gASK.G..S.S.RR...S.S.F..S.TDDE..............
A0A498LAB3_LABRO/118-243             ..................................................................................................MQARAHGLA...VV...AS..P..SL..YS.SD..L.V..A.RAIKQE.....................................................PGM.GD.CTS.DLY..........................PH-LPS...---....................--...................................................PDL..SR..PT..........TLDLNNGTISy........ndSPTEEGEP..gVY.D.S..PN.K....AS......TKLEDM......................LMDN...............TLSPVS.sSDPLLSS.GS..PV..PSN.S..S.-.--...G.S.S..S.MDE-hen...........
A0A087YGF2_POEFO/328-509             ..................................................................................................MQAQLHGLP...SN...SP..S..AL..NP.SE..M.M..P.PYIKQEtspeqnfshaqaqalhqsqhi...........phnqaqpqqhhflpqahlhpqSQL.QP.QAR.QLPp.......................lpQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..hGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
G3TZZ1_LOXAF/291-416                 ..................................................................................................MQARAHGLS...LL...PS..T..GL..CS.PD..V.V..N.RVIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTESNQ...AY.C.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A384AYX0_BALAS/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-t.............
A0A3Q3WE09_MOLML/269-396             ..........................................rlnhsecwsgcvdqsetfsavspiligpypgallsprlphpfssssspslatpslg---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----LDALSF...........AELDDPRGastVF.S.P..DL.M....SDvgltglHGLGDM......................LMEE...............AEGGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
E9QC93_DANRE/222-347                 ..................................................................................................MQARAHGLT...VV...AS..S..SL..YS.AE..L.V..A.RAIKQE.....................................................PGM.GD.CTS.NLY..........................PH-LPS...---....................--...................................................PDM..SR..PT..........TLDLNNGTISy........ndSPTEDGEP..gVY.D.S..PN.K....AS......TKLEDM......................LMDN...............TLSPVG.sSDPLLSS.GS..PV..PSN.S..S.-.--...G.S.S..S.MDE-hdn...........
A0A2R8ZEX6_PANPA/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A060XDP0_ONCMY/327-472             ..................................................................................................VQAQLHGLS...SP...MS..Y..GL.sSD.PS..F.L..Q.QQHLQQgghilgprtgv..............................acsqtflslgdaA--.--.---.---..........................-MAQPI...PTSflsp............pssdSP...................................................AGV..TI..GS..........PLDLG-SLRF...........AELDDPS-...--.N.A..GL.F....PG......VGLGDI......................VMDEg.............cTRSPER..VDPLF-F.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A060WAU6_ONCMY/308-423             ..................................................................................................MQARAHGLA...IL...PS..S..SL..CS.SE..L.I..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QQPGPD...--M....................--...................................................---..SP..PT..........TLDLNNGTIH...........--FNDSPV...--.D.A..--.-....AS......TKLKDI......................LMDN...............TLSPIS.sNDPLLSS.AS..PD..TSN.S..S.S.RR...S.S.S..SsMEE-n.............
H2QSZ5_PANTR/321-473                 ..................................................................................................MQARVHGLP...TA...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
W5NUB2_SHEEP/229-348                 ..................................................................................................IQARAHGLP...TL...AS..L..--..VT.VD..L.G..A.HITKQQ.....................................................THL.EQ.NSG.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDNM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SEDG..............
E9PZ28_MOUSE/372-497                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITft......nnlGTMPESSP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A1S3SG03_SALSA/319-464             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A2U3XD63_LEPWE/171-326             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQEmpseegpgeal..............................lleaevpdpeslPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1V4KY25_PATFA/423-560             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEasgd............................................egtlePLL.PP.PDP.ESQ..........................LVLPPA...---....................--...................................................-PQ..SP..YH..........QLDFTHSLSF...........---DDGSR...GF.P.D..SL.E....PGh....sASFPALskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3Q3WAK1_MOLML/248-373             ..................................................................................................IQARAHGLA...IA...SP..S..-V..CT.SD..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITf.........dQIRTDSGN...PG.P.Y..GN.S....RN......CKLKEL......................VRDN...............TLSPIS.pSDPLLSS.MS..PE.gSNN.V..S.N.RH...S.S.C..SsMEE-k.............
A0A3B3R177_9TELE/252-379             ..................................................................................................IQARAHGLP...SM...AP..S..-L..GS.TE..S.P..S.HLLKLQ.....................................................-QM.PH.AQQ.AVY..........................QEDLSG...DYA....................ES...................................................PIA..PP..TG..........HTEHGGTVVAfs......dplSHFTDF--...-F.N.G..TL.K....EE......SRLDHI......................LPGG...............SLSPFD..ADPLLSA.TS..PP..ASK.G..S.S.RR...S.S.F..S.TDDG..............
A0A3P9BQ61_9CICH/266-392             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A096MFL0_POEFO/272-400             ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfn......hmpADAGDS-A...HY.G.-..-S.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSN.P.vS.G.RHsssS.S.S..S.MEE-k.............
A0A3P9QCD2_POERE/244-372             ..................................................................................................IQARAHGLT...VV...PS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHNCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpADAGDS-A...HY.G.-..-S.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSN.P.vS.G.RHsssS.S.S..S.MEE-k.............
A0A2R8Q945_DANRE/246-398             ..........................................................lipkstdpemrwnkgtilkasvdyirklqkeqqrakeiem---------...--...--..-..--..--.--..-.R..Q.K-----.....................................................-KL.EQ.SNQ.ALIlriqvhh............spgflfiTQTSPS...-PFlsv.............ppsgSP...................................................AAV..AV..SG..........PLHLE-TFSF...........TELDEH--...--.A.S..DL.Y....PD......VGLSDI......................LMDD...............V---RG..SDVLFSP.MS..PG..ASK.T..S.S.QG...S.S.I..N.MEDD..............
A0A3Q3VWX9_MOLML/335-517             ..................................................................................................MQARLHGLP...SN...SP..S..GL..NP.AE..L.M..N.PFIKQEtspenlphpqaqvhhqaqhlpqnqp...hvqaqqhhflqqthlhhpvqaqpqaRQL.PP.LPP.---..........................-HMQTQ...QAM....................QF...................................................LSV..GG..SQ..........PYDFAPSLDF...........---SD-GI..pAF.S.D..GM.-....--......SGLGDLggldvqg.......rrpelgflMMEE...............PLSPIG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2Y9MQP2_DELLE/327-469             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQST...PHQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A1D5PQJ4_CHICK/315-452             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEagad............................................egmlePLL.PP.PDP.ESQ..........................PVLPPL...---....................--...................................................-PQ..SP..YH..........QLDFSHSLSF...........---DDGSQ...SF.P.D..SL.E....PSh....gASFPSLskke..............ldlmLLQD...............TMLPLA..SDPLFSA.VS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A087Y975_POEFO/252-404             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQS.PPQ.........................vQQQQPQ..qPPI....................YQedpngdylqr..............................iavvtgvpsiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A1S2ZW17_ERIEU/195-314             ..................................................................................................IQARAHGLP...IL...AS..F..--..GT.VD..L.G..A.PVNKQQ.....................................................TQL.EQ.NSV.DFC..........................QQLTPS...QG-....................--...................................................---..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGI......................LLDD...............AISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDD-a.............
A0A452FLL9_CAPHI/375-499             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PE..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITfn.......slGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B5KL38_TAKRU/359-479             ..................................................................................................MQARAHGIS...IA...SS..A..-L..CS.AE..L.A..I.RSIKQE.....................................................TSL.ED.CHQ.DIY..........................T-LHPH..hPPC....................--...................................................-TP..ET..PG..........TLELNESHAN...........--F--PKG...HY.G.V..QG.K....PG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A1S3ENQ4_DIPOR/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHQAE-...---....................--...................................................--L..TC..TT..........TLDLTDGTITfn......sslGTGPDSNP...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4BA99_9GOBI/312-457             ..................................................................................................MQARLHGLPpgtSM...SP..G..LT..TD.PS..L.-..Q.QPVPQSsqsa............................................plaagV--.--.---.--Vnaqnller.........vaigqslppS-----...--Flsp.............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDTSA...--.-.S..AL.Y....PD......VGLSDI......................LMDDg.............cTLSPEG.gAEPLFSP.LS..PG..PSK.T..S.S.RR...S.S.F..D.MDED..............
A0A3Q1I6A6_ANATE/276-420             ..................................................................................................IQARAHGLT...NM...PT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QS.SPQ.AQQp.......................llYQEDPN...SDYlqriav........vagvpsLP...................................................SAG..GP..QD..........HIAGADGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HQLDKI......................LMED...............PLSPFG..ADPLLSA.TS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3B4DJ39_PYGNA/283-411             ..................................................................................................MQARAHGLT...VG...SS..T..AL..CS.TE..L.V..A.RAIKQE.....................................................PGL.GN.CSS.DLY..........................AHTHLP...---....................-S...................................................PDL..TR..TT..........TLDLNNGTISyn......dspTEEPD-GG...LY.S.S..HD.K....AS......GKLEDM......................FMDN...............ALSPMG.sSNPLLSS.GS..PT..HSN.S..S.S.RR...S.S.S..S.TEEQ..............
A0A3Q1KGS9_ANATE/398-581             ..................................................................................................MQAHLHGLP...NT...SP..S..GL..NP.SD..M.M..A.PYIKQEtsseenlsipqvqahhhhqhlqqnq..aqpqaqqhpffpqnhlhpqgqaqpqpR--.--.---.--Qlp.....................plpQHLQPQ...PPI....................QF...................................................PAV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMG..RDPLLSA.MS..PE..ASV.N..S.S.RR...S.S.F..S.IEDG..............
A0A3Q7WUT5_URSAR/313-432             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q3WK53_MOLML/386-508             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.SE..L.A..A.RTIKQE.....................................................SAL.ED.CHQ.DMY..........................TLHQHH...QHH....................LA...................................................CTP..DT..PG..........TLELNEGHGN...........----YAEG...HY.V.-..HG.K....TG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2K5Q0R8_CEBCA/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-V----...DYC....................QQ...................................................LTV..SQ..GR..........SLELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A226PFJ2_COLVI/87-205              ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..S.QVIKQQ.....................................................SYL.EN.SVE.--Y..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..PSK.E..S.S.RR...S.S.F..S.TDDG..............
A0A2K6CFN6_MACNE/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2Y9IZF1_ENHLU/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A226MIU8_CALSU/315-452             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEagtd............................................egmleP--.--.LLP.TPD..........................PESQPV...--L....................PP...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGSQ...GF.P.D..NL.E....PSh....sSSFPSLskke..............ldlmLLQD...............TMLPLA..SDPLFSA.VS..PE..ASK.A..S.S.RR...S.S.F..S.LED-t.............
TFEC_RAT/196-314                     ..................................................................................................IQARAHGLP...IL...AS..L..--..GT.AD..F.G..T.HITKQQ.....................................................THS.EK.NSV.GCC..........................QQLTPS...QGT....................--...................................................---..-S..PE..........FYEQAVAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLSD...............TICPFG..TDPLLSA.IS..PA..VSK.A..S.S.R-...S.S.L..S.SEDG..............
A0A093PR34_9PASS/344-372             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQE.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----..............
A0A2K6EJZ9_PROCO/234-386             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpgeegpgetl..............................mlgaevpdpeplP--.--.---.---..........................-ALPPQ...APL....................GP...................................................PAQppSP..FH..........HLDFSHSLSF...........AGGDDEGP..pGY.P.E..AL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2U9BHP6_SCOMX/763-908             ..................................................................................................MQARVHGLP...NS...SS..L..S-..SG.LS..C.D..P.CLLQQQplp...............................................qggQSL.PP.GAG.GASsqsl..................lslgAIGQPL...PTSflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDASA...--.-.S..AL.Y....PD......VGLGDI......................LMDDg.............cTLSPER.gADPLFSP.LS..PG..ASK.S..S.-.-R...S.S.L..E.MDED..............
A0A2R9BLI2_PANPA/321-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDN...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H2MMD1_ORYLA/323-401                 ..................................................................................................MQARLHGLP...NA...SP..S..GL..SL.PD..M.M..P.AYIKQEtspee..........................................nlshshPQG.--.---.--Hhqph..................hlhhNHAQPQ...QHA....................QQ...................................................HHY..MP..QT..........HL--------...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----hpqdhmq.......
A0A2Y9JRJ6_ENHLU/429-571             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgtaa.................fhaaeGSAQSG...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeeegv....agglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2Y9FSG8_PHYMC/158-277             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A455AG86_PHYMC/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3HNC3_CRIGR/432-573                 ..................................................................................................LQAQIHGLP...VP...PT..P..G-..-L.LS..L.A..T.SSVSDS.....................................................--L.KP.EQL.DIEeegrpst............tsfhvsgG-----...--Piqn.............apqqQP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegvvg.....glsggTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
G3RDS0_GORGO/432-574                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q2DMH3_CYPVA/335-444             ..................................................................................................LQARLNGLS...SS...SS..S..A-..--.--..-.S..T.PLTSSS.....................................................SSL.DP.NTH.--L..........................SPLLPN...---....................--...................................................---..PS..LS..........FMDLEESHAT...........------PT...VF.S.P..DL.L....PG......VGLTELssl................ggfLMEE...............DGGAAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
H3D4U4_TETNG/339-462                 ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.TE..L.V..V.RTIKQE.....................................................NSL.ED.CHQ.DIY..........................-TLHPH...HPH....................HP...................................................PCT.pET..PG..........TLELNESHAN...........----FPKG...HY.G.V..HG.K....PG......SKLNDV......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2K5RBR5_CEBCA/381-506             ..................................................................................................MQARAHGLS...LI...PT..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A0P7UF86_SCLFO/373-514             .................................................................................................r-QAQLHGLP...CS...SP..L..SL..GS.AE..L.M..G.PFVKQEgspeevtl.....................................gnglpqpsCQL.PP.LS-.---..........................HHAPPQ...APL....................QY...................................................PSV..GS..SQ..........HFDFTQSLDL...........---CDGGH...CY.P.D..PL.A....QVagpgkkSELGFL......................LMD-...............ELSPLA..GDPLLST.LS..PE..TSV.D..S.S.RR...S.S.F..S.MED-s.............
A0A3B5R7D7_XIPMA/383-466             ....................................................................................dpqtllspllpnps---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..LS..........FMDLDESHQA...........------SA...VF.S.T..DL.V....AEl....gEGLSGLga..................glLMEE...............DGGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
G5BNI2_HETGA/550-583                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQE.....................................................--L.P-.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----nds...........
A0A3Q1MD59_BOVIN/225-343             ..................................................................................................IQARAHGLP...TL...AS..L..--..VT.VD..L.G..A.HITKQT.....................................................-HL.EQ.NSG.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDNM......................LLDD...............TVSPFG..TDPLLSA.IS..PA..VSK.E..S.S.RR...S.S.F..S.SEDG..............
A0A2U3VPB4_ODORO/429-570             ..................................................................................................LQAQIHGLP...VP...PS..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtap.................fpaagGSAQSA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeeggv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2Y9FMV2_PHYMC/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3WZM2_9TELE/330-511             ..................................................................................................MQAQLHGLP...SN...SP..S..AL..NP.SE..M.M..P.PYIKQEtspeqnfshaqaqalhqsqhi...........phnqaqpqqhhflpqahlhpqSQL.QP.QAR.QLPp.......................lpQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..hGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2K5ETI6_AOTNA/361-513             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q1GB84_9TELE/242-397             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqs......................ppQAQQPQ...QPP....................LYqedpngdylqr.............................iavvtgvpsiaTVS..GP..QD..........HIAGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......HPLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A452SCZ0_URSAM/397-521             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn.......nlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
G3P7Y4_GASAC/278-417                 ..................................................................................................MQARHHSLS...PD...PS..L..-L..HQ.QQ..-.-..-.---VQHg...................................................gPSL.PQ.GAD.GVSsqnllsmga........sgigqplpaS-----...--Flsp.............pssdSP...................................................AGV..TI..SS..........PLDLG-GLSF...........AELDDDSA...--.-.S..GL.Y....PD......VGLGDF......................LMDEv.............yTLSPER.mAEPLFSP.LS..PG..ASK.G..S.S.RR...S.S.L..E.MDED..............
A0A3Q2WKJ3_HAPBU/320-446             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpADAGEP-G...PY.G.S..S-.-....SA......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3P8VQT9_CYNSE/277-427             ..................................................................................................IQARAHGLP...NM...TT..S..-Q..GT.VE..L.T..S.HLLKQQ.....................................................-QQ.QQ.QPQ.QQR..........................SPPQAQ...QPP...................lYQeepnndylqr..............................iaavagmpsipGAG..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....DE......QRLEEI......................LIDE...............ALSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
A0A3Q7SW86_VULVU/318-473             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsdegpgeal..............................llepevpdpeplPVV.PP.QAP.LPL..........................PAQPPQ...---....................--...................................................-PP..SP..FH..........HLDFSHSLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B3QJH8_9TELE/330-457             ..................................................................................................MQARAHGLA...LV...SP..T..AL..CP.SE..L.A..G.RVIKQE.....................................................PVL.GD.CLR.DPY..........................PH--PH...---....................HA...................................................SDM..SR..PT..........TLDLTDGTITy........sdGHGEPGES..aPY.T.R..PT.K....GA......SKLDDI......................LMDG...............SLSPVR.aGDPLLSS.SS..PG..ASN.E..S.S.RR...S.S.V..S.MEEN..............
A0A401PCP5_SCYTO/364-485             ..................................................................................................MQARAHGLP...LV...NP..S..GL..CS.PD..L.T..G.RNIKLE.....................................................LVR.NE.CHN.DSL..........................QHHSDL...---....................--...................................................---..SR..TT..........TLNLADGTLT..........fNDNLGHAV...TY.N.A..PT.K....MG......SKLDDI......................LMDD...............TLSPVE.aTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-s.............
H2LD91_ORYLA/248-374                 ..................................................................................................IQARAHGLT...VA...AA..P..SI..CT.SE..L.L..A.RAIKQE.....................................................PIL.GE.CPP.EIY..........................QHC---...---....................SA...................................................PDM..SP..ST..........TMDLNNGIITfd......tipAEPGDS-S...SY.-.-..GI.S....RI......CKMKEM......................VRDK...............SFGPLS.pSKPLLSS.IP..PD..VSN.N..S.S.NHc.sS.N.A..S.MEEK..............
A0A2Y9N258_DELLE/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q2U8M4_CHICK/365-490             ..................................................................................................MQARAHGLS...LV...PS..T..GI..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
M3YQT2_MUSPF/429-571                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgtaa.................fhaagGSAQSA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeeegv....agglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K6RDH8_RHIRO/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLTv.................sqGP...................................................APE..LC..DQ..........AIAFSDPLSY...........--FTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3B4GMG4_9CICH/357-480             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2K6JR82_RHIBE/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
G3WZ06_SARHA/397-522                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RVIKQE.....................................................PVL.EN.CSQ.DVL..........................QHHPDL...---....................--...................................................---..TC..TT..........TLDLTDGTITfs......nnlGNGTETTT...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
M3WXG8_FELCA/314-433                 ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
G3WZ07_SARHA/290-415                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RVIKQE.....................................................PVL.EN.CSQ.DVL..........................QHHPDL...---....................--...................................................---..TC..TT..........TLDLTDGTITfs......nnlGNGTETTT...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A0A2K5X0Z4_MACFA/321-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
G1SQP6_RABIT/267-386                 ..................................................................................................IQARAHGLP...TL...AS..L..--..GV.VD..L.G..A.PVIKQQ.....................................................THL.EQ.HSA.DYC.........................qQLTLSQ...EPS....................--...................................................-PE..LS..DQ..........AMAFSDPL--...........SHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDG...............KLSPFG..ADPLLSV.TS..PA..ISK.E..S.S.RR...S.S.F..S.SDDG..............
A0A0R4IX50_DANRE/249-393             ..................................................................................................IQAHAHGLP...SM...TA..S..-M..GT.VE..L.S..S.HLLKQQ.....................................................HHQ.TQ.ATA.ASQs........................aQAPQST..qPPIypqegv........sspeytQR...................................................TSL..PSivGE..........QSDGSNNFSDp.........lSHFTDF--...-F.C.S..TL.K....EE.....hQRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PT.aASK.E..S.S.RR...S.S.F..S.SEE-t.............
A0A2K6JRD7_RHIBE/334-486             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3P9QCP2_POERE/272-400             ..................................................................................................IQARAHGLT...VV...PS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHNCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpADAGDS-A...HY.G.-..-S.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSN.P.vS.G.RHsssS.S.S..S.MEE-k.............
A0A3Q3MST6_9LABR/302-445             ..................................................................................................MQARLHGLS...TPnsiSP..G..LS..SD.PS..L.L..Q.QQVQHS....................................................sQSM.AV.SAQ.N-Llgi....................gaaTIGQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDNSA...--.-.S..AL.Y....SD......MGLGDI......................LMDDg.............cTLSPER.gADSLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
H3CPE5_TETNG/309-436                 ..................................................................................................MQARLHGFP...AS...SG..A..SS.aLA.SD..P.A..L.NLLSMGaa.................................................aaAIG.EP.LPA.---..........................SFLSPP...SSN....................SP...................................................ARG..TI..SS..........PLDLG-GLSF...........AELDDGSA...--.-.P..AL.Y....PD......VGLGDI......................LMDDg.............cTLSPDR.tGEPLFSP.LS..PG..ASK.T..S.S.R-...S.S.F..E.MDED..............
A0A3Q1C0D7_AMPOC/272-398             ..................................................................................................IQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHNSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTISfd......hipADAGDP-G...SY.G.-..-N.S....RT......CKMKEL......................VRDK...............GLGPIS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MDEK..............
A0A091DVH3_FUKDA/314-432             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HLTKQQ.....................................................--T.PE.QSS.VDY.........................cQQLTP-...---....................--...................................................SQG..PS..PK..........LTDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLND...............TVSPFG..TDPLLSA.AS..PA..VSK.S..S.S.RR...S.S.F..S.SEDG..............
A0A1S3ERD2_DIPOR/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHQAE-...---....................--...................................................--L..TC..TT..........TLDLTDGTITfn......sslGTGPDSNP...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-t.............
A0A0D9REW8_CHLSB/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...N.S.F..S.SDDG..............
A0A3Q3ABC8_KRYMA/392-514             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.E..A.RTIKQE.....................................................PAL.ED.CHR.DLY..........................-TLHPH...HHH....................HH...................................................HLH..QH..QH..........HAGCAPEQAG...........AQPELGEG...HY.S.A..Q-.-....--......SKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q3W3R3_MOLML/238-358             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.---..........................---QQQ...QPL....................--...................................................-TS..GP..QD..........HVPGADGCTTfs......dplSHFTDF--...-F.S.T..TL.K....EE......HRLDEI......................LMED...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SGE-g.............
A0A2U3W8K3_ODORO/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2K6T5V0_SAIBB/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-I...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A2I4BF38_9TELE/387-500             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.G..P.RPIKQE.....................................................PAL.ED.CHR.ELYa.......................lpRHHQH-...---....................-H...................................................PAC..TP..EP..........PG----TLEL...........----NEGH...RY.G.S..Q-.-....--......GKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
H3AHG2_LATCH/251-369                 ..................................................................................................IQARAHGLP...LM...SS..L..--..ST.VD..L.T..S.QVLKQS.....................................................-YQ.ED.STP.E--..........................------...-YL....................QQ...................................................QAL..SQ..VP..........SVDFSNRSTNfl......dplSHFTDL--...SF.S.A..AL.K....ED......QRLDEI......................LMDN...............TLSPFG..TDPLLSA.AS..PV..ASK.G..S.S.RR...S.S.F..S.SDDD..............
A0A1L8F5F4_XENLA/309-415             ..................................................................................................IQAQLHGLN...DN...PP..A..C-..KA.T-..-.-..-.DTLKSE.....................................................PTF.HS.ASP.---..........................QPPHPS...---....................--...................................................--A..LH..LG..........TLHFTDPLSH...........-------L...DF.H.L..TL.T....PD......SAIADI......................LMDD...............ALSPLG.gTDPLLSS.VS..PQ..ASR.N..S.S.PH...S.S.F..S.MEDD..............
A0A3P8ND66_ASTCA/252-407             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqs......................spQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3L8Q7K3_CHLGU/353-484             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEgsgd............................................egtlePLL.PP.PDP.ES-..........................---QPA...--L....................PA...................................................PPQ..SP..YH..........QLDFTHSLSFd........dgS------Q...GF.P.D..SA.SfpslSK......KELDLM......................LMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3Q7W6Q5_URSAR/370-495             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A1S3LMW3_SALSA/247-365             ..................................................................................................MQARAHGLT...TD...SS..D..-L..CS.AE..L.S..A.RGIKQE.....................................................PAL.GD.FHQ.DLY..........................-PVDPQ...HQH....................--...................................................---..HP..AC..........TPDQVQSTTL...........-ELNDETS...PY.T.E..GH.-....-G......GFSGEL......................RMDD...............TLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.I..S.MEEN..............
A0A384D2S5_URSMA/309-434             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A401PDV1_SCYTO/312-440             ..................................................................................................MQAQAHGLS...TV...SP..S..GL..NT.LE..I.S..G.PSIKHE....................................................eNIM.NS.LQQ.EHQ..........................HHLQPP...---....................--...................................................---..--..QS..........QLDFVQSLDLcdsslgfvdpmSQLTDL--...SF.S.M..PT.K....KE......YRLDDM.....................lMMDD...............AVSPLG..RDPLLSS.GS..PG..ASK.A..S.S.RR...S.S.I..S.IDD-a.............
A0A2K5IBY1_COLAP/323-475             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2D0RW60_ICTPU/251-380             ..................................................................................................MQARAHGLA...VG...GS..S..AL..CS.TE..L.V..A.CAIKEE.....................................................PISyTS.CSS.---..........................-DLYTR...SHL....................SS...................................................PDH..SR..PT..........TLDLNNGTISy........sdSTTEEAET..eLY.A.S..HK.E....SS......TKLDDM......................FLEN...............TLSPVG.tSNLLLSS.GS..PT..HSN.D..S.S.RR...S.S.T..S.TEEQ..............
TFEC_MOUSE/196-314                   ..................................................................................................IQARAHGLP...IL...AS..L..--..GT.AD..V.G..T.HITKQQ.....................................................---.-T.HPE.RNLgg......................ccLQLTPT...QGT....................--...................................................SPE..FY..EQ..........AVAFS----Dp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLSD...............TICPFG..TDPLLSA.IS..PA..VSK.A..S.S.R-...S.S.L..S.SEDG..............
I3KJ79_ORENI/276-428                 ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..I.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QSS.........................pQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGADACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2U4AIL8_TURTR/315-434             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A340XA22_LIPVE/232-387             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAQ.---..........................-LPPPA...QPA....................Q-...................................................-PP..SP..FH..........HLDFSHSLSF...........GGGGNEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H2V581_TAKRU/226-373                 ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.ME..L.S..S.HLLKQQ.....................................................QQQ.QQ.LSP.---..........................QAQQPQ...QPP....................LYqedpnseylq..............................rivaagvsnlpAAS..GA..QD..........HVTGADSCTTfs......dplSHFTDF--...-F.S.S..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...T.S.F..S.SAE-g.............
A0A3Q7X323_URSAR/440-565             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A096MME4_PAPAN/432-545             ..................................................................................................LQAQIHGLP...VP...PT..P..GL..--.LS..L.A..T.TSASD-.....................................................-SL.KP.EQL.DIE..........................EEGRPG...AAT....................FH...................................................VGG..GP..AQ..........NRAPISSCTA...........SRCRCL--...--.T.L..A-.-....--......-LLQNI......................LMEE...............RGRGWL..G-GLFRG.LS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A1S3LMV8_SALSA/391-509             ..................................................................................................MQARAHGLT...TD...SS..D..-L..CS.AE..L.S..A.RGIKQE.....................................................PAL.GD.FHQ.DLY..........................-PVDPQ...HQH....................--...................................................---..HP..AC..........TPDQVQSTTL...........-ELNDETS...PY.T.E..GH.-....-G......GFSGEL......................RMDD...............TLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.I..S.MEEN..............
F7DUA0_ORNAN/105-230                 ..................................................................................................MQARAHGLP...LI...PS..T..GL..CS.PD..L.V..N.RVIKQE.....................................................PIL.EN.CNQ.EVL..........................QHHPD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITfs......snlGNGTESTT...GY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-a.............
A0A402FP47_9SAUR/415-547             .......................................................................................rklqkeqqrsk---------...--...--..-..--..-E.ME..M.R..Q.RKLEQTnrsl.............................................qlrvQ--.--.---.ELElq......................vqMHGLPL...TSTp.................glLA...................................................QPL..AG..DL..........APPFAESLDL...........-PFTAEEL...GL.G.L..AL.G....SD.....gGGLQDV......................LMDEg.............aALSPLG.aSDPLLSS.IS..PG..ASK.G..S.S.RR...S.S.F..S.MEDD..............
A0A340X2F8_LIPVE/196-315             ..................................................................................................IQARAHGLP...TL...AS..R..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDV......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q2I593_HORSE/480-605             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...TCT....................TT...................................................L-D..LT..DG..........TISFNNNLGT...........--GTESNQ...AY.S.I..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
I3KT53_ORENI/332-484                 ..................................................................................................MQARLHGLP...SN...SP..S..GL..NT.GD..I.M..G.SYIKQE.....................................................TSL.EE.NHS.HPQaqgqgqpe..........prqlpplpQHLQPQ...PPI....................QY...................................................PAV..GS..SQ..........HFDFAQSLDL...........---CD-GI..sGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgdlgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2K5F4E9_AOTNA/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DS----.....................................................--L.KP.EQL.DIEeegrpga............atfhvagGPAQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2I3GFL8_NOMLE/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................---QRH...---....................--...................................................ADL..TC..TT..........TLDLTDGTITfs......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVA.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I3M436_PAPAN/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B1IZ96_ASTMX/215-369             ..................................................................................................IQARAHGLP...SA...--..-..-L..GA.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqvaq.................tvpgpQAPQAS...QPA....................LYpqedlsapeyl............................qrnplpavislaGGG..GA..AE..........QVDASTTFSDp.........lSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMED...............ALSPFG..ADPLLSA.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDN..............
A0A3B3BES9_ORYME/385-508             ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RSIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................HP...................................................ACT.pEQ..QG..........TLELNEGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
G5BNI2_HETGA/579-615                 ................................................................................................lp---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....--......------......................--ND...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5ZD31_MANLE/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q1I978_ANATE/268-355             ..........................................................................................vpsdpsll---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................QQ...................................................HAVpqSS..HS..........PLDLG-SLSF...........AELDDTSA...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cTLSPER.vAEPLFSP.LS..PG..ASK.N..S.S.RR...S.S.L..E.MDED..............
A0A2R8MPG5_CALJA/224-343             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........NPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
MITF_RAT/397-522                     ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQADL...---....................--...................................................---..TC..TT..........TLDLTDGTISft......nnlGTMPESSP...AY.S.I..PR.K....MA......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A3B3UW21_9TELE/305-440             ..................................................................................................MQARIHGLP...AA...QQ..Q..Q-..QQ.AA..V.A..V.PHAGQNpgaa............................................ttlnlS--.--.---.--Al........................gAIAQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDP--...-T.T.S..AL.Y....PD......VGLGDI......................LMDDg.............cALSPER.mGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A2K5SBS3_CEBCA/350-502             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1L8GI33_XENLA/370-493             ..................................................................................................MQARAHGLS...IM...PS..T..GL..CS.TD..L.V..N.RVIKQE.....................................................PML.DS.CNR.EML..........................QNHHDL...---....................--...................................................---..SV..TT..........TLDLTDGTITfs......nnlRNMTDSPT...AY.S.I..AT.K....LG......SKLEDI......................FMDD...............TLSPRV..NDP-YHT.IS..PG..ASK.T..S.S.RS...S.S.I..S.MEEN..............
A0A2Y9FND0_PHYMC/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q0E8A5_TARSY/327-469             ..................................................................................................LQAQIHGLP...VP...PA..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgtat.................fhvvgGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q1JF74_ANATE/369-492             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..N.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EP..........HGTLELSEDH...........SNFPEG--...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A384B6K7_BALAS/225-344             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
G3QJP3_GORGO/320-472                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I4BF40_9TELE/386-499             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.G..P.RPIKQE.....................................................PAL.ED.CHR.ELYa.......................lpRHHQH-...---....................-H...................................................PAC..TP..EP..........PG----TLEL...........----NEGH...RY.G.S..Q-.-....--......GKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3B4GMW2_9CICH/303-450             ..................................................................................................MQARLHGLS...NS...NS..V..--..SA.LS..S.D..P.SLLQQQ.....................................................STV.PQ.SSQ.SLApntggas...........nqnllgpaAIGQPL...PASflsp............pssdSP...................................................AGL..TI..SS..........PLDLG-SLSF...........AELDDPPA...--.-.S..AL.Y....SD......MGLGDI......................LMDDg.............cTLSPER.iGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A060WBS2_ONCMY/279-400             ..................................................................................................MQARAHGLA...VV...PS..P..SL..CS.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QKSGPD...---....................--...................................................--M..SP..TT..........TLDLNNGTIHf........ndSPLDAGEP..gAY.G.-..SN.K....AS......TKLKDI......................-IDN...............TLSPIS..--SLLSS.VS..PD..ASN.S..S.S.RR...S.S.S..SsMEE-n.............
H2RU81_TAKRU/248-371                 ..................................................................................................IQARAHGLS...VA...SM..S..-V..CT.SD..L.M..A.RAIKQE.....................................................SVL.GD.CPS.DLY..........................QHNSTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......rihSDSGDHG-...AF.E.N..S-.-....RN......CKLKEL......................VRDS...............SLSPLS.pSDPLLSA.MS..PD..GSV.S..N.H.HS...S.C.S..S.LEEN..............
A0A3Q3W8E4_MOLML/361-486             ..................................................................................................LQARLQTFS...SS...ST..S..PL..PT.SS..S.S..S.SSLDPQ.....................................................ALL.SP.RLP.HPF..........................------...SSS....................SS...................................................PSL..AT..P-..........SLG-LDALSF...........AELDDPRGastVF.S.P..DL.M....SDvgltglHGLGDM......................LMEE...............AEGGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
H3ATZ0_LATCH/309-434                 ..................................................................................................MQARAHGLS...LA...PS..T..GL..CA.PD..L.G..A.RIIKQE.....................................................PVL.ED.CKQ.DAL..........................QHHSNL...---....................--...................................................---..SC..TT..........TLNLTDGTITfs......envGHVVEHSG...AY.S.V..PT.K....VG......SRLEDI......................LMDD...............TLSPAG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-p.............
F7C2T4_CALJA/332-484                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2D0RXP9_ICTPU/279-408             ..................................................................................................MQARAHGLA...VG...GS..S..AL..CS.TE..L.V..A.CAIKEE.....................................................PISyTS.CSS.---..........................-DLYTR...SHL....................SS...................................................PDH..SR..PT..........TLDLNNGTISy........sdSTTEEAET..eLY.A.S..HK.E....SS......TKLDDM......................FLEN...............TLSPVG.tSNLLLSS.GS..PT..HSN.D..S.S.RR...S.S.T..S.TEEQ..............
A0A091JPP8_EGRGA/259-378             ..................................................................................................IQARAHGLP...IM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
G1M398_AILME/304-459                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................lleaevpdpeplPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGEEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A0J9YJK3_DANRE/170-299             .................................................................................................r-QAQIHGLP...SN...SP..S..GL..TN.TD..H.Q..N.PFIKQEsspeenhlq...................................hqshlppryPQQ.HP.QPH.PQLh.......................qhQHLHPQ...PPL....................QY...................................................PAV..GS..SQ..........HFDLAQSLDL...........---CDGGI..pGY.Q.D..GL.-....--......GDLGFLgggiaqmg......kkselsflLMEE...............ALS---..-------.--..--..---.-..-.-.--...-.-.-..-.----..............
F7FA62_MONDO/264-383                 ..................................................................................................IQAWAHGLP...AL...SL..H..--..SA.VD..L.A..A.HTTNHQ.....................................................TYV.ED.NSE.DYS..........................-----Q...---....................-E...................................................LTL..AP..RS..........RTDLCDGSKAfs......yplSHFTDL--...SF.S.A..AL.K....EE......QRLDDI......................LLDD...............SISPFG..TDPLLSD.AS..PT..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2Y9NZV7_DELLE/225-344             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P9N650_POERE/338-519             ..................................................................................................MQARLHGLP...SN...SP..S..AL..NP.SE..M.M..P.PYIKQEtspeqnfshaqaqvlhqsqhi...........phnqahpqqhhflpqthlhpqSQL.QP.QAR.QLPq.......................lpQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..hGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A1S3LLL2_SALSA/277-395             ..................................................................................................MQARAHGLT...TD...SS..D..-L..CS.AE..L.S..A.RGIKQE.....................................................PAL.GD.FHQ.DLY..........................-PVDPQ...HQH....................--...................................................---..HP..AC..........TPDQVQSTTL...........-ELNDETS...PY.T.E..GH.-....-G......GFSGEL......................RMDD...............TLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.I..S.MEEN..............
A0A1S3LD38_SALSA/274-419             ..................................................................................................VQAQLHGLS...SP...MS..Y..GL.sSD.PS..L.I..Q.QQHLQQgghilgprtgv..............................acsqtflslgdaA--.--.---.---..........................-MAQPI...PTSflsp............pstdSP...................................................VGV..TI..GS..........PLDLG-SLSF...........AELDDPS-...--.N.A..GL.F....PD......VGLGDI......................LMDEg.............cTLSPER..VDPLF-F.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A2D0QYF8_ICTPU/417-560             ..................................................................................................MQARLHGLV...PS...QV..S..D-..SI.VN..H.H..H.QQQQQQ.....................................................QQL.TS.VQH.TAEpvtttlltlg......gptlnhthvsSLLSPP...PSA....................SP...................................................VGG..AM..NV..........PLDLG-TLTF...........GELDDHAS..sIF.S.P..GL.M....AG.....eMGLSDI......................LMDD...............G----G..ADPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A2K6KIH3_RHIBE/165-284             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLTv.................sqGP...................................................APE..LC..DQ..........AIAFSDPLSY...........--FTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A093Q0A4_9PASS/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CTQ.DMM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A452GK47_9SAUR/380-498             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVI.DN.CNQ.DVL..........................---QRH...S--....................--...................................................-DL..SC..TT..........TLDLTDGTIT...........--FSDNLG...TY.S.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A0A3B3QJB8_9TELE/220-334             ..................................................................................................MQARAHGLA...LV...SP..T..AL..CP.SE..L.A..G.RVIKQE.....................................................PVL.GD.CLR.DPY..........................PH--PH...---....................HA...................................................SDM..SR..PT..........TLDLTDGTITy........sdGHGEPGES..aPY.T.R..PT.K....GA......SKLDDI......................LMDG...............SLSPVR.aGDPLLSS.SS..PG..---.-..-.-.--...-.-.-..-.----hac...........
A0A384AZM1_BALAS/372-497             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-t.............
A0A3Q2CCL1_CYPVA/386-508             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..V.G..V.RPIKRE.....................................................PLL.ED.CHQ.DLY..........................KLHRQH...HPA....................--...................................................CTP..EQ..ST..........TLELKEGPSN...........--FNEG--...HY.S.C.vHG.E....AE......TKLTDI......................LMED...............NLSPVR.gVDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDDN..............
A0A2I0M9R5_COLLI/311-436             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.EN.CNP.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PP.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A1U8C191_MESAU/290-415             ..................................................................................................MQARAHGLS...LI...PS..S..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPESNP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A1U8BQQ1_MESAU/381-506             ..................................................................................................MQARAHGLS...LI...PS..S..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPESNP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A2K5SBX6_CEBCA/318-470             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
K7G9S5_PELSI/259-378                 ..................................................................................................IQARAHGLP...LM...SS..L..--..SA.VD..V.A..A.QVIKQQ.....................................................-TY.PA.ENA.---..........................-TDYSQ...QLV....................-L...................................................VHG..PS..AD..........LCDGSTAFSDp.........lSYFTDL--...SF.S.A..AS.K....EE......QRLEEI......................LLDN...............TISPFG..TDPLLSS.IS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A2U3XC89_LEPWE/225-344             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..V.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1S3LCQ2_SALSA/306-451             ..................................................................................................VQAQLHGLS...SP...MS..Y..GL.sSD.PS..L.I..Q.QQHLQQgghilgprtgv..............................acsqtflslgdaA--.--.---.---..........................-MAQPI...PTSflsp............pstdSP...................................................VGV..TI..GS..........PLDLG-SLSF...........AELDDPS-...--.N.A..GL.F....PD......VGLGDI......................LMDEg.............cTLSPER..VDPLF-F.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A340WDQ6_LIPVE/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1S3MG25_SALSA/390-522             ..................................................................................................MQARAHGLT...TD...TS..A..-L..CS.TE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYh........................vH-SQHQ..hHPA....................CT...................................................PDQ..VQ..YT..........TLELNDGASPyt......kghGGVSGDQR...PY.G.G..HL.-....-K......GALMDI......................LMDD...............TLSPVR.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.K..S.MEEN..............
A0A3P8XF29_ESOLU/313-453             ..................................................................................................MQARFHGLS...SS...MS..S..GL.cSD.PS..L.Q..Q.HVHQGG.....................................................PTL.GP.SAE.DQNlls...................lqaaAMAQPV...PTSflsp............ptsnSP...................................................VGV..PV..NS..........TLDLG-SLSF...........AELDETS-...--.N.A..GL.Y....TE......VGLGDI......................LMDEs.............cTLSPER..VGPLFS-.MS..PG..ASK.N..S.S.CR...S.S.F..S.MEED..............
H3DME4_TETNG/252-368                 ..................................................................................................IQLRAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLSPQ.....................................................PQQ.PQ.QPP.-LY..........................QEDHNT...SGT....................--...................................................---..QD..HA..........TADACTTFSDp.........lSHFTDF--...-F.S.S..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSE.P-..--..ASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A2D0R090_ICTPU/425-568             ..................................................................................................MQARLHGLV...PS...QV..S..D-..SI.VN..H.H..H.QQQQQQ.....................................................QQL.TS.VQH.TAEpvtttlltlg......gptlnhthvsSLLSPP...PSA....................SP...................................................VGG..AM..NV..........PLDLG-TLTF...........GELDDHAS..sIF.S.P..GL.M....AG.....eMGLSDI......................LMDD...............G----G..ADPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
F1SFN4_PIG/360-485                   ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGSEGNP...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2R9A1Y5_PANPA/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.ESLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
D2HNA1_AILME/225-344                 ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..P.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLNDL......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2I4BF25_9TELE/387-500             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.G..P.RPIKQE.....................................................PAL.ED.CHR.ELYa.......................lpRHHQH-...---....................-H...................................................PAC..TP..EP..........PG----TLEL...........----NEGH...RY.G.S..Q-.-....--......GKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A287DDQ2_ICTTR/327-469             ..................................................................................................LQAQIHGLP...VP...PT..P..GLlsLT.TT..S.A..S.DSLKPE.....................................................-QL.DI.EEE.GRPgtaa.................fhvagGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3B5QMV3_XIPMA/356-480             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..V.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................-H...................................................PACtpEQ..PS..........TLELTEGHSN...........--FPDG--...HYgS.V..HG.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q2W9S7_HAPBU/354-483             ..................................................................................................LQARVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................spPLL.HP.FSS.---..........................---SSS...PPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DEPQGAAT...VF.S.P..DL.M....SD......MGLTDLngl................gglLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A096NU84_PAPAN/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1L8GPZ9_XENLA/266-389             ..................................................................................................MQARAHGLS...IM...PS..T..GL..CS.TD..L.V..N.RVIKQE.....................................................PML.DS.CNQ.EML..........................QNHHDL...---....................--...................................................---..SG..TT..........TLDLTDGTITfs......nnlRNMSDSPT...AY.S.I..PT.K....MG......SKLEDI......................FMDD...............TLSPRV..NDP-HHT.IS..PG..ASK.T..N.S.RR...S.S.I..S.MEEN..............
A0A0J9YJ85_DANRE/182-288             .................................................................................................r-QAQIHGLP...SN...SP..S..GL..TN.TD..H.Q..N.PFIKQEsspeenhlq...................................hqshlppryPQQ.HP.QPH.PQLh.......................qhQHLHPQ...PPL....................QY...................................................PAV..GS..SQ..........HFDLAQSLDL...........---CDGGI..pGY.Q.D..GL.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----gdlgfl........
K7G040_PELSI/312-430                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..V.V..S.RVIKQE.....................................................PVL.DN.CNQ.EVL..........................---QRH...S--....................--...................................................-DL..SC..TT..........TLDLTDGTIT...........--FSDNLG...PY.S.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vSDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
H0Z4F9_TAEGU/257-376                 ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.AD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.---..........................-VDYSQ...QMT....................--...................................................--L..VH..GQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLDEI......................LLED...............TVSQFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
TFEB_HUMAN/321-473                   ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3P9N819_POERE/209-290             .....................................................................................qtllspllpnpsl---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..-S..........FMDLDDSHQA...........------SA...VF.S.T..DL.V....AEl....gAGLSDLga..................glLMEE...............DGGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2K5ZD08_MANLE/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
F1R1N1_DANRE/312-450                 ..................................................................................................IQARHHGLN...AT...VS..P..GL..NTeAS..F.I..Q.NQLLQPnasm............................................qagvgD--.--.---.--Gqpqsh................lnmdgAMAQTS..pSPFlsv.............ppsgSP...................................................AAV..AV..SG..........PLHLE-TFSF...........TELDEH--...--.A.S..DL.Y....PD......VGLSDI......................LMDD...............V---RG..SDVLFSP.MS..PG..ASK.T..S.S.QG...S.S.V..N.MEDD..............
U3C9W3_CALJA/432-574                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvagGPTQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A091WRE9_OPIHO/252-371             ..................................................................................................IQARAHGLP...VT...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................THG..PN..SD..........ACDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSA.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
M7AKC5_CHEMY/226-345                 ..................................................................................................IQARAHGLP...LM...SS..L..--..SA.VD..V.A..A.QVIKQQ.....................................................-TY.PE.ENS.---..........................-IDYSQ...QLV....................-L...................................................VHG..PS..AD..........LCDGSTAFSDp.........lSHFTDL--...SF.S.A..AS.K....EE......QRLEEI......................LLDD...............TISPFG..TDPLLSS.IS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A1S3LLZ4_SALSA/390-508             ..................................................................................................MQARAHGLT...TD...SS..D..-L..CS.AE..L.S..A.RGIKQE.....................................................PAL.GD.FHQ.DLY..........................-PVDPQ...HQH....................--...................................................---..HP..AC..........TPDQVQSTTL...........-ELNDETS...PY.T.E..GH.-....-G......GFSGEL......................RMDD...............TLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.I..S.MEEN..............
H0ZHV0_TAEGU/339-464                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CSQ.DMM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPAG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A151NDZ6_ALLMI/452-520             ........................................................................................aclldlalaa---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........-----EDL...GF.P.L..GL.G....GG......GAFEDV......................LMEDg............ggPLSPLG.aSDPLLSA.VS..PV..ASK.G..S.S.RR...S.S.F..S.MEDE..............
A0A1S3MYS0_SALSA/319-463             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A2I2YS93_GORGO/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K6A4X5_MANLE/334-486             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A340WJG5_LIPVE/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1S3MGL3_SALSA/383-515             ..................................................................................................MQARAHGLT...TD...TS..A..-L..CS.TE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYh........................vH-SQHQ..hHPA....................CT...................................................PDQ..VQ..YT..........TLELNDGASPyt......kghGGVSGDQR...PY.G.G..HL.-....-K......GALMDI......................LMDD...............TLSPVR.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.K..S.MEEN..............
A0A3B3VXJ1_9TELE/244-372             ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpSDAGDS-A...HY.G.-..-S.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSN.P.vS.G.RHsssS.S.S..S.MEE-k.............
A0A087X6N9_POEFO/409-483             ...........................................................................................lpnpsls---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........FMDLDESHQA...........------SA...VF.S.T..DL.M....VEl....gAGLSGLga..................glLMEE...............DAGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2I3TF99_PANTR/322-474             ..................................................................................................MQARVHGLP...TA...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B4GK85_9CICH/386-509             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
F1MCS8_BOVIN/284-409                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
F6ZKQ4_HORSE/290-415                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...TCT....................TT...................................................L-D..LT..DG..........TISFNNNLGT...........--GTESNQ...AY.S.I..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2U9BH63_SCOMX/293-429             .............................................................kasvdyirklqreqqrakelecrqrkvehanrhlmlr---------...--...--..-..--..--.--..-.-..-.---IQE.....................................................PLL.GD.CPS.ELY..........................QHGSA-...---....................--...................................................PDM..SP..PT..........TLDLNNGTITfd......hipADAADPGP...-Y.G.-..-N.S....RT......LKMKEL......................ARDN...............TLSSIS.cSDPLLSS.IS..PE..GSN.V..S.S.HH..sS.S.S..S.MDD-k.............
A0A452FLE6_CAPHI/284-408             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PE..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITfn.......slGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2D0T5J5_ICTPU/269-420             ..................................................................................................IQARAHGLP...SN...--..-..-L..GA.AE..I.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QALpapav................tpgaqTSLYPQ...DELngp..............eylQRnslsvl.......................................hagnegNSS..SS..GE..........HADAT-STTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEL......................LMEE...............ALSPFG..TDPLLSA.TS..PN..ASK.G..S.S.RR...S.S.F..S.TDDN..............
A0A384D3J5_URSMA/345-470             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
I3MMJ4_ICTTR/397-539                 ..................................................................................................LQAQIHGLP...VP...PT..P..GLlsLT.TT..S.A..S.DSLKPE.....................................................-QL.DI.EEE.GRPgtaa.................fhvagGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K5ZRN0_MANLE/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2D0QYG2_ICTPU/421-564             ..................................................................................................MQARLHGLV...PS...QV..S..D-..SI.VN..H.H..H.QQQQQQ.....................................................QQL.TS.VQH.TAEpvtttlltlg......gptlnhthvsSLLSPP...PSA....................SP...................................................VGG..AM..NV..........PLDLG-TLTF...........GELDDHAS..sIF.S.P..GL.M....AG.....eMGLSDI......................LMDD...............G----G..ADPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A1U7TSJ2_TARSY/230-382             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.TE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-ATQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGDDEGP..pGY.P.D..PL.G....PEh....gSPFPNLskkd..............ldlmLLDN...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I3MQL1_PAPAN/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4VBH2_SERDU/386-509             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................TFHPHH...QHH....................PA...................................................CTP..EP..PS..........TLELNEGHSN...........--FPDG--...HY.S.V..HS.K....PS......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2R8Q839_DANRE/381-428             ..................................................................................................IQARAHGLA...MA...SS..A..-L..CA.SE..L.A..A.RAIKQE.....................................................PLL.GD.CSQ.DMY..........................TSTHAH...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----psc...........
A0A2K6JXN7_RHIBE/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B5BK74_9TELE/296-422             ..................................................................................................IQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QQS--S...---....................-A...................................................PDM..SP..PT..........TLDLNNGTITfd......qipADTGDP-G...PY.G.N..S-.-....QP......CKMKEL......................VRNN...............SLGPIS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MEEK..............
A0A2I2UHM0_FELCA/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3UST0_9TELE/277-405             ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpSDAGDS-A...HY.G.-..-S.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSN.P.vS.G.RHsssS.S.S..S.MEE-k.............
A0A3B4TVN6_SERDU/251-419             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..T.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQ..........................QQQQQQ...QQQ....................QQqqqsspqaqqpqqpplyqe............dpssdylqrlavvagvpsipTAS..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
A0A2D0T5B1_ICTPU/206-357             ..................................................................................................IQARAHGLP...SN...--..-..-L..GA.AE..I.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QALpapav................tpgaqTSLYPQ...DELngp..............eylQRnslsvl.......................................hagnegNSS..SS..GE..........HADAT-STTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEL......................LMEE...............ALSPFG..TDPLLSA.TS..PN..ASK.G..S.S.RR...S.S.F..S.TDDN..............
A0A2I3S4B4_PANTR/236-388             ..................................................................................................MQARVHGLP...TA...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
F7FXN6_MACMU/335-487                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S2ZRD7_ERIEU/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3D2S0_ORYME/386-509             ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RSIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................HP...................................................ACT.pEQ..QG..........TLELNEGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
B1AKB5_HUMAN/179-331                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2U9B247_SCOMX/273-390             ..................................................................................................IQARAHGLP...NM...TT..S..-L..GT.ED..P.N..S.DYLQRI.....................................................AAV.AG.GPS.---..........................---HPT...---....................--...................................................-AS..GP..QD..........HTTGADGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLST.GS..PG.pASK.D..S.S.RR...S.S.F..S.S---ggg...........
H0X1Z8_OTOGA/327-479                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mmgaevpdpeplP--.--.---.---..........................-ALPPQ...APL....................GP...................................................PAQppSP..FH..........HLDFSHSLSF...........GGGDDEGP..pGY.P.G..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B3WXU7_9TELE/356-480             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..A.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................-H...................................................PAG..TP..EQp........sTLELTKGHSN...........--FPEG--...HY.GsV..HG.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3B3WZF4_9TELE/330-490             ..................................................................................................MQAQLHGLP...SN...SP..S..AL..NP.SE..M.M..P.PYIKQEtspeqnfshaqa.............................qalhqsqhiphnQAQ.PQ.QH-.--Hf.......................lpQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..hGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2Y9FSE4_PHYMC/225-344             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q2I5C5_HORSE/364-519             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAP.LPP..........................PAQPPQ...PP-....................--...................................................---..SS..FH..........HLDFSHSLSF...........GDGGDEGP..pGY.P.E..PL.G....PEh....gSLFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A340WTP5_LIPVE/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQST...PHQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K5EA43_AOTNA/317-436             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QTS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLHD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A2Y9FQE9_PHYMC/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3P8VTL4_CYNSE/335-484             ..................................................................................................IQARAHGLP...NM...TT..S..-Q..GT.VE..L.T..S.HLLKQQ.....................................................-QQ.QQ.QPQ.QRS..........................-PPQAQ..qPPL....................YQeepnndylqr..............................iaavagmpsipGAG..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....DE......QRLEEI......................LIDE...............ALSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
A0A2Y9SA46_PHYMC/458-600             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQST...PHQ....................QP...................................................PAP..PT..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q3WBK2_MOLML/335-484             ..................................................................................................MQARLHGLP...SN...SP..S..GL..NP.AE..L.M..N.PFIKQEtspenlph....................................pqaqaqpqaRQL.PP.LPP.---..........................-HMQTQ...QAM....................QF...................................................LSV..GG..SQ..........PYDFAPSLDF...........---SD-GI..pAF.S.D..GM.-....--......SGLGDLggldvqg.......rrpelgflMMEE...............PLSPIG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2U3W8L7_ODORO/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2K6T5W2_SAIBB/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-I...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A151MKJ3_ALLMI/396-505             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..-.V..N.RVIKQE.....................................................SVI.DN.CNP.DIV..........................QHRTDL...---....................--...................................................---..SC..TT..........TLDLTDGTITfs......dnlGNVTDSSS...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPD-..-------.--..--..---.-..-.-.--...-.-.-..-.----evvtskpdlskpgv
A0A3Q4I8I7_NEOBR/243-369             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3B3C1R4_ORYME/251-401             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..N.HLLKQP.....................................................-QQ.PQ.QQQ.SPP..........................QAPQPQ...QAP...................lYQedpnndylqr..............................iavvtgvpsiaAAG..TP..QD..........HISGGDACTTfs......dplSHFTDF--...-F.T.A..SL.K....EE......NQLDEI......................LMDE...............ALSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SGE-g.............
A0A2K5LC64_CERAT/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3P9NBI1_POERE/356-480             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..V.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH..hQHH....................PA...................................................CTP..EQ..PS..........TLDLTEGHSN...........--FPEG--...HYgS.V..HG.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.XS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q3APF9_KRYMA/252-374             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.E..A.RTIKQE.....................................................PAL.ED.CHR.DLY..........................-TLHPH...HHH....................HH...................................................HLH..QH..QH..........HAGCAPEQAG...........AQPELGEG...HY.S.A..Q-.-....--......SKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2K5WMF9_MACFA/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3P8QQX8_ASTCA/303-450             ..................................................................................................MQARLHGLS...NS...NS..V..--..SA.LS..S.D..P.SLLQQQ.....................................................STV.PQ.SSQ.SLApntggas...........nqnllgpaAIGQPL...PASflsp............pssdSP...................................................AGL..TI..SS..........PLDLG-SLSF...........AELDDPPA...--.-.S..AL.Y....SD......MGLGDI......................LMDDg.............cTLSPER.iGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A452SCY6_URSAM/290-414             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn.......nlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A3Q3B5C0_KRYMA/285-469             ..................................................................................................MQAHMHGLP...ST...SP..S..GI..NL.TE..V.M..S.PYVKQEtspeenfshpqpqahhqhqhqhqh....lphnqaqpqvqqhhflpqtnlhpqgQAL.PP.PRQ.MP-..........................PLQHLQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgelgflMMDE...............PLSPIS..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A4D9DZX2_9SAUR/319-459             ..................................................................................................MQARLHGLP...AS...SP..S..GV..NV.AE..L.V..Q.QVVKQEvtge............................................dgsmePQQ.PQ.LPP.DQE..........................TQQQPP...L--....................-P...................................................LLP..PS..PY..........QLDFTHGLSF...........---DDGSR...GF.R.D..QL.D....PSh....nVSFPSLskke..............ldlmLMED...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3B3U917_9TELE/146-327             ..................................................................................................MQAQLHGLP...SN...SP..S..AL..NP.SE..M.M..P.PYIKQEtspeqnfshaqaqvlhqsqhi...........phnqaqpqqhhflpqahlhpqSQL.QP.QAR.QLPp.......................lpQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..hGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
M3YZV7_MUSPF/391-516                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A3Q7WS33_URSAR/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A1S2ZRC0_ERIEU/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2R8RRI1_DANRE/331-490             .................................................................................................r-QAQIHGLP...SN...SP..S..GL..TN.TD..H.Q..N.PFIKQEsspeenhlq...................................hqshlppryPQQ.HP.QPH.PQLh.......................qhQHLHPQ...PPL....................QY...................................................PAV..GS..SQ..........HFDLAQSLDL...........---CDGGI..pGY.Q.D..GL.-....--......GDLGFLgggiaqmg......kkselsflLMEE...............ALSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IED-s.............
A0A2I2UUF2_FELCA/285-404             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
I3KWS2_ORENI/309-456                 ..................................................................................................MQARLHGLS...SS...--..N..NI..SA.LS..S.D..P.SLLQQQ.....................................................STV.PQ.SSQ.SLApntggas...........nqnllgpvAIGQPL...PASflsp............pssdSP...................................................AGL..TI..SS..........PLDLG-SLSF...........AELDDPPA...--.-.S..AL.Y....SD......MGLGDI......................LMDDg.............cTLSPER.iGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A2I2Y6F0_GORGO/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3P8YT87_ESOLU/421-567             ..................................................................................................MQARLHGIS...TP...AS..S..SL..GS.SS..-.S..H.LSISQS.....................................................--M.DP.STG.DVLsktllslgg........gsglqaassFMSPPP...SAS....................PV...................................................GLM..NM..AS..........PLDLD-SLSF...........SELDDPST..rAF.H.S..SL.L....PD......MGLGDI......................LMDDa............gmGMSPVG.gHDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A2K5RBV2_CEBCA/290-415             ..................................................................................................MQARAHGLS...LI...PT..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K5IEL2_COLAP/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......snlGAGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I4BXE1_9TELE/252-401             ..................................................................................................IQARAHGLP...NM...AN..T..-L..GT.VD..L.S..S.HLLKQQ.....................................................QQQ.QQ.QSP.--S..........................QAQQPQ...QPP....................LYqedpnsdylqr.............................iavltgvpsitAVS..GT..QD..........HIQGADAGTTfs......dplSHFTDF--...-F.A.S..TL.K....EE......NQLNEI......................LMDD...............PLSPFG..TDPLLSA.SS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A3P9DH70_9CICH/228-382             ...........................................................................................hthslsr-------LP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQs.......................spQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3B4X6X5_SERLL/276-402             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......qipEDAGDV-G...PY.G.-..-N.S....RT......CKMKEL......................VRDN...............TLSSIS.pTDPLLSS.MS..PD..VSN.N.vS.S.HH...S.S.T.sS.MEE-k.............
A0A2K5WMD0_MACFA/366-491             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I4BF31_9TELE/386-499             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.G..P.RPIKQE.....................................................PAL.ED.CHR.ELYa.......................lpRHHQH-...---....................-H...................................................PAC..TP..EP..........PG----TLEL...........----NEGH...RY.G.S..Q-.-....--......GKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2U4C179_TURTR/241-383             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQST...PHQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A452SQA9_URSAM/384-564             tilkasvdyirklqkeqqrskdlesrqrsleqanrslqlriqvwdkeavaevtgvxslattsasdslkpeqldveeegrpgaapfhaaggpaqsaphq---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................HP...................................................PAP..PS..DA..........LLDL----HFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2U3W8K5_ODORO/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2K5MJV1_CERAT/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A0A0AQZ7_CHAVO/345-484             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEaggd............................................egtlePLL.PP.PDP.---..........................-ESQPQ...PAL....................PP...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGSR...GF.P.D..SL.E....PGh....sASFPSLskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A2R9CFP5_PANPA/366-491             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A498MFP5_LABRO/814-956             ..................................................................................................MQARHHGLS...AA...VP..P..GL..SAeAS.fL.Q..Q.QLLQGN.....................................................QSM.QP.GTG.ESQp.......................qsH-----...--Lsitqtstss..flaippsgsPA...................................................AAA..AV..SG..........PLDLD-TFSF...........AELDESSA...--.-.S..DL.Y....PD......VGLSDI......................LMDDg.............cTMPAVR.sSDLLFSP.MS..PG..ASK.T..S.S.RR...S.S.V..T.MEDD..............
A0A1S3FFX9_DIPOR/226-345             ..................................................................................................IQARAHGLP...AL...TS..L..--..GM.VG..L.E..A.HLTKQQ.....................................................-SH.PE.QNS.V--..........................DYCQQL...NLF....................--...................................................-QR..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDSL......................LLED...............TISPFG..TDPLLSA.TS..PA..VSK.A..S.S.RR...S.S.F..S.SEDG..............
A0A3Q0TCQ7_AMPCI/327-493             ..................................................................................................MQARLHGLP...SS...SP..S..GM..NP.AD..I.M..A.SYIKQEtsleenhshpqaqahhq...................pqhllhnqahpqaqpepRQL.--.---.--Pp.......................lpQHLQPQ...PPI....................QF...................................................PAV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLcgldlqg.......rrgelsfhMMDE...............PLSPMG..GDPLLSA.MS..PE..ESV.D..S.S.RR...S.S.F..S.IEDG..............
A0A087RGR0_APTFO/259-378             ..................................................................................................IQARAHGLP...VM...SS..L..--..GA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.DNS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3B4CRI9_PYGNA/240-387             ..................................................................................................IQARAHGLP...ST...--..-..-L..GA.VE..L.S..S.HLLKQQ.....................................................QHQ.AP.QPV.QGP..........................QAPQAS...QPA....................LYpqeelngpeylq..........................rtslpsivpagggGGG..GV..SE..........QADVSTTFSDp.........lSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDE...............ALSPFG..ADPLLSA.TS..PA..ASK.G..S.S.RR...S.S.F..S.TDDG..............
A0A3Q7WKC5_URSAR/315-434             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A384D3P4_URSMA/339-464             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2I3GJ87_NOMLE/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................---QRH...---....................--...................................................ADL..TC..TT..........TLDLTDGTITfs......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVA.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I3RP34_PANTR/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYC-...---....................QQ...................................................LTV..SQ..RP..........SPEFCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
H2M3V1_ORYLA/252-401                 ..................................................................................................IQARAHGLP...NM...TT..A..-L..GT.VE..L.S..N.HLLKQP.....................................................QQQ.QQ.QSP.--P..........................QAPQPQ...QAT....................LYqedpnndylqr.............................iaavtaipsitAAG..PT..QD..........HISGGDACTTfs......dplSHFTDF--...-F.T.A..SL.K....EE......NQLDEI......................LMDE...............ALSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SGE-g.............
A0A3Q2DS07_CYPVA/328-509             ..................................................................................................MQARLHGLP...ST...SP..S..GL..NP.GE..M.M..P.AYIKQEtspeqnfshaqqqalhqpqhl...........phnqaqpqqhhflpqphmhpqNQL.QP.QPR.QLPp.......................mpQHLPPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelsflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3B3DEK3_ORYME/375-488             .................................................................................................q-QARQHGLS...SS...SS..V..--..EP.QS..L.-..-.------.....................................................-LL.PP.LPP.PISa.......................ssSSSLPP...LSL....................RE...................................................DAL..SF..VE..........PDDPLQAGTVf.........sSDLICD--...--.-.L..AL.T....EM......HDLQGL......................LMEN...............GQRGSE..YNPLLSC.A-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A455AI20_PHYMC/380-505             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A452SCW4_URSAM/373-497             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn.......nlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A3P8VGC7_CYNSE/248-373             ..................................................................................................IQARAHGLT...VV...SS..P..PV..CT.SE..L.L..A.RAIKQE.....................................................PIL.GD.CPS.EVY..........................RCGSPP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......qvsVDSGDS-G...LY.G.-..-N.S....RT......CKMKEL......................VRNN...............SLSSLS..SNDLLSS.LS..PE..GSN.TmsS.H.HC...S.S.S..N.MEEK..............
A0A452F9T1_CAPHI/196-315             ..................................................................................................IQARAHGLP...TL...AS..L..--..VT.VD..L.G..A.HITKQQ.....................................................THL.EQ.NSG.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDNM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SEDG..............
A0A2K5JG66_COLAP/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
Q3UKG7_MOUSE/379-531                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsedgpgeal..............................mlgpevpepeqmPAL.PP.QAP.LP-..........................SAAQPQ...SPF....................--...................................................---..--..-H..........HLDFSHGLSF...........GGGGDEGP..tGY.P.D..TL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
F6WH91_ORNAN/229-350                 ..................................................................................................IQAHAHGLP...IV...ST..L..--..NT.FD..L.A..A.QVIKQQ.....................................................--M.HP.EEN.SNS..........................-VDYSQ...QLS....................--...................................................LSH..GP..SS..........DVSVG-STAFsd.......plSHFTDL--...SF.S.A..AQ.K....EE......QRLEEI......................LLDD...............ALSPFG..TDPLLCA.PS..PT..VSK.E..S.S.RR...S.S.F..S.SDN-g.............
A0A096MHP8_POEFO/330-511             ..................................................................................................MQAQLHGLP...SN...SP..S..AL..NP.SE..M.M..P.PYIKQEtspeqnfshaqaqalhqsqhi...........phnqaqpqqhhflpqahlhpqSQL.QP.QAR.QLPp.......................lpQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..hGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2Y9QNU1_TRIMA/372-497             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RVIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHTDL...T--....................--...................................................---..-C..TT..........TLDLTDGTITfn......nslGTGTESNQ...VY.C.V..PA.K....MG......AKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
M3YQ82_MUSPF/320-475                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................lleaevpdpeplPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5Q0P8_CEBCA/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-V----...DYC....................QQ...................................................LTV..SQ..GR..........SLELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A151PEX7_ALLMI/143-262             ..................................................................................................IQARAHGLP...VM...SS..L..--..AA.VD..L.A..A.QVIKQQ.....................................................-TY.PE.ENV.---..........................-IDYSQ...QMA....................-L...................................................THG..PS..SD..........ICDGSIAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TISPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3B1JUD6_ASTMX/425-572             ..................................................................................................MQARVHGIA...ST...--..Q..G-..SD.ST..L.L..Q.QQQQQQhqttil.........................................dssnepH--.--.---.--Sktlltlcg.........pglnqttisTLLSPP...PSA....................SP...................................................VGG..AM..TV..........PLDLG-TLSF...........GELDDPTS..sMF.T.S..TL.M....GE......MDLGDI......................LMDDa.............gALSPVG.gGDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A0D9RKQ6_CHLSB/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
F7E1U7_HORSE/320-475                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAP.LPP..........................PAQPPQ...PP-....................--...................................................---..SS..FH..........HLDFSHSLSF...........GDGGDEGP..pGY.P.E..PL.G....PEh....gSLFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
L9J913_TUPCH/288-382                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGPGTESNP...PY.S.V..PT.K....MG......SKLEDI......................LX--...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----xxxxx.........
A0A2K6EJZ5_PROCO/319-471             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpgeegpgetl..............................mlgaevpdpeplP--.--.---.---..........................-ALPPQ...APL....................GP...................................................PAQppSP..FH..........HLDFSHSLSF...........AGGDDEGP..pGY.P.E..AL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
W5NG68_LEPOC/315-441                 ..................................................................................................IQARAHGLP...TM...AS..S..-L..GA.VE..L.S..S.HLMKQP.....................................................-HQ.PQ.QQP.--Y..........................QEELNG...LYV....................QQ...................................................AAG..PP..MP..........GVDHGDGSTTfs......dplSHFTDF--...SF.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.TS..PV..ASK.G..S.S.RR...S.S.F..S.TDDG..............
A0A2R8Q378_DANRE/353-462             ..................................................................................................IQARHHGLN...AT...VS..P..GL..NT.EA..-.-..-.SFIQNQ.....................................................-LL.QP.NAS.MQAg........................vGDGQPQ...SH-....................--...................................................---..--..-L..........NMDGAMTFSF...........TELDE---...-H.A.S..DL.Y....PD......VGLSDI......................LMDD...............V---RG..SDVLFSP.MS..PG..ASK.T..S.S.QG...S.S.I..N.MEDD..............
A0A151MKD0_ALLMI/396-517             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..-.V..N.RVIKQE.....................................................SVI.DN.CNP.DIV..........................QHRTDL...---....................--...................................................---..SC..TT..........TLDLTDGTITfs......dnlGNVTDSSS...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..-.----np............
A0A2D0QYQ1_ICTPU/413-556             ..................................................................................................MQARLHGLV...PS...QV..S..D-..SI.VN..H.H..H.QQQQQQ.....................................................QQL.TS.VQH.TAEpvtttlltlg......gptlnhthvsSLLSPP...PSA....................SP...................................................VGG..AM..NV..........PLDLG-TLTF...........GELDDHAS..sIF.S.P..GL.M....AG.....eMGLSDI......................LMDD...............G----G..ADPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A3Q3RWW1_9TELE/327-408             ..................................................................................................MQARLHGLP...ST...SP..S..VL..NP.ND..L.M..A.PYIKQEtspeenlsl...................................pqvqahhhpQHL.PQ.NQA.QHQ..........................AQHQAQ...---....................-H...................................................QAQ..HQ..--..........----------...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----aqqhhflpqnhl..
A0A3Q2WJV8_HAPBU/358-481             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
H1A498_TAEGU/138-183                 ..................................................................................................MHARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEaagt.............................................rgtlE--.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----sllpppdp......
A0A2I4BXD4_9TELE/276-425             ..................................................................................................IQARAHGLP...NM...AN..T..-L..GT.VD..L.S..S.HLLKQQ.....................................................QQQ.QQ.QSP.--S..........................QAQQPQ...QPP....................LYqedpnsdylqr.............................iavltgvpsitAVS..GT..QD..........HIQGADAGTTfs......dplSHFTDF--...-F.A.S..TL.K....EE......NQLNEI......................LMDD...............PLSPFG..TDPLLSA.SS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A2K6PBJ5_RHIRO/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3B3QFI1_9TELE/237-351             ..................................................................................................MQARAHGLA...LV...SP..T..AL..CP.SE..L.A..G.RVIKQE.....................................................PVL.GD.CLR.DPY..........................PH--PH...---....................HA...................................................SDM..SR..PT..........TLDLTDGTITy........sdGHGEPGES..aPY.T.R..PT.K....GA......SKLDDI......................LMDG...............SLSPVR.aGDPLLSS.SS..PG..---.-..-.-.--...-.-.-..-.----hac...........
A0A1S3SG07_SALSA/254-399             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A2K6ALQ3_MACNE/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
F6S413_CALJA/375-500                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
M3ZJ12_XIPMA/272-400                 ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpADAGDS-A...HY.G.-..-N.S....RT......CKMKEL......................VRDN...............GLGPVS.pSDPLLSS.MS..PE..VSHpA..S.S.RH...S.S.S..S.S---ssmeek........
F7FA74_CALJA/391-516                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4X030_SERLL/252-375             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................TFHPHH...QHH....................PA...................................................CTP..EP..PS..........TLELNEGHSN...........--FPDG--...HY.S.V..HS.K....PS......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
U3KG20_FICAL/278-403                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CSQ.DMM..........................PHHTDL...---....................--...................................................---..SC..TT..........TLDLTDGTISfs......dslGNVTDPAG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
G1N9V6_MELGA/257-376                 ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVTKQR.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................VHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TISPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A2D0PJW7_ICTPU/355-527             ..................................................................................................MQARMHGLP...ST...SP..S..GL..NN.IE..P.Q..N.QFVKQEnspdelhhqrppph.........................qpphlhsqppqlhpQQL.HP.---.--Qqlh....................pqaSQLPPQ...QPL....................QY...................................................SAV..GS..TQ..........PFNFSHSLDL...........---CDGGM..aGY.A.D..GM.-....--......GCLGDLgsiggtvggt.mvhagkksdmaWMDE...............ALSPLG..TDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IDD-s.............
A0A3P9A3Z0_ESOLU/261-407             ..................................................................................................IQALAHGLP...NM...AT..S..-L..GT.VE..L.S..S.HLLKQQ.....................................................-QQ.QH.QPQ.ASQp.......................eeTQKGPQ...PPM....................YQeevngeyl..................................qrtsmpamaPGA..TE..QG..........PGAVDGSTTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMED...............PLSPFA..TDPLLSA.GS..PA..TSK.D..S.S.QR...S.S.F..S.SDDE..............
A0A1S3LCV8_SALSA/283-408             ..................................................................................................MQARAHGLA...IL...PS..S..SL..CS.SE..L.I..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QQPGPD...--M....................--...................................................---..SP..PT..........TLDLNNGTIHf........ndSPLDAGDP..gVY.G.-..SS.K....AS......TKLKDI......................LMDN...............TLSPIS.sNDPLLSS.AS..PD..TSN.S..S.S.RR...S.S.S..SsMEE-n.............
A0A3Q0SYK4_AMPCI/247-373             ..................................................................................................IQARAHGLT...VV...SS..T..SV..CA.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITf.........dQIPTDAGEp.gPY.G.S..S-.-....SA......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDvsSSI.D..S.H.HT...S.S.S..S.LDDK..............
F6R8X8_MONDO/487-555                 .........................................................................................elgedpfql---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....--......-GLEDI......................LMEEeeaaaagalgpspggGLSPLRaaTDPLLSS.VS..PA..QSK.G.sS.S.RR...S.S.F..S.MEEE..............
A0A3B4AQ36_9GOBI/274-396             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RQIKQE.....................................................PTM.ED.CHQ.DIY..........................-TLHPQ...H--....................-H...................................................QAC..TP..DHp........tSLELSDGHGN...........---YQESS...HY.S.V..HN.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASQ.D..S.S.RK...S.S.V..S.MDEN..............
A0A2U3Y3Z5_LEPWE/429-570             ..................................................................................................LQAQIHGLP...VP...PS..P..GL.lSL.AT..TsA..S.DGLKPE.....................................................-QL.DV.EEE.GRPatap.................fpaagGSAQSA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeeggv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
TFEC_CHICK/255-374                   ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QQLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A0D9RFT9_CHLSB/320-472             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pSY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLED...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
G1SH07_RABIT/397-522                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.ELL..........................QHHADL...---....................--...................................................---..TC..ST..........TLDLTDGTITfn......nglGTGTESSQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPAG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
F6UXW1_MACMU/290-415                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3P8U8Q1_AMPPE/272-398             ..................................................................................................IQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTISfd......hipADAGDP-G...SY.G.-..-N.S....RT......CKMKEL......................VRDN...............GLGPIS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MDEK..............
F1Q885_DANRE/381-496                 ..................................................................................................IQARAHGLA...MA...SS..A..-L..CA.SE..L.A..A.RAIKQE.....................................................PLL.GD.CSQ.DMY..........................TSTHAH...PSC....................--...................................................ADM..SR..SS..........TLDLNNGTIS...........--FSDT--...HL.S.D..TH.-....-A......AKLDDI......................LMDE...............TLTSGA.tNESLISA.A-..--..-SN.E..S.T.HK...D.S.M..N.MEEN..............
A0A2Y9J775_ENHLU/396-521             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
F1MX26_BOVIN/320-475                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAP.LPP..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHNLSF...........GGGGNEGP..pGY.P.E..PL.G....PEh....aSPFPDLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2U3W8M2_ODORO/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A1D5NZC5_CHICK/353-490             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEagad............................................egmlePLL.PP.PDP.ESQ..........................PVLPPL...---....................--...................................................-PQ..SP..YH..........QLDFSHSLSF...........---DDGSQ...SF.P.D..SL.E....PSh....gASFPSLskke..............ldlmLLQD...............TMLPLA..SDPLFSA.VS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A287D1E0_ICTTR/319-471             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpealP--.-A.---.---..........................--LPPQ...APL....................PP...................................................PAQppSP..FH..........HLDFSQSLGF...........GGGSDEGT..aGY.S.D..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2D0T5A6_ICTPU/293-444             ..................................................................................................IQARAHGLP...SN...--..-..-L..GA.AE..I.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QALpapav................tpgaqTSLYPQ...DELngp..............eylQRnslsvl.......................................hagnegNSS..SS..GE..........HADAT-STTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEL......................LMEE...............ALSPFG..TDPLLSA.TS..PN..ASK.G..S.S.RR...S.S.F..S.TDDN..............
A0A286Y3C9_CAVPO/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DIL..........................QHHPDL...SCT....................T-...................................................TLD..LT..DG..........TISFNSNLGT...........--GAEGNP...AY.S.V..PT.K....MA......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I3M228_PAPAN/321-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAT.LPL..........................-PTQ--...---....................--...................................................-PP..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PQh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A099Z8L4_TINGU/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLL..........................QHHADL...---....................--...................................................---..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2U4CCZ7_TURTR/228-353             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A286XDK3_CAVPO/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DIL..........................QHHPDL...SCT....................T-...................................................TLD..LT..DG..........TISFNSNLGT...........--GAEGNP...AY.S.V..PT.K....MA......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A493TBY9_ANAPP/346-471             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PAL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNMTEPTG...TY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A287CTT0_ICTTR/263-387             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHQAEL...---....................--...................................................-AC..TS..LD..........LTDGTLAFSSs.........lGPTAEGAQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPAG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A3B4APL2_9GOBI/269-391             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RQIKQE.....................................................PTM.ED.CHQ.DIY..........................-TLHPQ...H--....................-H...................................................QAC..TP..DHp........tSLELSDGHGN...........---YQESS...HY.S.V..HN.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASQ.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q3M635_9LABR/429-611             ..................................................................................................MQARLHGLP...SN...SP..S..GL..NP.ND..L.M..A.SYVKQEtspednlshpqihhqaqhlaqnq.......aqpqaqqhhhflpqnhlhhqnqaQ--.--.---.--Hqhrq.................lpplpQHLQPQ...LPI....................QY...................................................PSV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqg.......krgelgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ESV.D..S.S.RR...S.S.F..S.IEDG..............
A0A287BAS8_PIG/192-311               ..................................................................................................LQARAHGLP...IL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................SHL.EQ.NSV.DCC..........................QQ----...--L....................TL...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q7R342_VULVU/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...P--....................--...................................................---..-C..TT..........TLDLTDGSITfn......nnlGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4BUW4_PYGNA/301-439             ..................................................................................................MQARLHGLS...SNl.sSS..S..GI..SS.DS..P.F..L.QPPAQA.....................................................SVG.EP.LSH.SHThlgldg..............avgqtsSFLAP-...PPS....................GS...................................................PGL..AL..AA..........PLDLG-TLSF...........SELDEP-A...--.G.S..SL.Y....PD......VSLGDM......................LMEE..............cTLSPGT.aPNALLNS.NS..PG..ASK.T..S.S.QR...S.S.L..D.MEED..............
A0A3Q2C8H9_CYPVA/344-453             ..................................................................................................LQARLNGLS...SS...SS..S..A-..--.--..-.S..T.PLTSSS.....................................................SSL.DP.NTH.--L..........................SPLLPN...---....................--...................................................---..PS..LS..........FMDLEESHAT...........------PT...VF.S.P..DL.L....PG......VGLTELssl................ggfLMEE...............DGGAAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A099YZY9_TINGU/258-377             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..V.A..A.QVIKQR.....................................................-SY.PE.ENS.---..........................-VDYSQ...---....................-Q...................................................MSL..AH..GQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.AS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A1S3SG09_SALSA/244-389             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A384AYN5_BALAS/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-t.............
A0A3Q3LEZ8_9TELE/276-429             ..................................................................................................IQARAHGLP...NM...TT..A..-L..GN.IE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQSs........................pQTQQPQ...QPP....................LYqedpnsdylqr.............................iaaaagvstipSAG..GP..QD..........QITGADSCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2K5F4M1_AOTNA/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DS----.....................................................--L.KP.EQL.DIEeegrpga............atfhvagGPAQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3P8Y3V8_ESOLU/317-481             ..................................................................................................MQARLHGIP...CS...SP..S..GM..GS.GD..P.A..G.SYVKQEtspeeklhqqhqqvqt.....................qgqqhlhhpqshhlqpRQL.PP.LPP.---..........................-HLQPQ...LPL....................QY...................................................PAV..GS..SQ..........PFDFAQSLDL...........---CDG-V..pGY.P.D..GL.-....--......SGLGDLgllgtqg.......rrgdlgfmMMDE...............PLSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IED-a.............
A0A2U4CCY7_TURTR/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3CVU7_ORYME/370-514             ..................................................................................................MQARLHGLS...NPtgiSA..D..LN..SD.PS..-.-..L.QPVSQS....................................................gQAL.PQ.NTG.VGApqnllglg..........avgasmptSF----...--Lspp..............ssdSP...................................................AGV..TL..SS..........PLDLG-SLSF...........AELDDTSA...--.-.A..AL.Y....PD......VGLGDI......................LMDEg.............cVLSPDR.vGESLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..D.MDED..............
I3LP73_PIG/366-491                   ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGSEGNP...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2Y9QMG9_TRIMA/210-329             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.MD..L.G..A.QVTKQQ.....................................................-TH.PE.QNS.---..........................-VDYCQ...QLT....................-L...................................................SQG..PS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDVM......................LLDD...............TISPFG..TDPLLSA.TS..PT..ASK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2K6A510_MANLE/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q0GKJ6_ALLSI/157-276             ..................................................................................................IQARAHGLP...VM...SS..L..--..AA.VD..L.A..A.QVIKQQ.....................................................-TY.PE.ENV.---..........................-IDYSQ...QMA....................-L...................................................THG..PS..SD..........ICDGSIAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TISPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A401TCP5_CHIPU/2-83                .........................................................................pqavgpsmdlgldlglglsdqplaf---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........DSMTD--M...PF.P.-..-L.K....LD......SGLGNI......................LMDD...............LLSPVG.tTDPLLSS.VS..PG..VSK.G..S.S.RR...S.S.F..S.MEDE..............
A0A2R9BVK9_PANPA/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDN...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S3LLL8_SALSA/362-480             ..................................................................................................MQARAHGLT...TD...SS..D..-L..CS.AE..L.S..A.RGIKQE.....................................................PAL.GD.FHQ.DLY..........................-PVDPQ...HQH....................--...................................................---..HP..AC..........TPDQVQSTTL...........-ELNDETS...PY.T.E..GH.-....-G......GFSGEL......................RMDD...............TLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.I..S.MEEN..............
A0A3Q2WFB4_HAPBU/394-513             ....................................................................................lshthfhpqgqaqp---------...--...--..-..--..--.--..-.-..-.----EP.....................................................RQL.PP.LPQ.---..........................-HLQPQ...PPI....................QY...................................................PAV..GS..SQ..........HFDFAQSLDL...........---CD-GI..sGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgdlgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2Y9NR18_DELLE/227-382             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAQ.---..........................-LPPPA...QPA....................Q-...................................................-PP..SP..FH..........HLDFSHSLSF...........GGGGNEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H2M3V0_ORYLA/251-400                 ..................................................................................................IQARAHGLP...NM...TT..A..-L..GT.VE..L.S..N.HLLKQP.....................................................QQQ.QQ.QSP.--P..........................QAPQPQ...QAT....................LYqedpnndylqr.............................iaavtaipsitAAG..PT..QD..........HISGGDACTTfs......dplSHFTDF--...-F.T.A..SL.K....EE......NQLDEI......................LMDE...............ALSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SGE-g.............
A0A0G2K5U8_RAT/381-506               ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQADL...---....................--...................................................---..TC..TT..........TLDLTDGTISft......nnlGTMPESSP...AY.S.I..PR.K....MA......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A3Q4H6R5_NEOBR/387-510             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3P9P2W5_POERE/252-400             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.SP.SQV.---..........................QQQQPQ..qPPI....................YQedpnsdylqr..............................iavvtgvpsiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLDEI......................LMDD...............PLSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A3Q1CZU0_AMPOC/349-472             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..P.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EPp........gTLELSEGHSN...........----YPEG...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A1S3A5R7_ERIEU/322-477             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpgeedlgeal..............................llgaevpdpeplPAL.PP.QAP.LPPp........................tQPPP--...---....................--...................................................-PQ..SP..FH..........HLDFSQGLSF...........GGGSDEGP..pNY.P.E..AM.G....PEh....gSMFPTLskkd..............ldlmLLDD...............TLLPLT..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
G1KP22_ANOCA/291-417                 ..................................................................................................MQARAHGLS...II...PT..S..GL..CS.PE..M.V..N.RLIKQE.....................................................PVL.DN.CSQ.EIL..........................QHHPDL...SC-....................--...................................................---..--..TT..........TLDLTDGTITfn......dslANVTESTT..gTY.A.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.V..S.MED-t.............
A0A2Y9J239_ENHLU/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A0Q3MSB2_AMAAE/75-124              ..............................................................................................glgg---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....PD......GTFDDI......................LMDEg.............gALSPLG.pPGTLLA-.-S..PG..PSR.A..S.S.PR...S.S.L..S.MEDE..............
A0A2K6AJE3_MANLE/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q1MCQ1_BOVIN/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G1NSU4_MYOLU/330-485                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegrgeal..............................lmgaelpdpeslPAL.PP.QAP.LPP..........................QAQPPQ...PPS....................--...................................................---..-P..FH..........HLDLSHSLSF...........GGGGDEGP..pGY.P.E..PM.G....QEp....gSLFPNLskkd..............ldlmLLDN...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2U3V0J3_TURTR/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1U7TL51_TARSY/315-467             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.TE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-ATQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGDDEGP..pGY.P.D..PL.G....PEh....gSPFPNLskkd..............ldlmLLDN...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K6CFN5_MACNE/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2I4BF20_9TELE/388-501             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.G..P.RPIKQE.....................................................PAL.ED.CHR.ELYa.......................lpRHHQH-...---....................-H...................................................PAC..TP..EP..........PG----TLEL...........----NEGH...RY.G.S..Q-.-....--......GKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A384C5V7_URSMA/255-395             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQE.....................................................--L.PS.EEG.PGEal......................llEAELPL...PAQ....................PP...................................................QPP..SP..FH..........HLDFSHSLSF...........GGGSEEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2Y9NG72_DELLE/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q2WFB4_HAPBU/330-406             ..................................................................................................MQARLHGLP...SN...SP..S..GL..NT.GD..I.M..G.SYIKQE.....................................................TSL.EE.NHS.HPQa........................qAHHQPQ...HLP....................HN...................................................QAH..PQ..AQ..........QHQFLSHTHF...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----hpqgqaq.......
A0A2I3MYK3_PAPAN/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1V4J957_PATFA/195-314             ..................................................................................................IQARAHGLP...IM...SS..L..--..GA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A384AYJ4_BALAS/335-460             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-t.............
A0A493SYK3_ANAPP/319-438             ..................................................................................................IQARAHGLP...VI...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................---..AH..GQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A0A0AC37_CHAVO/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PP.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2Y9FQF6_PHYMC/341-466             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A452R665_URSAM/318-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................lleaevpdpeplPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGEEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1L8H6Y2_XENLA/317-432             .................................................................................................s-QAQMHGLP...AS...SP..H..GL..SP.AD..L.-..-.--IKQE.....................................................SNL.IP.LVQ.RQL..........................-VAPSQ...TSF....................Q-...................................................--M..DY..PA..........PLGYQNNTSV...........----DT--...SF.P.S..-L.-....SR......TELDLM......................LMEDa............mlTSDPIM.aCDPVMST.LS..PD..TSK.A..S.S.RR...S.S.F..S.IDE-v.............
A0A3Q0G279_ALLSI/380-505             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RAIKQE.....................................................SVI.DN.CNP.DIV..........................QRRT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTDSSN...AY.N.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A0A3Q0HG50_ALLSI/445-476             ..............................................................................................xxxx---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....--......------......................----...............-----T..GDPLLSA.VS..PG..ASK.G..S.S.RR...S.S.F..S.MEDE..............
A0A2U3W8L3_ODORO/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A3B4XI65_SERLL/241-408             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..T.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqqqqqq.............qqqqsspQ-----...---....................-Ahqaqqpqqpplyqedps.................sdylqrlavvagvpsipTAS..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
TFE3_HUMAN/432-574                   ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3P8YCU0_ESOLU/253-399             ..................................................................................................IQALAHGLP...NM...AT..S..-L..GT.VE..L.S..S.HLLKQQ.....................................................-QQ.QH.QPQ.ASQp.......................eeTQKGPQ...PPM....................YQeevngeyl..................................qrtsmpamaPGA..TE..QG..........PGAVDGSTTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMED...............PLSPFA..TDPLLSA.GS..PA..TSK.D..S.S.QR...S.S.F..S.SDDE..............
I3KWP5_ORENI/273-399                 ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGDPG-...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............SLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
F7BMF4_HORSE/225-344                 ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.QVTKQQ.....................................................THL.EQ.NSV.DYC..........................QQLT--...--I....................--...................................................SQG..TS..PE..........LSDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A452FLC8_CAPHI/350-474             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PE..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITfn.......slGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q1D9I8_AMPOC/251-412             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GS.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqqqqq................qqsppQ-----...---....................-Aqqphqpplyqedpng....................dylqripvvtgvpsiaTVS..GP..QD..........HIAGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......HPLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A340X954_LIPVE/158-277             ..................................................................................................IQARAHGLP...TL...AS..R..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDV......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2Y9DLR4_TRIMA/432-572             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtf....................hvgGAPAPN..aSHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeesvv....gglsggTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q3AGP5_KRYMA/275-401             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QHSCGP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......qipADTGDP-D...PY.G.-..-N.S....RT......CKMKEL......................MRDN...............TLGLIS.pSDPLLTA.MS..PD..VSNnA..S.SnHS...S.S.S..S.MEE-k.............
A0A096N6Y8_PAPAN/388-513             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A384AYP0_BALAS/341-466             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-t.............
A0A2K5WMM0_MACFA/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
E7FEM8_DANRE/329-488                 .................................................................................................r-QAQIHGLP...SN...SP..S..GL..TN.TD..H.Q..N.PFIKQEsspeenhlq...................................hqshlppryPQQ.HP.QPH.PQLh.......................qhQHLHPQ...PPL....................QY...................................................PAV..GS..SQ..........HFDLAQSLDL...........---CDGGI..pGY.Q.D..GL.-....--......GDLGFLgggiaqmg......kkselsflLMEE...............ALSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IED-s.............
A0A2K6CPA0_MACNE/334-486             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S3MYX3_SALSA/346-490             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A3Q0ST48_AMPCI/228-379             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.SSP..........................QAQQPQ...QPT....................LYqedinndylqr.............................iavvsgvpstaTIS..GP..QD..........HISGADACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3B4VBK0_SERDU/356-479             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................TFHPHH...QHH....................PA...................................................CTP..EP..PS..........TLELNEGHSN...........--FPDG--...HY.S.V..HS.K....PS......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
H2U9F8_TAKRU/305-459                 ..................................................................................................MQARLHGLP...SAssiSS..P..LA..SD.PT..L.L..Q.QQQQQQ.....................................................QQQ.VP.QGR.QSLthsadg.............tssqnllA-----...--IgaaaigeslpasflsppssnSP...................................................ARG..TI..SS..........PLDLG-SLSF...........AELDDGSA...--.-.S..AL.Y....PD......VGLGDI......................LMDDg.............cALSPDR.tGEPLFSP.LS..PG..ASK.T..S.S.R-...S.S.F..E.MDED..............
A0A2K6ALQ4_MACNE/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1S2ZRE1_ERIEU/339-464             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
H2PAA2_PONAB/391-516                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHH---...---....................--...................................................ADV..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3QJG8_9TELE/332-459             ..................................................................................................MQARAHGLA...LV...SP..T..AL..CP.SE..L.A..G.RVIKQE.....................................................PVL.GD.CLR.DPY..........................PH--PH...---....................HA...................................................SDM..SR..PT..........TLDLTDGTITy........sdGHGEPGES..aPY.T.R..PT.K....GA......SKLDDI......................LMDG...............SLSPVR.aGDPLLSS.SS..PG..ASN.E..S.S.RR...S.S.V..S.MEEN..............
A0A3Q2C8H0_CYPVA/364-473             ..................................................................................................LQARLNGLS...SS...SS..S..A-..--.--..-.S..T.PLTSSS.....................................................SSL.DP.NTH.--L..........................SPLLPN...---....................--...................................................---..PS..LS..........FMDLEESHAT...........------PT...VF.S.P..DL.L....PG......VGLTELssl................ggfLMEE...............DGGAAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3B3DU86_ORYME/353-536             ..................................................................................................MQARLHGLP...NA...SP..S..GL..SL.PD..M.M..P.PYIKQEtspeenlphshpqvhhqphhlhhnh..aqpqpqqhhympqphlhpqdhmqpqtRQL.PP.LPP.---..........................-HLQPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..pGF.S.D..GM.-....--......AGLGDLsgldvqm.......rrgdmgllMMDE...............PLSPMV..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
I4EC02_BOVIN/339-464                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3R5V8_9TELE/251-365             ..................................................................................................IQARAHGLP...NM...AP..P..VL..GQ.VE..L.S..S.PLQSQP.....................................................-AL.PM.HQE.GSS..........................-GEYAQ...ST-....................--...................................................---..VS..AA..........AAAFSDPLTH...........--FTDF--...-F.G.A..TL.K....EE......QRLEHI......................LMDG...............PLSPFG..ADPLLSS.TS..PA..ASK.G..S.S.RR...S.S.F..S.TDEG..............
A0A3B3CZR6_ORYME/248-374             ..................................................................................................IQARAHGLT...VA...SS..T..SV..CT.SE..L.L..A.RAIKQE.....................................................PVL.GE.CPP.EMY..........................----PH...--C....................SA...................................................PDM..SP..PT..........TMDLNNGVITfd......pvpADSGDS-G...SY.V.-..-I.S....RT......SKMKEM......................GKDK...............RFRSLS.pSNSLLSS.IS..PD..VSN.N..S.N.RC...C.S.SmpS.MEE-k.............
A0A3Q2CCN8_CYPVA/356-478             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..V.G..V.RPIKRE.....................................................PLL.ED.CHQ.DLY..........................KLHRQH...HPA....................--...................................................CTP..EQ..ST..........TLELKEGPSN...........--FNEG--...HY.S.C.vHG.E....AE......TKLTDI......................LMED...............NLSPVR.gVDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDDN..............
A0A2I3M4I2_PAPAN/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAT.LPL..........................-PTQ--...---....................--...................................................-PP..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PQh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A091E4V7_FUKDA/345-470             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DIL..........................QHHPDL...SCA....................-T...................................................TLD..LT..DG..........TISFNSGLGT...........--GPESNP...AY.G.V..PM.K....MA......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K5M018_CERAT/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B3VF37_9TELE/356-480             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..V.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................HP...................................................AGT.pEQ..PS..........TLDLTKGHSN...........--FPEG--...HYgS.V..HS.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A1D5QF51_MACMU/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2R9C5U0_PANPA/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I3MX05_PAPAN/154-273             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3B4VBH4_SERDU/359-482             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................TFHPHH...QHH....................PA...................................................CTP..EP..PS..........TLELNEGHSN...........--FPDG--...HY.S.V..HS.K....PS......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3B5AVM1_9TELE/381-504             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RAIKQE.....................................................PSL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EPp........gALELSEGHSN...........--FPE--G...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3P9N848_POERE/253-329             ..........................................................................................pllpnpsl---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..-S..........FMDLDDSHQA...........------SA...VF.S.T..DL.V....AEl....gAGLSDLga..................glLMEE...............DGGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
I3IWQ3_ORENI/415-543                 ..................................................................................................LQARVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................spPLL.HP.FSS.---..........................----SS...SPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DEPQGAAT...VF.S.P..DL.M....SD......MGLTDLhgl................gglLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A218UDM5_9PASE/176-295             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.---..........................-VDYSQ...---....................-Q...................................................MTL..VH..RQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLED...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
F6RZV7_XENTR/357-480                 ..................................................................................................MQARAHGLS...IM...PS..T..GL..CS.TD..L.V..N.RVIKQE.....................................................PML.DS.CNQ.EIL..........................SNHHDL...---....................--...................................................---..SG..TT..........TLDLTDGTITfs......nnlRNMTDSPT...AY.S.I..PT.K....LG......SKLEDM......................FMDD...............TLSPRV..NDP-HHT.IS..PG..ASR.T..N.S.RR...S.S.I..S.MEEN..............
A0A2Y9DDU9_TRIMA/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RVIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHTDL...T--....................--...................................................---..-C..TT..........TLDLTDGTITfn......nslGTGTESNQ...VY.C.V..PA.K....MG......AKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A3B3WXW3_9TELE/386-510             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..A.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................-H...................................................PAG..TP..EQp........sTLELTKGHSN...........--FPEG--...HY.GsV..HG.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A1S3MYP6_SALSA/276-420             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
U3IXD9_ANAPP/337-456                 ..................................................................................................IQARAHGLP...VI...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................---..AH..GQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
TFEC_HUMAN/225-344                   ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A498LEN3_LABRO/227-398             .................................................................................................r-QARMHGLP...ST...SP..S..GL..NN.TE..I.L..N.PFIKQEnspeenhllhqp.............................hlpphypqhqqhQ--.--.---.--Gqpqprph...........aqlhqhqhQHLHPQ...PPL....................QY...................................................PAV..GS..SQ..........HFDYAQSLDL...........---CDGGI..pGY.Q.D..SM.G....GI......GDLSSLgggvapmg......kkselgflLMEE...............ALSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IED-s.............
A0A3B4GLB5_9CICH/394-513             ....................................................................................lshthfhpqgqaqp---------...--...--..-..--..--.--..-.-..-.----EP.....................................................RQL.PP.LPQ.---..........................-HLQPQ...PPI....................QY...................................................PAV..GS..SQ..........HFDFAQSLDL...........---CD-GI..sGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgdlgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3B4DTJ7_PYGNA/331-515             ..................................................................................................MQARLHGLP...SN...SP..S..AL..NN.VD..L.M..N.PFMKQEgspeenhhnph...............................pphmpvhhpqqQQQ.QQ.QHQ.--Qhqqhpgqlq........qprglpplpQHLHPQ..pPPL....................QY...................................................SAV..GS..TQ..........HFDFAQSLDL...........---CDGGVp.gGY.S.D..GM.-....--......SCLGDLsslggggagtphmgkkndmgflLMEE...............ALSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IDD-s.............
F6WU39_XENTR/289-404                 ..................................................................................................MQAQLHGIS...AA...PP..A..--..CN.PT..-.-..-.------.....................................................NTL.KG.APP.---..........................AMAMP-...-AF....................QS...................................................AQR..PD..PT..........TLDLG-TLHFtd.......plSDLVDQDL...NF.H.L..SL.T....GD......SAIADI......................LMDD...............ALSPLG.gADPLLSS.VS..PQ..ASK.T..S.S.RH...S.S.F..S.MEDD..............
A0A286Y0A7_CAVPO/429-571             ..................................................................................................LQAQIHGLP...VP...PT..P..GL..IS.VA..T.TsaS.DSLKPE.....................................................-QL.DI.EEE.GRPstat.................fhvagAPVQNT...PQQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A1S3WBN2_ERIEU/228-353             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3Q544_GASAC/252-406                 ..................................................................................................IQARAHGLP...NM...AS..A..-L..GA.AE..P.T..S.QLLKQP.....................................................QQL.QS.SPQ.AQQtq.....................qaqQ---AQ...QTQ....................-Qaqqpplyqedpn...........................gdylqriagvppSLP..GP..HD..........HMPGADGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..ADPLLSA.GS..PE.aASK.D..S.S.RR...S.S.F..S.SDEG..............
A0A2K6CPR8_MACNE/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
F7HP56_CALJA/390-515                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
H3CPI2_TETNG/276-399                 ..................................................................................................IQARAHGLS...VA...SM..S..-V..CT.SD..L.M..A.RVIKQE.....................................................PAL.GD.CPS.DLY..........................QHSSTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......qirSDSGDHG-...AF.E.N..S-.-....RN......CKLKEL......................VRDS...............TLSPLS.pSDPLLCA.MS..PD..GSI.S..N.H.HT...S.C.S..S.VEEN..............
MITF_HUMAN/397-522                   ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
#=GR MITF_HUMAN/397-522        SS    ..................................................................................................HHHHH-XXX...XX...XX..X..XX..XX.XX..X.X..X.XXXXXX.....................................................XXX.XX.XXX.XXX..........................XXXXXX...---....................--...................................................---..XX..XX..........XXXXXXXXXXXX......XXXXXXXXXXX...XX.X.X..XX.X....XX......XXXXXX......................XXXX...............XXXXXX.XXXXXXXX.XX..XX..XXX.X..X.X.XX...X.X.X..X.XXX-X.............
A0A3Q0G5P8_ALLSI/374-499             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RAIKQE.....................................................SVI.DN.CNP.DIV..........................QRRT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTDSSN...AY.N.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A0A1L8F5E4_XENLA/410-516             ..................................................................................................IQAQLHGLN...DN...PP..A..C-..KA.T-..-.-..-.DTLKSE.....................................................PTF.HS.ASP.---..........................QPPHPS...---....................--...................................................--A..LH..LG..........TLHFTDPLSH...........-------L...DF.H.L..TL.T....PD......SAIADI......................LMDD...............ALSPLG.gTDPLLSS.VS..PQ..ASR.N..S.S.PH...S.S.F..S.MEDD..............
R7VY95_COLLI/339-464                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.EN.CNP.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PP.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A091E0D5_FUKDA/151-301             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElsgeeap.......................................getlmlgPEV.PD.R--.--Ep........................lPALPPQa.pPPP....................SA...................................................EPL..SP..FH..........HLDFSHSLSF...........GDGGDKGP..aGY.P.D..PL.G....PE......HGFPDLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A151NBM7_ALLMI/310-452             ..................................................................................................MQARIHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEvsrge..........................................dgstepQQR.QP.HPD.---..........................QETQPQ...PSL....................PP...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGPS...GF.H.D..QL.D....PGh....nASFPSLskke..............ldlmLMED...............TMLPLA..SDPLFSA.MS..PE..ASK.T..S.S.RR...S.S.F..S.MED-t.............
A0A2Y9IYS2_ENHLU/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
G1PCK6_MYOLU/141-258                 ..................................................................................................IQARAHGLP...SL...AS..L..--..GT.ID..M.D..A.HVNTQT.....................................................-PL.EQ.NSV.---..........................--DYCQ...QPT....................QL...................................................-QG..LS..PE..........LCDQALSFSDp.........lSHFTDL--...SF.S.A..AS.K....EE......QRLDDM......................LLD-...............TLSPFG..TDPLLSA.TS..PE..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A3P8VN16_CYNSE/302-451             ..................................................................................................IQARAHGLP...NM...TT..S..-Q..GT.VE..L.T..S.HLLKQQ.....................................................-QQ.QQ.QPQ.QRS..........................-PPQAQ..qPPL....................YQeepnndylqr..............................iaavagmpsipGAG..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....DE......QRLEEI......................LIDE...............ALSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
A0A2K5M007_CERAT/334-486             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I3T7T7_PANTR/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHAEL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q7W7X2_URSAR/429-570             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgaap.................fhaagGPAQSA...PHQ....................HP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q2EF89_CYPVA/244-368             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DIY..........................QHNCTP...---....................--...................................................-EM..SP..PT..........TLDLNNGTIT..........fDHIPADAG..dSY.G.-..-N.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSH.N.vS.S.RH...SsS.S..S.MDE-k.............
G5BJJ2_HETGA/250-453                 ..................paitvsnscpaelpnikqeiseteakallkerqkkdnhnlierrrrfnindrikelgtlipksndpemrwnkgtilkasv---------...--...--..-..--..--.-D..Y.I..R.KLQKEQ.....................................................QRS.KD.LES.RQR..........................SLEQAN...RSLqlriq..........nvphqQP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.L..--.-....--......-GLEDIlmeee...........egmvggLSGD...............ALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K6U831_SAIBB/234-386             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S2ZRB4_ERIEU/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
R0KB61_ANAPL/258-377                 ..................................................................................................IQARAHGLP...VI...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................---..AH..GQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3B3I0H0_ORYLA/382-531             ..................................................................................................IQARAHGLP...NM...TT..A..-L..GT.VE..L.S..N.HLLKQP.....................................................QQQ.QQ.QSP.--P..........................QAPQPQ...QAT....................LYqedpnndylqr.............................iaavtaipsitAAG..PT..QD..........HISGGDACTTfs......dplSHFTDF--...-F.T.A..SL.K....EE......NQLDEI......................LMDE...............ALSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SGE-g.............
A0A1U7R0U3_MESAU/431-572             ..................................................................................................LQAQIHGLP...VP...PT..P..GLlsLA.TS..S.G..S.DSLKPE.....................................................-QL.DI.EEE.GRPntas.................fhvsgGPVQNT...PQQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegvmg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q3BFZ3_KRYMA/252-400             ..................................................................................................IQARAHGLP...NM...AN..T..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.SPP.PVH..........................---QPQ...QPPl..................yQEdpnsdylqri...............................avltgvpsiaAAG..GP..QD..........HIQGADAGTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLNEI......................LMDD...............PLSPFG..TDPLLSA.SS..PG.vISK.D..S.S.RR...S.S.F..S.SAE-g.............
G3S312_GORGO/375-500                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A340WL13_LIPVE/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A096M293_POEFO/329-510             ..................................................................................................MQAQLHGLP...SN...SP..S..AL..NP.SE..M.M..P.PYIKQEtspeqnfshaqaqalhqsqhi...........phnqaqpqqhhflpqahlhpqSQL.QP.QAR.QLPp.......................lpQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..hGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3Q1JB46_ANATE/343-456             ..................................................................................................LQARLHGLA...SC...ST..S..L-..PP.PS..-.S..S.SLDPQT.....................................................-LL.SP.TLP.---..........................---QPS...TS-....................--...................................................-LV..TP..SL..........GLDALSFVEL...........EDPQGAPV...VF.S.P..DL.I....SDve.ltlHGLGDI......................LMEE...............G---GG..GDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A226PQ91_COLVI/295-420             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGSVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2K5EA62_AOTNA/158-277             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QTS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLHD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A452SD32_URSAM/214-338             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn.......nlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
G3U5V9_LOXAF/330-485                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.T..Q.QVVKQElpsdegpgeal..............................llgaevpdpeplQAL.PP.QAP.---..........................---PPP...PAQ....................LP...................................................QQQ..SP..FH..........PLDFSHSLSF...........GGGGNEGP..pGY.S.E..AL.G....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
E2R7M9_CANLF/315-434                 ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......HRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P8ND63_ASTCA/251-406             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqs......................spQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2Y9FVG2_TRIMA/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RVIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHTDL...T--....................--...................................................---..-C..TT..........TLDLTDGTITfn......nslGTGTESNQ...VY.C.V..PA.K....MG......AKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2K6GN98_PROCO/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGPGTEGSQ...VY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q3AM57_CHICK/390-515             ..................................................................................................MQARAHGLS...LV...PS..T..GI..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2I3RWW4_PANTR/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHAEL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q2UV91_HAPBU/348-474             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpADAGEP-G...PY.G.S..S-.-....SA......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
F6WCA4_MACMU/328-480                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
G3WFS0_SARHA/326-445                 ..................................................................................................IQAQAHGLP...II...SS..H..--..SA.ID..L.A..A.HTTNHH.....................................................TYT.ED.KSG.DY-..........................----SQ...-EL....................TL...................................................AEG..SR..SD..........LCDGSMAFSYp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDPI......................LLDD...............SISPFG..TDPLLSA.TS..PT..VSK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3Q1B6Y6_AMPOC/320-487             ..................................................................................................MQARLHGLP...ST...SP..S..GL..NP.TD..M.M..A.SYIKQEtspednlshpqaqv........................hhqpqhlhhnqaqpqA--.--.---.--Qlqprq................lpmapQHLQPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFTQSLDL...........----CDGI..pGF.S.D..NM.-....--......SGLGDLggldvqg.......rrgelsflMMDE...............ALSPIG.gGDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
G3PDP9_GASAC/276-400                 ..................................................................................................IQARAHGLT...VV...SS..S..PV..CT.SD..L.M..G.RSIKQE.....................................................PVI.GD.CPV.ELY..........................QHSSGP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hvpADGGDAG-...PY.G.-..-N.S....RT......CNLKDL......................VRD-...............TLSPMS.pSDPLLSS.MS..PE..GSN.A..S.S.LH..sS.S.S..S.MDE-k.............
W5PND3_SHEEP/430-572                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL..--.LS..L.A..A.TSASDS.....................................................--L.KP.EQL.DVE..........................EEGRPG...TAIfhaag..........glaqsAP...................................................HQQ..PP..PP..........PSDALLDLHFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A093GVW4_STRCA/259-378             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENA.---..........................-VDYSQ...-QV....................SL...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A2R9A6G5_PANPA/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.ESLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q3NFL1_9TELE/248-374             ..................................................................................................IQARVHGLT...IV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PML.SD.CPS.ELY..........................QHSSAS...---....................--...................................................-DM..SP..PC..........TLDLNNGTITfd......qipADNGDS-G...QY.G.-..-N.S....RT......CKMKEL......................LKDN...............TLSPVS.pSDPLVSS.MS..PDgtNTI.S..S.H.HI...S.S.S..S.MEEK..............
G1NB70_MELGA/384-509                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A498ND01_LABRO/373-521             ..................................................................................................IQARAHGLP...SM...AA..S..-M..GA.VE..L.S..S.HLLKQQ.....................................................QQH.QP.VTP.APLs.......................tqA---PL...QPG....................QPplypqedmsnp............................eytqrtplpaamIAG..NA..GE..........QTDGSNTFSDp.........lSHFTDF--...-F.C.S..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PA..ASK.G..S.S.RR...S.S.F..S.SEE-a.............
A0A3B3D1K9_ORYME/272-398             ..................................................................................................IQARAHGLT...VA...SS..T..SV..CT.SE..L.L..A.RAIKQE.....................................................PVL.GE.CPP.EMY..........................----PH...--C....................SA...................................................PDM..SP..PT..........TMDLNNGVITfd......pvpADSGDS-G...SY.V.-..-I.S....RT......SKMKEM......................GKDK...............RFRSLS.pSNSLLSS.IS..PD..VSN.N..S.N.RC...C.S.SmpS.MEE-k.............
A0A3P9BQX7_9CICH/315-441             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A0P7V3S6_SCLFO/339-468             ..................................................................................................IQARAHGLP...NV...TP..S..-Q..GP.TE..A.S..S.HLMKQQ.....................................................QQQ.QQ.QPT.EPL..........................YQEDPG...GDY....................AA...................................................QAV.aPT..MA..........PAEHADGPATfs......dplSHFTDF--...-F.S.A..TL.K....DE......HRLDHI......................LMNG...............SLSPFG..GDPLLSA.TS..PD..ASK.G..S.S.RR...S.S.L..S.TDDG..............
A0A3P8XJ32_ESOLU/323-463             ..................................................................................................MQARFHGLS...SS...MS..S..GL.cSD.PS..L.Q..Q.HVHQGG.....................................................PTL.GP.SAE.DQNlls...................lqaaAMAQPV...PTSflsp............ptsnSP...................................................VGV..PV..NS..........TLDLG-SLSF...........AELDETS-...--.N.A..GL.Y....TE......VGLGDI......................LMDEs.............cTLSPER..VGPLFS-.MS..PG..ASK.N..S.S.CR...S.S.F..S.MEED..............
A0A2I3HYI0_NOMLE/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgtat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q2X3Y3_HAPBU/355-484             ..................................................................................................LQARVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................spPLL.HP.FSS.---..........................---SSS...PPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DEPQGAAT...VF.S.P..DL.M....SD......MGLTDLngl................gglLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3Q3LU27_9TELE/275-428             ..................................................................................................IQARAHGLP...NM...TT..A..-L..GN.IE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQSs........................pQTQQPQ...QPP....................LYqedpnsdylqr.............................iaaaagvstipSAG..GP..QD..........QITGADSCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A218UVT9_9PASE/390-515             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CSQ.DMM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPAG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2R8Z8L4_PANPA/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
G1M0Z6_AILME/429-570                 ..................................................................................................LQAQIHGLP...VP...PT..P..G-..-L.LS..L.A..T.TSVSDS.....................................................--L.KP.EQL.DVEeegrpga............tpfhaagGPAQSA...PHQ....................HP...................................................PAP..PS..DA..........LLDL----HFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgALSPLRaaSGLLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2U9BGC5_SCOMX/330-515             ..................................................................................................MQAQLHGLP...GN...SP..S..GL..NL.PD..L.M..A.PYIKQElspeeklshpqiqghhqphhqpqhlprnqvqhqahqhhflpqnhlqaqgqaqpRQL.PP.LP-.---..........................QHLQPQ...PPI....................QY...................................................PAV..GS..SQ..........PFDYAQSLDL...........---CD-SI..pGF.S.D..GM.-....--......SGLGDLvgldgqg.......rrgelgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3P8ZGK9_ESOLU/256-381             ..................................................................................................MQARAHGLA...VL...PS..S..SL..CS.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QQSGPN...---....................--...................................................--M..SP..PT..........TLDLNNGTIHf........nnSPLGAGDP..gAY.S.S..-S.K....AS......GKLKDI......................LMDN...............TLSPIS.sNDPLLSS.VS..PD..TSN.S..S.S.RR...S.S.S..SgMEE-n.............
A0A2K6AJD3_MANLE/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2K6CPU0_MACNE/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B3C0Q2_ORYME/252-402             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..N.HLLKQP.....................................................-QQ.PQ.QQQ.SPP..........................QAPQPQ...QAP...................lYQedpnndylqr..............................iavvtgvpsiaAAG..TP..QD..........HISGGDACTTfs......dplSHFTDF--...-F.T.A..SL.K....EE......NQLDEI......................LMDE...............ALSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SGE-g.............
M3ZMX0_XIPMA/409-483                 ...........................................................................................lpnpsls---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........FMDLDESHQA...........------SA...VF.S.T..DL.V....AEl....gEGLSGLga..................glLMEE...............DGGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2I3SJV1_PANTR/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYC-...---....................QQ...................................................LTV..SQ..RP..........SPEFCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A452SQE6_URSAM/351-526             .....lkasvdyirklqkeqqrskdlesrqrsleqanrslqlriqvwdkeasqlvxslattsasdslkpeqldveeegrpgaapfhaaggpaqsaphq---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................HP...................................................PAP..--..--..........PSDALLDLHFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K6JXP2_RHIBE/350-475             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3P9BPZ9_9CICH/343-469             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3Q3WS11_MOLML/303-452             ..................................................................................................IQARLHGLS...SP...SS..M..SS..GL.S-..-.S..N.SSVFQQ.....................................................QSL.PQ.GSQ.ALAprsdgassqnll.glgvaamgeslpaS-----...--Flsp.............pssdSP...................................................AQA..TI..SS..........PLDLG-SLSF...........AELDDTSA...--.-.S..AL.Y....PD......VGLGDI......................LIDDr.............cAMSPER.mAEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A3L8Q7A5_CHLGU/316-447             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEgsgd............................................egtlePLL.PP.PDP.ES-..........................---QPA...--L....................PA...................................................PPQ..SP..YH..........QLDFTHSLSFd........dgS------Q...GF.P.D..SA.SfpslSK......KELDLM......................LMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3B3QRV6_9TELE/401-560             ..................................................................................................MQARLHGLT...AS...AS..P..T-..LA.SD..Q.D..R.HPQQQPl..................................................agPAL.ES.RSG.GVLsqnlitl...........ggsgigggI--APQ...SASfls.............lgsaPP...................................................AGL..AS..NN..........PLDLD-ALNF...........AGMDDPSA..tAF.D.P..AM.M....SD......TTFESTlms...............dmgiLMDEg.............cALSPVG.aADPLLSS.VS..PG..ASK.S..S.S.RR...S.S.F..S.VDED..............
A0A3B5B7J9_9TELE/333-516             ..................................................................................................MQARLHGLP...NT...PP..A..GM..NP.TD..M.M..A.SYIKQEtspeenlshpqaqihhqpqhlhh......nqaqpqaqqhhylpqthlhpqgqaQ--.--.---.--Qqprq.................lqlppQHLQPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............QLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
M4APX2_XIPMA/369-493                 ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..V.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................-H...................................................PACtpEQ..PS..........TLELTEGHSN...........--FPDG--...HYgS.V..HG.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A1S3SG11_SALSA/233-378             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A1S3FDY4_DIPOR/321-472             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpgeegp......................................gealmlgaEVP.EP.---.--Ep........................rQALPPQ...APL....................PP...................................................PAQppSP..FH..........PLDFSHSLGF...........GGGGDGPA...AY.P.D..PL.G....PEh....sSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S3MYX6_SALSA/252-396             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A1D5RIV3_MACMU/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P8U2H3_AMPPE/302-449             ..................................................................................................MQARVHGLS...TPt.sMS..S..GL.gSD.PS..LlQ..Q.QAVPQS....................................................gQSL.PP.NTG.GASthnl..................lslgAAGQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDTSA...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cALSPER.lAEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A1S3MFR0_SALSA/360-492             ..................................................................................................MQARAHGLT...TD...TS..A..-L..CS.TE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYh........................vH-SQHQ..hHPA....................CT...................................................PDQ..VQ..YT..........TLELNDGASPyt......kghGGVSGDQR...PY.G.G..HL.-....-K......GALMDI......................LMDD...............TLSPVR.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.K..S.MEEN..............
A0A1S3MG37_SALSA/391-523             ..................................................................................................MQARAHGLT...TD...TS..A..-L..CS.TE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYh........................vH-SQHQ..hHPA....................CT...................................................PDQ..VQ..YT..........TLELNDGASPyt......kghGGVSGDQR...PY.G.G..HL.-....-K......GALMDI......................LMDD...............TLSPVR.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.K..S.MEEN..............
A0A452GK69_9SAUR/339-461             ..................................................................................................MQAQLHGLP...LT...SS..A..GL..LP.LG..C.S..G.EGAKPE.....................................................---.GP.GPP.PFR..........................----GG...PSC....................-A...................................................PAP..TS..SA..........ACLLDLAFPS...........EELGEAGL...GF.P.L..GL.G....VD......GGLEDI......................LMEDg.............gPLSPLG.aSDPLLSS.LS..PG..ASK.G..S.S.RR...S.S.F..S.MEED..............
I3MPL2_ICTTR/179-331                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpealP--.-A.---.---..........................--LPPQ...APL....................PP...................................................PAQppSP..FH..........HLDFSQSLGF...........GGGSDEGT..aGY.S.D..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5WMY5_MACFA/388-513             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1U8BTW6_MESAU/397-522             ..................................................................................................MQARAHGLS...LI...PS..S..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPESNP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
I3KJT4_ORENI/387-510                 ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH..hQHH....................PA...................................................CTP..ET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A452GJT9_9SAUR/371-489             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVI.DN.CNQ.DVL..........................---QRH...S--....................--...................................................-DL..SC..TT..........TLDLTDGTIT...........--FSDNLG...TY.S.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A0A3B3R600_9TELE/238-352             ..................................................................................................IQARAHGLP...NM...AP..P..VL..GQ.VE..L.S..S.PLQSQP.....................................................-AL.PM.HQE.GSS..........................-GEYAQ...ST-....................--...................................................---..VS..AA..........AAAFSDPLTH...........--FTDF--...-F.G.A..TL.K....EE......QRLEHI......................LMDG...............PLSPFG..ADPLLSS.TS..PA..ASK.G..S.S.RR...S.S.F..S.TDEG..............
A0A3Q4MP35_NEOBR/356-479             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A384DAD1_URSMA/233-352             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2K6LR71_RHIBE/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A1V4K931_PATFA/362-487             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.EN.CNP.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PP.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A3Q0T747_AMPCI/317-476             ..................................................................................................MQARLHGLP...SS...SP..S..GM..NP.AD..I.M..A.SYIKQEtsleenhshpqaq..........................ahhqpqhllhnqahP--.--.---.--Qlp.....................plpQHLQPQ...PPI....................QF...................................................PAV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLcgldlqg.......rrgelsfhMMDE...............PLSPMG..GDPLLSA.MS..PE..ESV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2K5ZRS8_MANLE/388-513             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K5QJT2_CEBCA/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DS----.....................................................--L.KP.EQL.DIEeegrpga............atfhvagGPAQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q2V1R0_HAPBU/252-405             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQSs........................pQAQQPQ...QPTlyqed.........inndylQRiaaas........................................gvqstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3B4BYC3_PYGNA/390-522             ..................................................................................................MQARAHGLA...VA...SS..A..-L..CS.PD..L.S..A.RPIKQE.....................................................PML.GD.CTR.DMY..........................PHQNPH...QTG....................--...................................................PDI..TR..ST..........TLDLTDGTISfs......dghAPTSSDPG...AY.G.V..IS.K....VT.....gAKLDNI......................LMDA..............eTLSPVA.tGDPLLSS.VS..PG..ASK.D..S.S.RK...S.S.I..S.MEE-s.............
A0A1S3P2W1_SALSA/286-408             ..................................................................................................MQARAHGLA...VV...PS..P..SL..CS.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QKSGPD...---....................--...................................................--M..SP..TT..........TLDLNNGTIHf........ndSPLDAGEP..gAY.G.-..SN.K....AS......TKLKDI......................-IDN...............TLSPIS..--SLLSS.VS..PD..ASN.S..SsS.RR...S.SsS..S.MEE-n.............
M3ZZN9_XIPMA/305-439                 ..................................................................................................MQAQLHGLP...AS...QQ..Q..-Q..QQ.QQ..A.A..P.HGVQNPgaastl.........................................nlsalsA--.--.---.---..........................-IAQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDP--...-A.S.S..AL.Y....PD......VGLGDI......................LMDDg.............cALSPER.mGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
TFEC_BOVIN/196-314                   ..................................................................................................IQARAHGLP...TL...AS..L..--..VT.VD..L.G..A.HITKQT.....................................................-HL.EQ.NSG.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDNM......................LLDD...............TVSPFG..TDPLLSA.IS..PA..VSK.E..S.S.RR...S.S.F..S.SEDG..............
Q864F3_CANLF/290-415                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...P--....................--...................................................---..-C..TT..........TLDLTDGSITfn......nnlGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1S2ZRB0_ERIEU/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGTGTENNQ...VY.S.V..PT.K....IG......SKLEDI......................LMDD...............TLSPVG.lTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1S3LDH1_SALSA/358-529             ..................................................................................................MQARLHGLP...SS...SP..S..GM..GS.GD..L.M..G.SYVKQEtspeeklhqqqaqhqaqaq..............gqqhlhhpqshhlqpqqgqlRQL.PP.LPP.---..........................-HLQPQ...LPL....................QY...................................................SAV..GS..SQ..........PFDFAQSLDL...........---CDG-V..pGF.P.E..GL.-....--......SGLGELgglgtqg.......rrgelgflMMDE...............PLSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IED-a.............
A0A1S3SG14_SALSA/249-394             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A2I4BF27_9TELE/386-499             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.G..P.RPIKQE.....................................................PAL.ED.CHR.ELYa.......................lpRHHQH-...---....................-H...................................................PAC..TP..EP..........PG----TLEL...........----NEGH...RY.G.S..Q-.-....--......GKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2U3ZJU0_ODORO/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2K5IEH1_COLAP/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......snlGAGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
U3IWY7_ANAPP/365-490                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PAL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNMTEPTG...TY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A340XDT8_LIPVE/317-472             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAQ.---..........................-LPPPA...QPA....................Q-...................................................-PP..SP..FH..........HLDFSHSLSF...........GGGGNEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2Y9FPL9_PHYMC/345-470             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q1HH80_9TELE/302-449             ..................................................................................................MQARVHGLS...TPt.nMS..S..GL.gSD.PS..L.L..Q.QQAGPQs...................................................gQSL.PL.NTG.GASthnl..................lslgAVGQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDTSA...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cALSPER.lAEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
H2MGI4_ORYLA/365-511                 ..................................................................................................MQARLHGLS...TPagiSA..D..LN..SD.PS..L.Q..P.QPVSQS....................................................gQAL.PP.NTG.VTAhqnlmgla..........aigasmptSF----...--Lspp..............ssdSP...................................................AGV..TI..SS..........PLDLG-SLTF...........AELDDTSA...--.-.T..AL.Y....PD......VGLGDI......................LMDEg.............cALSPDR.vDESLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..D.MDED..............
A0A3Q1K765_ANATE/374-487             ..................................................................................................LQARLHGLA...SC...ST..S..L-..PP.PS..-.S..S.SLDPQT.....................................................-LL.SP.TLP.---..........................---QPS...TS-....................--...................................................-LV..TP..SL..........GLDALSFVEL...........EDPQGAPV...VF.S.P..DL.I....SDve.ltlHGLGDI......................LMEE...............G---GG..GDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3P9BYU8_9CICH/252-408             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqq.....................sspQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2K5X0B1_MACFA/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A091CXQ7_FUKDA/431-573             ..................................................................................................LQAQIHGLP...VP...PN..P..GL.lSL.AT.tS.A..S.DSLKPE.....................................................-QL.DI.EEE.GRPsaat.................fhvagAPVQNT...PQQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A0D9RGQ2_CHLSB/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A093T1Q9_9PASS/259-378             ..................................................................................................IQARAHGLP...VM...SS..L..--..TA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................VHG..QN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3P9BUX0_9CICH/303-450             ..................................................................................................MQARLHGLS...NS...NS..V..--..SA.LS..S.D..P.SLLQQQ.....................................................STV.PQ.SSQ.SLApntggas...........nqnllgpaAIGQPL...PASflsp............pssdSP...................................................AGL..TI..SS..........PLDLG-SLSF...........AELDDPPA...--.-.S..AL.Y....SD......MGLGDI......................LMDDg.............cTLSPER.iGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A091VIN9_NIPNI/315-440             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2D0T5B4_ICTPU/245-396             ..................................................................................................IQARAHGLP...SN...--..-..-L..GA.AE..I.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QALpapav................tpgaqTSLYPQ...DELngp..............eylQRnslsvl.......................................hagnegNSS..SS..GE..........HADAT-STTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEL......................LMEE...............ALSPFG..TDPLLSA.TS..PN..ASK.G..S.S.RR...S.S.F..S.TDDN..............
A0A1D5P4F2_CHICK/318-437             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3B3BDH2_ORYME/282-405             ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RSIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................HP...................................................ACT.pEQ..QG..........TLELNEGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2Y9JHV6_ENHLU/234-389             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................lleaevpdpeplPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B4EIF5_PYGNA/416-558             ..................................................................................................MQARVHGVQ...GS...DA..T..--..--.--..L.M..Q.QQQQQQitsldssngp.................................lsktiltlggPGL.NP.TTT.S--..........................TLLSPP...PSA....................SP...................................................VAR..AM..TI..........PLDFG-TLSF...........GELDDPGS..sMF.N.S..AL.M....GD......MGLGDI......................LMDDg.............gALSPVG.gADPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A3B4UH05_SERDU/317-431             ..................................................................................................MQARIHGLS...NS...NS..IssGL.gSD.PS..L.L..Q.HAGGAS.....................................................---.--.---.---..........................----SQ...NLL....................SL...................................................GAI..GQ..PL..........PASFLSPPS-...........---SDSPA...GV.T.I..TL.Y....PD......VGLGDI......................LMDDg.............cTLSPER.vGDPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A1S3LCI1_SALSA/367-492             ..................................................................................................MQARAHGLA...IL...PS..S..SL..CS.SE..L.I..A.RAIKQE.....................................................PIL.GD.CPS.DLY..........................QQPGPD...--M....................--...................................................---..SP..PT..........TLDLNNGTIHf........ndSPLDAGDP..gVY.G.-..SS.K....AS......TKLKDI......................LMDN...............TLSPIS.sNDPLLSS.AS..PD..TSN.S..S.S.RR...S.S.S..SsMEE-n.............
A0A3Q0GP80_ALLSI/346-488             ..................................................................................................MQARIHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEvsrge..........................................dgstepQQR.QP.HPD.---..........................QETQPQ...PSL....................PP...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGPS...GF.H.D..QL.D....PGh....nASFPSLskke..............ldlmLMED...............TMLPLA..SDPLFSA.MS..PE..ASK.T..S.S.RR...S.S.F..S.MED-t.............
A0A2K5IEP4_COLAP/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......snlGAGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3NGM3_GASAC/335-456                 ..................................................................................................MQARAHGLV...IA...PP..A..-L..CS.AE..L.C..A.RPIKQE.....................................................TAL.DD.CRS.ELY..........................ALHQHH...PAC....................TP...................................................EPP..GA..P-..........--ELSEGHGD...........--FSA-EG...HY.G.V..HV.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.IS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2Y9FEK3_PHYMC/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQST...PHQ....................QP...................................................PAP..PT..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2I4BXG3_9TELE/277-426             ..................................................................................................IQARAHGLP...NM...AN..T..-L..GT.VD..L.S..S.HLLKQQ.....................................................QQQ.QQ.QSP.--S..........................QAQQPQ...QPP....................LYqedpnsdylqr.............................iavltgvpsitAVS..GT..QD..........HIQGADAGTTfs......dplSHFTDF--...-F.A.S..TL.K....EE......NQLNEI......................LMDD...............PLSPFG..TDPLLSA.SS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A2K5MJT8_CERAT/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
H3ATZ1_LATCH/357-482                 ..................................................................................................MQARAHGLS...LA...PS..T..GL..CA.PD..L.G..A.RIIKQE.....................................................PVL.ED.CKQ.DAL..........................QHHSNL...---....................--...................................................---..SC..TT..........TLNLTDGTITfs......envGHVVEHSG...AY.S.V..PT.K....VG......SRLEDI......................LMDD...............TLSPAG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-p.............
A0A2U4CCZ9_TURTR/341-466             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A0P7VII7_SCLFO/260-388             ..................................................................................................MQARAHGLV...VV...AS..S..AL..CP.SE..L.T..N.RAIKQE.....................................................PVL.GD.CSQ.DMY.........................pHGHHPA...---....................--...................................................SDP..SR..PT..........TLDLNDGTISy........sdNHPEQGDP..rVY.G.M..PA.K....VA......SKLDDI......................LMDG...............TLSPVG.vSDPLLSS.VS..PG..ASQ.D..S.S.RR...S.S.I..S.MEEN..............
A0A2U3W8L8_ODORO/228-353             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A455AFT7_PHYMC/360-485             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q3EFL7_9LABR/306-457             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.SSP..........................---QPQ...QPI....................QPplyqedpnsdyl..........................qriasvagvhsipSAA..GP..QD..........HIPGADGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.eASK.D..S.S.RR...S.S.F..S.SAED..............
A0A402EH99_9SAUR/258-376             ..................................................................................................IQAQAHGLP...VM...SS..V..--..RA.ID..L.A..S.QVTEQQ.....................................................-VF.PE.DNS.---..........................-VNYS-...---....................QH...................................................LAV..AH..EQ..........HPDLRDKSAAfs......dplSHFTDL--...SF.S.A..AL.-....KE......QKLDNI......................LLDD...............PISPFG..TDALLSS.IS..PV..ASK.G..S.S.RR...S.S.F..S.TDDG..............
A0A2Y9FN16_PHYMC/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2U3ZNL1_ODORO/313-468             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQEmpseegpgeal..............................lleaevpdpeplPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
L9KY47_TUPCH/332-484                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplP--.--.---.---..........................-ALPPQ...APL....................PP...................................................PAQ..PP..SPf........pHLDFSHGLSF...........GGGGDEGP..pGY.T.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H2QMX3_PANTR/381-506                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHAEL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K5EDW0_AOTNA/374-499             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
F7E2P9_MACMU/432-574                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
J9NT96_CANLF/350-475                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...P--....................--...................................................---..-C..TT..........TLDLTDGSITfn......nnlGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A287D994_ICTTR/343-467             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHQAEL...---....................--...................................................-AC..TS..LD..........LTDGTLAFSSs.........lGPTAEGAQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPAG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A2Y9J234_ENHLU/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A2K5MJU0_CERAT/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2Y9JYW2_ENHLU/315-434             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.HSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.I..S.SDDG..............
G3IKG7_CRIGR/146-185                 ..................................................................................................MQARAHGLS...FI...PS..T..GL..CS.PD..L.V..S.GIVKQE.....................................................PVL.EN.CSQ.E--..........................------...---....................--...................................................---..--..--..........----------...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----lv............
A0A3Q0SNN5_AMPCI/249-400             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.SSP..........................QAQQPQ...QPT....................LYqedinndylqr.............................iavvsgvpstaTIS..GP..QD..........HISGADACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2K6P6R5_RHIRO/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A0P7VLP6_SCLFO/333-474             ..................................................................................................MQARLHGLS...TP..pAP..T..GL..CSdLS..V.L..Q.QQQQQQ.....................................................-QQ.QT.GPP.LSHtvlsld.............rmgreggASA---...RPT....................AA...................................................SGL..TF..LS..........PPALPVGVTM...........SSPLDLGT..lNF.V.-..DL.D....TT......VGLGDM......................LMDEg.............cALSPVG.aADPLFSG.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEED..............
A0A091KDI0_EGRGA/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2I4APU7_9TELE/348-530             ..................................................................................................MQARLHGLP...ST...SP..S..GI..SM.TE..V.M..P.PYVKQEtsqeenfshpppqahhqhqhqhl......phsqappqaqqhhflpqnnlhpqgQAL.--.---.--Pppr....................qlpPLQHLQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgelgflMMDE...............PLSPIG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
F6T5E1_HORSE/432-574                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaggGPAQGA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
G1KFM3_ANOCA/193-311                 ..................................................................................................IQARAHGLP...IM...TS..I..--..ST.VD..L.T..S.HVMKQP.....................................................-AF.PE.ENS.VDY..........................----SQ...---....................-H...................................................LPV..AH..EL..........HSDLGDTVAAfs......dplSHFTDL--...SF.S.A..AL.-....KE......QRLDKI......................LLDD...............TISPFG..TDPLLSS.VS..PA..VSK.G..S.S.RR...S.S.F..S.SDDG..............
A0A2K6PBB9_RHIRO/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
F1RUY2_PIG/318-473                   ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAQ.LPP..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHGLSF...........GGGGTEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S3MG41_SALSA/358-490             ..................................................................................................MQARAHGLT...TD...TS..A..-L..CS.TE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYh........................vH-SQHQ..hHPA....................CT...................................................PDQ..VQ..YT..........TLELNDGASPyt......kghGGVSGDQR...PY.G.G..HL.-....-K......GALMDI......................LMDD...............TLSPVR.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.K..S.MEEN..............
A0A2K6CP54_MACNE/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5ZRU7_MANLE/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
F1PC33_CANLF/317-472                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsdegpgeal..............................llepevpdpeplPVV.PP.QAP.LPL..........................PAQPPQ...---....................--...................................................-PP..SP..FH..........HLDFSHSLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I2ZZ24_GORGO/235-387             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H0VLA3_CAVPO/224-342                 ..................................................................................................IQARAHGLP...SL...AS..L..--..GT.VD..L.G..A.HLTKHQ.....................................................--T.PE.QNS.VDY.........................cRQLT--...---....................-P...................................................SQG..PS..PK..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLND...............TVSPFG..TDPLLSA.AS..PA..VSK.S..S.S.RR...S.S.F..S.SEDG..............
A0A1S2ZW25_ERIEU/224-343             ..................................................................................................IQARAHGLP...IL...AS..F..--..GT.VD..L.G..A.PVNKQQ.....................................................TQL.EQ.NSV.DFC..........................QQLTPS...QG-....................--...................................................---..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGI......................LLDD...............AISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDD-a.............
A0A1A6GTJ4_NEOLE/4-129               ..................................................................................................MQARAHGLS...VI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITft......nnlGTMPESSP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A3Q3BHV3_KRYMA/250-398             ..................................................................................................IQARAHGLP...NM...AN..T..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.SPP.PVH..........................---QPQ...QPPl..................yQEdpnsdylqri...............................avltgvpsiaAAG..GP..QD..........HIQGADAGTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLNEI......................LMDD...............PLSPFG..TDPLLSA.SS..PG.vISK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2Y9R941_TRIMA/324-479             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpieegpgeal..............................llgaevpdpeplQAL.PP.QAP.PPP..........................PAQPP-...---....................--...................................................QQQ..SP..FH..........HLDFSHSLSF...........GGRGEEGP..pGY.S.E..PL.G....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
W5N2T2_LEPOC/319-485                 ..................................................................................................MQAKIHGLP...CS...SP..S..GM..GN.TE..M.L..S.SFVRLEsspeekasaeplrqpa.....................qlpqppqfshhqhahhQQA.QP.QPP.QLP.........................qPPQPPQ...QPI....................QY...................................................GSV..GS..SQ..........QLDFAQTLDL...........---CDNAA...GY.Q.D..PL.-....--......SQLTDLsftsps..........srkglgFMDE...............ILSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.MED-t.............
A0A093G807_DRYPU/259-378             ..................................................................................................IQARAHGLP...VM...SP..L..--..SA.VN..L.A..A.QFIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3P8ND57_ASTCA/249-404             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqs......................spQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
F6PGK5_CALJA/233-385                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A091GL13_9AVES/345-484             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEavgd............................................egtlePLL.PP.PDP.---..........................-ESQAQ...PAL....................PP...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGSQ...GF.P.D..SL.E....PCh....sASFPSLskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3P8SC09_AMPPE/336-520             ..................................................................................................MQARLHGLP...ST...SP..S..GL..NP.TD..M.M..A.SYIKQEtspednlshpqaqvhhqpqhlhh.......nqaqpqaqqhhylpqtqlhpqgqA--.--.---.--Qlqprq................lpmapQHLQPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFTQSLDL...........----CDGI..pGF.S.D..NM.-....--......SGLGDLggldvqg.......rrgelsflMMDE...............ALSPIG.gGDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A1U8C3V3_MESAU/319-469             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsedgp.......................................gealmlgP--.--.EVP.DPEq........................mPTLPPQ...APP....................PP...................................................AAQ..SP..FH..........HLDFSHSLSF...........GGGGDEGP..tGY.H.D..PL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q2H7T7_HORSE/487-612             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...TCT....................TT...................................................L-D..LT..DG..........TISFNNNLGT...........--GTESNQ...AY.S.I..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4H0H2_9CICH/389-517             ..................................................................................................LQARVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................spPLL.HP.FSS.---..........................----SS...SPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DESQGAAT...VF.S.P..DL.M....SD......MGLTDLngl................gglLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A452F9S1_CAPHI/225-344             ..................................................................................................IQARAHGLP...TL...AS..L..--..VT.VD..L.G..A.HITKQQ.....................................................THL.EQ.NSG.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDNM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SEDG..............
A0A1V4KX42_PATFA/401-538             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEasgd............................................egtlePLL.PP.PDP.ESQ..........................LVLPPA...---....................--...................................................-PQ..SP..YH..........QLDFTHSLSF...........---DDGSR...GF.P.D..SL.E....PGh....sASFPALskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
F7DV34_MONDO/397-522                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PE..L.V..N.RVIKQE.....................................................PIL.EN.CSQ.DVL..........................QHHPDL...---....................--...................................................---..TC..TT..........TLDLTDGTITfs......nnlGNGTETTT...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MED-t.............
A0A2Y9JY43_ENHLU/225-344             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.HSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.I..S.SDDG..............
A0A2U3W8M0_ODORO/339-464             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A401SIU1_CHIPU/367-491             ..................................................................................................MQARAHGLP...LV...NP..S..GL..CL.PD..I.T..G.RNIKLE.....................................................PVT.DE.CHS.DSL..........................QHHSDL...SRT....................--...................................................---..TA..AT..........TLNLSDGTLT..........fNDNLGHAG...TY.S.A..PT.K....MG......SKLDDI......................LMDD...............TLSPGE.aTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.VED-s.............
A0A3B5B5K3_9TELE/324-450             ..................................................................................................IQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QQS--S...---....................-A...................................................PDM..SP..PT..........TLDLNNGTITfd......qipADTGDP-G...PY.G.N..S-.-....QP......CKMKEL......................VRNN...............SLGPIS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MEEK..............
A0A2K5IC55_COLAP/236-388             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
K7G049_PELSI/329-447                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..V.V..S.RVIKQE.....................................................PVL.DN.CNQ.EVL..........................---QRH...S--....................--...................................................-DL..SC..TT..........TLDLTDGTIT...........--FSDNLG...PY.S.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vSDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A455AHL6_PHYMC/416-541             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A060X9E9_ONCMY/391-523             ..................................................................................................MQARAHGLT...TD...TS..A..-L..CS.AE..L.S..V.RGIKQE.....................................................PAL.GD.CHQ.DLY..........................-HVHPQhqhHPA....................CT...................................................PDQ..VQ..YT..........ILELNNGASPytk.....ghrGVSGD--M..gPY.G.-..-S.H....PK......GALMDI......................LMDD...............NLSPVG.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.K..S.MEEN..............
A0A060XNT6_ONCMY/113-273             ..................................................................................................MQARLHGLP...SS...SP..S..GM..GS.GD..L.M..G.SYIKQEtspeeklqqqqqaq.........................hqalsqgqqhlhhpQQL.PP.LPP.---..........................-HLQPQ...LPL....................QY...................................................PAV..GS..SQ..........PFDFAQSLDL...........---CDG-V..pGY.P.E..GL.-....--......SGLGELgllgtqg.......rrgdlgflMMDE...............PLSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IED-t.............
A0A3B5R978_XIPMA/251-399             ..................................................................................................IQARAHGLP...NM...AA..T..-L..GT.VE..L.S..S.HLLKQQ.....................................................Q--.QQ.SPP.QVQ..........................-QQQPQ..qPPI....................YQedpnsdylqr..............................iamvtgvssiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLEEI......................LMDD...............PLSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A2Y9JY38_ENHLU/286-405             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.HSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.I..S.SDDG..............
A0A3L8SCE4_CHLGU/475-600             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CTQ.DMM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPAG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A3B1JLY2_ASTMX/327-523             ..................................................................................................MQARLHGLP...ST...SP..S..GL.gNN.ME..M.M..N.PFVKQEsspeenhhnphqphmp....................mhhsqqqqqqqqqqqqqQ--.--.---.--QqqqqhqqhqqqhpgqpqqprglpplpQHLHPQ..pPPL....................QY...................................................SAV..GS..TQ..........PFDFAHSLDL...........---CDGGMp.gGY.S.D..GL.-....--......GCLGDLsslgggggcg.sqmgkkndmsyMLME...............ALSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IDD-a.............
A0A1D5QUV2_MACMU/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A498P5Z4_LABRO/8-133               ..................................................................................................IQARAHGLA...VA...SS..T..-L..CS.SE..L.A..P.RPIKQE.....................................................PVL.GD.CTQ.DMY..........................----PH...AHL....................SC...................................................PDI..GC..SS..........TLDLNDGTITfn.......dsST----ST..dAY.G.L..VT.K....AH.....gAKLDDI......................LMDD...............TLSSVA.tNDPLLTS.VS..SG..ASN.D..S.S.CK...D.S.V..S.MEEN..............
A0A4D9F0Y1_9SAUR/396-514             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..V.V..N.RVIKQE.....................................................PVI.DN.CNQ.DVL..........................QHR---...---....................--...................................................SDV..SC..TT..........TLDLTDGTIT...........--FNDNLG...TY.G.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A0A2I2Y5Q4_GORGO/334-486             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A091E7V9_CORBR/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CTQ.DMM..........................SHHTDL...---....................--...................................................---..SC..TT..........TLDLTDGTITfs......dnlGNVTEPAG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2K5SBU0_CEBCA/331-483             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
G3VKS4_SARHA/420-532                 .................................................................................................l-QAQIHGLP...LS...PA..S..--..-K.GD..P.L..E.CSAPQP.....................................................--L.PP.PPE.ALL..........................DLHFPG...DPL....................G-...................................................--E..LG..ED..........PFQLGL----...........--------...--.-.-..--.-....--......---EDI......................LMEEdeaataa.gllgsgtGLSPLRaaTDPLLSS.VS..PA..QSK.G.sS.S.RR...S.S.F..S.MEEE..............
A0A2K6RDG9_RHIRO/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLTv.................sqGP...................................................APE..LC..DQ..........AIAFSDPLSY...........--FTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q7VWL5_URSAR/396-521             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A3Q7R569_VULVU/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...P--....................--...................................................---..-C..TT..........TLDLTDGSITfn......nnlGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
H2ME84_ORYLA/354-477                 ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RAIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EQp........gTLELNDGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLAPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
G1N3A1_MELGA/250-383                 ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEag.................................................adEGM.LP.LPD.PES..........................QPV---...--L....................PP...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGSQ...GF.P.D..SL.E....PGh....sASFPSLskke..............ldlmLLQD...............TMLPLA..SDPLFSA.VS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3Q3BEN5_KRYMA/304-410             ..................................................................................................MQARIHGLA...NPa.gVP..S..GL..--.--..S.S..D.PSLLQH.....................................................---.--.---.---..........................-QAAPQ...---....................--...................................................-SS..QS..VS..........PLDLG-TLSF...........AELDDPSA...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cALSPER.gAEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.F..E.MDED..............
A0A3B5KP13_TAKRU/326-503             ..................................................................................................MQARLHGLP...GN...SP..T..VL..SA.AD..L.M..P.AYIKQEeenlahhqaqvhq...........................aqhlpqnqphpqvQ--.--.---.--Qhhflqhhlhheg.hpqpqarqlsllpSHMQPH...API....................QY...................................................PSV..GS..SQ..........PFDFAPALDF...........---SD-GI..pAF.S.D..GM.-....--......TGLGDLggldvqa........rrgelgfLMME...............ALSPIG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A2Y9K2X7_ENHLU/250-369             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.HSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.I..S.SDDG..............
A0A3P9DLA8_9CICH/358-481             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q2I515_HORSE/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...TCT....................TT...................................................L-D..LT..DG..........TISFNNNLGT...........--GTESNQ...AY.S.I..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4FLV4_9CICH/252-405             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQSs........................pQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A091ISK0_CALAN/259-378             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................---.-P.YPE.ENS..........................-VDYSQ..qMPL....................--...................................................AHR..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A151MKS6_ALLMI/290-399             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..-.V..N.RVIKQE.....................................................SVI.DN.CNP.DIV..........................QHRTDL...---....................--...................................................---..SC..TT..........TLDLTDGTITfs......dnlGNVTDSSS...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPD-..-------.--..--..---.-..-.-.--...-.-.-..-.----evvtskpdlskpgv
A0A096M2H9_POEFO/407-481             ...........................................................................................lpnpsls---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........FMDLDESHQA...........------SA...VF.S.T..DL.M....VEl....gAGLSGLga..................glLMEE...............DAGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
Q9PWC2_DANRE/285-410                 ..................................................................................................MQARAHGLT...VV...AS..S..SL..YS.AE..L.V..A.RAIKQE.....................................................PGM.GD.CTS.NLY..........................PH-LPS...---....................--...................................................PDM..SR..PT..........TLDLNNGTISy........ndSPTEDGEP..gVY.D.S..PN.K....AS......TKLEDM......................LMDN...............TLSPVG.sSDPLLSS.GS..PV..PSN.S..S.-.--...G.S.S..S.MDE-hdn...........
F1RUW6_PIG/292-447                   ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAQ.LPP..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHGLSF...........GGGGTEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5LZY5_CERAT/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H0VLD5_CAVPO/394-536                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL..IS.VA..T.TsaS.DSLKPE.....................................................-QL.DI.EEE.GRPstat.................fhvagAPVQNT...PQQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
G1Q720_MYOLU/431-573                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.iSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgvat.................fhaggAPAQGA...-PH....................QQ...................................................PPV.pPS..DT..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLTDI......................LMEEeegvl....gglsggALSPLRaaSDPLLSS.VS..PT..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q1HZA3_ANATE/248-370             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..V.RAIKQE.....................................................PIL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................--D..SP..PT..........TLDLNNGTITfd......qipA---DAGD...SY.G.-..-N.S....RT......CKMKEL......................VRDS...............TMSPIS.pSDPLLSS.MS..PE.gSNN.M..S.S.HS...S.S.S..S.MEEK..............
A0A096NU85_PAPAN/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1S3FHJ0_DIPOR/225-344             ..................................................................................................IQARAHGLP...AL...TS..L..--..GM.VG..L.E..A.HLTKQQ.....................................................-SH.PE.QNS.V--..........................DYCQQL...NLF....................--...................................................-QR..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDSL......................LLED...............TISPFG..TDPLLSA.TS..PA..VSK.A..S.S.RR...S.S.F..S.SEDG..............
A0A340WKU2_LIPVE/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K5ZRR0_MANLE/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
U3K6B7_FICAL/284-403                 ..................................................................................................IQARAHGLP...VI...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.---..........................-VDYPQ...QMP....................--...................................................--L..VH..GQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A2K5X0Y5_MACFA/334-486             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
U3JKB4_FICAL/315-454                 ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEasgd............................................egslePLL.PP.QDP.---..........................-ESQAQ...PAL....................PA...................................................PPQ..SP..YH..........QLDFTHSLSF...........---DDGSQ...GF.P.D..SL.E....PGh....sSSFPSLskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-t.............
A0A3Q1IA37_ANATE/275-419             ..................................................................................................IQARAHGLT...NM...PT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QS.SPQ.AQQp.......................llYQEDPN...SDYlqriav........vagvpsLP...................................................SAG..GP..QD..........HIAGADGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HQLDKI......................LMED...............PLSPFG..ADPLLSA.TS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A3B3R5X3_9TELE/237-351             ..................................................................................................IQARAHGLP...NM...AP..P..VL..GQ.VE..L.S..S.PLQSQP.....................................................-AL.PM.HQE.GSS..........................-GEYAQ...ST-....................--...................................................---..VS..AA..........AAAFSDPLTH...........--FTDF--...-F.G.A..TL.K....EE......QRLEHI......................LMDG...............PLSPFG..ADPLLSS.TS..PA..ASK.G..S.S.RR...S.S.F..S.TDEG..............
G3RXC5_GORGO/396-548                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
H2U0V2_TAKRU/355-475                 ..................................................................................................MQARAHGIS...IA...SS..A..-L..CS.AE..L.A..I.RSIKQE.....................................................TSL.ED.CHQ.DIY..........................T-LHPH..hPPC....................--...................................................-TP..ET..PG..........TLELNESHAN...........--F--PKG...HY.G.V..QG.K....PG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2I3G980_NOMLE/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAVAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1U8CVW0_MESAU/473-614             ..................................................................................................LQAQIHGLP...VP...PT..P..GLlsLA.TS..S.G..S.DSLKPE.....................................................-QL.DI.EEE.GRPntas.................fhvsgGPVQNT...PQQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegvmg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3P8QW18_ASTCA/348-474             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
W5KIZ0_ASTMX/311-452                 ..................................................................................................MQARLHGLP...ST...SP..S..GL.gNN.ME..M.M..N.PFVKQE.....................................................-SL.PP.LPQ.---..........................-HLHPQ..pPPL....................QY...................................................SAV..GS..TQ..........PFDFAHSLDL...........---CDGGMp.gGY.S.D..GL.-....--......GCLGDLsslgggggcg.sqmgkkndmsyMLME...............ALSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IDD-a.............
G1M3A1_AILME/311-466                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................lleaevpdpeplPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGEEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5V9Z3_MACFA/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2U3Z7J0_LEPWE/52-177              ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A2K6T440_SAIBB/290-415             ..................................................................................................MQARAHGLS...LI...PT..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGAEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q4HFS1_NEOBR/358-481             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..V.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQ-....................QH...................................................PACtpET..PS..........NLELNEGHSN...........--FSE--G...HY.G.V..HS.K....SG......SKLSDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
K7FWC1_PELSI/339-453                 .................................................................................................r-QAHLHGLP...AS...PP..S..GV..NV.DG..R.S..T.RGARRP.....................................................LPL.PP.P--.---..........................------...SPY....................--...................................................---..--..--..........QLDFSHSLSF...........---DDGSG...GF.H.D..HL.D....PSh....nVSFPSLskke..............ldlmLMED...............TMLPMA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3P9QE27_POERE/357-489             ..................................................................................................MQARLHGLP...AA...QQ..Q..A-..--.-A..V.A..V.PHAAQNpgaatt........................................lnlsalgAIA.QP.LPA.---..........................SFLSPP...SSD....................SP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDPTA...--.-.S..AL.Y....PD......VGLGDI......................LMDDg.............cALSPER.mGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A3Q2TT68_CHICK/224-343             ..................................................................................................IQARAHGLP...VM...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................AHG..PN..SD..........VCDGSTAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A2K5LZZ5_CERAT/321-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2U3Y4C3_LEPWE/327-468             ..................................................................................................LQAQIHGLP...VP...PS..P..GL.lSL.AT..TsA..S.DGLKPE.....................................................-QL.DV.EEE.GRPatap.................fpaagGSAQSA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeeggv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2D0T5A8_ICTPU/318-469             ..................................................................................................IQARAHGLP...SN...--..-..-L..GA.AE..I.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QALpapav................tpgaqTSLYPQ...DELngp..............eylQRnslsvl.......................................hagnegNSS..SS..GE..........HADAT-STTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEL......................LMEE...............ALSPFG..TDPLLSA.TS..PN..ASK.G..S.S.RR...S.S.F..S.TDDN..............
F6UXU7_MACMU/375-500                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q1B2R1_AMPOC/469-579             ..................................................................................................VQARLHGFS...SS...AP..P..PP..SS.SP..L.A..P.PTLLSS.....................................................---.-P.LPP.---..........................-FSSPS...SPL....................--...................................................--V..TP..PL..........GLDALSFVEL...........EDPRGASA...VF.S.P..EL.L....PE......AGLQGV......................LLME...............D--GVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A3Q1CWH3_AMPOC/244-370             ..................................................................................................IQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHNSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTISfd......hipADAGDP-G...SY.G.-..-N.S....RT......CKMKEL......................VRDK...............GLGPIS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MDEK..............
H0VS91_CAVPO/397-522                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DIL..........................QHHPDL...SCT....................T-...................................................TLD..LT..DG..........TISFNSNLGT...........--GAEGNP...AY.S.V..PT.K....MA......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q1CG76_AMPOC/318-474             ..................................................................................................MQARLHGLP...ST...SP..S..GL..NP.TD..M.M..A.SYIKQEtspednlsh...................................pqaqvhhqpQ--.--.---.HLHhnql..................pmapQHLQPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFTQSLDL...........----CDGI..pGF.S.D..NM.-....--......SGLGDLggldvqg.......rrgelsflMMDE...............ALSPIG.gGDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3Q1JPW1_ANATE/329-512             ..................................................................................................MQAHLHGLP...NT...SP..S..GL..NP.SD..M.M..A.PYIKQEtsseenlsipqvqahhhhqhlqqnq..aqpqaqqhpffpqnhlhpqgqaqpqpR--.--.---.--Qlp.....................plpQHLQPQ...PPI....................QF...................................................PAV..GS..SQ..........PFDFAQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMG..RDPLLSA.MS..PE..ASV.N..S.S.RR...S.S.F..S.IEDG..............
A0A2Y9FNE0_PHYMC/228-353             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q0D489_MESAU/196-314             ..................................................................................................IQARAHGLP...ML...AS..L..--..GT.AD..F.S..P.YITKQQ.....................................................--A.HP.EKN.SVGc........................cQQLTPS...---....................--...................................................-QG..TS..PE..........FCEQAVAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLSD...............TICPFG..TDPLLSA.TS..PA..VSK.A..N.S.R-...S.S.F..S.SED-s.............
A0A3Q7S9Z0_VULVU/327-468             ..................................................................................................LQAQIHGLP...VP...PT..P..GL..L-.-S..L.A..T.TSASD-.....................................................-SL.KP.EQL.DIE..........................EESRPG...TATfha..............aggS-...................................................---..--..AQsaphqhppvpPSDALLDLHFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q3AH24_CHICK/342-479             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEagad............................................egmlePLL.PP.PDP.ESQ..........................PVLPPL...---....................--...................................................-PQ..SP..YH..........QLDFSHSLSF...........---DDGSQ...SF.P.D..SL.E....PSh....gASFPSLskke..............ldlmLLQD...............TMLPLA..SDPLFSA.VS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A452FLK6_CAPHI/375-499             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PE..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITfn.......slGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A340WDR3_LIPVE/339-464             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2I4CRT2_9TELE/306-450             ..................................................................................................MQARLHGLS...APasvPP..A..LS..SD.AS..L.L..Q.HQAVPRs...................................................gPSV.PA.GA-.--Saqnf..................vglgAAGQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDPSA...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cVLSPEQ.gAEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.F..D.MDED..............
G3TRU7_LOXAF/427-567                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-HL.DV.---.--Eeegrp...............gtfhveGARAPN...ASY...................qQP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeesvv....gglsggTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3B3UD48_9TELE/406-483             ........................................................................................spllpnpsls---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........FMDLDESHQA...........------SA...VF.S.T..DL.M....AEl....gAGLSGLga..................glLMEE...............DAGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A455AI17_PHYMC/410-535             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAATESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
F7C2Z2_CALJA/397-539                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvagGPTQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3P8WVZ5_CYNSE/398-522             ..................................................................................................MQARAHGLA...IS...SS..A..-L..CS.SD..L.G..P.RSIKQE.....................................................PTL.DD.CHQ.DLYs.......................yhLHHQHH...PDC....................--...................................................-TP..EP..PG..........ALEPNEGHSN...........----YPES...HY.S.S..AHnK....AG......SKLNDI......................LMED...............TISPVR.gGDPLLSS.VS..PD..TSK.G..S.S.RK...S.S.V..S.MDEN..............
A0A3B3WXV6_9TELE/368-492             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..A.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................-H...................................................PAG..TP..EQp........sTLELTKGHSN...........--FPEG--...HY.GsV..HG.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
W5NWB4_SHEEP/334-445                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................llgaevpdpeplPAL.PP.QAP.LPP..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHNLSF...........GGGGNEGP..pGY.P.E..PL.G....PE......H-----......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----aspfpnls......
A0A452GJU4_9SAUR/352-470             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVI.DN.CNQ.DVL..........................---QRH...S--....................--...................................................-DL..SC..TT..........TLDLTDGTIT...........--FSDNLG...TY.S.V..PT.K....VG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A0A3B4BS06_PYGNA/256-384             ..................................................................................................MQARAHGLT...VG...SS..T..AL..CS.TE..L.V..A.RAIKQE.....................................................PGL.GN.CSS.DLY..........................AHTHLP...---....................-S...................................................PDL..TR..TT..........TLDLNNGTISyn......dspTEEPD-GG...LY.S.S..HD.K....AS......GKLEDM......................FMDN...............ALSPMG.sSNPLLSS.GS..PT..HSN.S..S.S.RR...S.S.S..S.TEEQ..............
A0A3P8YVL2_ESOLU/394-525             ..................................................................................................MQARAHGLN...TA...SS..A..-L..SP.AE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYs........................vHPQHQH...HPA....................CT...................................................ADQ..AQ..SS..........TLELNDVACSy........teGHGSDP-G...PY.S.A..HT.K....RS......VKHNDI......................LMDD...............TLSQVG.aGDPLLSA.VS..PG..ASK.D..S.S.CS...G.S.V..S.MEEN..............
A0A2K6KIG0_RHIBE/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLTv.................sqGP...................................................APE..LC..DQ..........AIAFSDPLSY...........--FTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2D0T642_ICTPU/270-421             ..................................................................................................IQARAHGLP...SN...--..-..-L..GA.AE..I.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QALpapav................tpgaqTSLYPQ...DELngp..............eylQRnslsvl.......................................hagnegNSS..SS..GE..........HADAT-STTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEL......................LMEE...............ALSPFG..TDPLLSA.TS..PN..ASK.G..S.S.RR...S.S.F..S.TDDN..............
A0A3Q4GPS7_NEOBR/352-480             ..................................................................................................LQARVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................stPLL.HP.FSS.---..........................----SS...APS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DEPQGAAT...VF.S.P..DL.M....SD......MGLTDLngl................gslLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
M3XD75_FELCA/376-501                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTEGNQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-t.............
L5KRU2_PTEAL/225-344                 ..................................................................................................IQAHAHGLP...TL...AS..L..--..GT.ID..L.D..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................QHLTLS...QR-....................--...................................................---..AS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QKLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SGD-g.............
A0A3Q1CVH3_AMPOC/304-449             ..................................................................................................MQARVHGLS...TPt.sMS..S..GL.gSD.PS..LlQ..Q.QAVPQS....................................................gQSL.PP.NTG.GASthnl..................lslgAAGQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDT--...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cALSPER.lAEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A3B4ANV4_9GOBI/367-489             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..A.RQIKQE.....................................................PTM.ED.CHQ.DIY..........................-TLHPQ...H--....................-H...................................................QAC..TP..DHp........tSLELSDGHGN...........---YQESS...HY.S.V..HN.K....AG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASQ.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q1GHQ8_9TELE/383-506             ..................................................................................................MQARAHGLA...TA...SS..A..-L..CS.GE..L.G..P.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TS..EPp........gTLELSEGHSN...........----YPEG...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A340WN55_LIPVE/327-469             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQST...PHQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2I4APU5_9TELE/346-528             ..................................................................................................MQARLHGLP...ST...SP..S..GI..SM.TE..V.M..P.PYVKQEtsqeenfshpppqahhqhqhqhl......phsqappqaqqhhflpqnnlhpqgQAL.--.---.--Pppr....................qlpPLQHLQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..pGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgelgflMMDE...............PLSPIG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3B4CRJ9_PYGNA/280-427             ..................................................................................................IQARAHGLP...ST...--..-..-L..GA.VE..L.S..S.HLLKQQ.....................................................QHQ.AP.QPV.QGP..........................QAPQAS...QPA....................LYpqeelngpeylq..........................rtslpsivpagggGGG..GV..SE..........QADVSTTFSDp.........lSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDE...............ALSPFG..ADPLLSA.TS..PA..ASK.G..S.S.RR...S.S.F..S.TDDG..............
TFEB_MOUSE/320-472                   ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsedgpgeal..............................mlgpevpepeqmPAL.PP.QAP.LP-..........................SAAQPQ...SPF....................--...................................................---..--..-H..........HLDFSHGLSF...........GGGGDEGP..tGY.P.D..TL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B5KJ49_TAKRU/415-541             ..................................................................................................LQSRLHTAA...APl.pAS..T..SS..SS.SS..L.D..P.QVLLSP.....................................................-HL.PQ.PFS.---..........................-SSSPS...SS-....................SS...................................................SLV..TP..SL..........GLDALSFVEL...........EEPQRTST...VF.S.S..DL.M....SDvgltglHSLGDI......................LMEE...............VGRGAG..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A452FM93_CAPHI/391-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PE..L.V..S.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHAD-...---....................--...................................................--L..TC..TT..........TLDLTDGTITfn.......slGAGTESSQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A087XPS1_POEFO/309-444             ..................................................................................................MQARLHGLP...AA...QQ..Q..Q-..QQ.AA..V.A..V.PHAGQNpgaa............................................ttlnlS--.--.---.--Al........................gAIAQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDP--...-T.T.S..AL.Y....PD......VGLGDI......................LMDDg.............cALSPER.mGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
G3P7X1_GASAC/314-453                 ..................................................................................................MQARHHSLS...PD...PS..L..-L..HQ.QQ..-.-..-.---VQHg...................................................gPSL.PQ.GAD.GVSsqnllsmga........sgigqplpaS-----...--Flsp.............pssdSP...................................................AGV..TI..SS..........PLDLG-GLSF...........AELDDDSA...--.-.S..GL.Y....PD......VGLGDF......................LMDEv.............yTLSPER.mAEPLFSP.LS..PG..ASK.G..S.S.RR...S.S.L..E.MDED..............
A0A3Q3NP06_9TELE/387-510             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CT.AE..L.G..T.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPQ...HQH....................-H...................................................PAC..TP..EP..........PGSLELNEVH...........SNFQEG--...HY.S.T..HN.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2I2UES6_FELCA/157-276             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A3Q2HHQ5_HORSE/430-555             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PAL.EN.CNQ.DLL..........................QHHADL...TCT....................TT...................................................L-D..LT..DG..........TISFNNNLGT...........--GTESNQ...AY.S.I..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
W5UDU2_ICTPU/278-407                 ..................................................................................................MQARAHGLA...VG...GS..S..AL..CS.TE..L.V..A.CAIKEE.....................................................PISyTS.CSS.---..........................-DLYTR...SHL....................SS...................................................PDH..SR..PT..........TLDLNNGTISy........sdSTTEEAET..eLY.A.S..HK.E....SS......TKLDDM......................FLEN...............TLSPVG.tSNLLLSS.GS..PT..HSN.D..S.S.RR...S.S.T..S.TEEQ..............
A0A2K5MJT1_CERAT/372-497             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K6LR77_RHIBE/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3B3I884_ORYLA/335-458             ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RAIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EQp........gTLELNDGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLAPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3B3VMK7_9TELE/432-509             ........................................................................................spllpnpsls---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..--..--..........FMDLDESHQA...........------SA...VF.S.T..DL.M....AEl....gAGLSGLga..................glLMEE...............DAGGAV.mSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2K5MGZ3_CERAT/158-277             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGI......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P8TEY6_AMPPE/251-410             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GS.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqqqq..................qsppQAQ---...---....................-Qphqpplyqedpngd......................ylqripvvtgvpsiaTVS..GP..QD..........HIAGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......HPLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
G3W772_SARHA/333-485                 ..................................................................................................MQARVHGLP...TA...SP..S..GV..NM.AE..L.A..Q.QVVKQElpseegl.......................................gepllptAEL.PD.QEP.SLT..........................LPPQPP...PPP...................pPP...................................................LPP..QS..PY..........QLDFSQNLSF...........S-GGEGPQ...GF.P.D..PL.G....PEh....gSLFPSLskke.............ldhlmLLDD...............TMLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q7TDR0_VULVU/225-344             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......HRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2K5SBU5_CEBCA/233-385             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B3YA37_9TELE/252-404             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQS.PPQ.........................vQQQQPQ..qPPI....................YQedpnsdylqr..............................iavvtgvpsiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A3B5Q5N0_XIPMA/252-400             ..................................................................................................IQARAHGLP...NM...AA..T..-L..GT.VE..L.S..S.HLLKQQ.....................................................Q--.QQ.SPP.QVQ..........................-QQQPQ..qPPI....................YQedpnsdylqr..............................iamvtgvssiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLEEI......................LMDD...............PLSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
W5NBS7_LEPOC/437-589                 ..................................................................................................MQARLHGLA...TP...AS..S.iGT.ePA.VS..L.L..Q.PQQKQG....................................................gQQL.EP.SSG.DALsasllpassl......gggaalpfpsSYISPP...PST....................SP...................................................GGV..AM..NS..........PHDLG-SLSF...........AELDDSAA...AF.N.S..AL.M....SD......VGLGDI......................LMDDg.............gALSPVG.aADPLLCS.VS..PG..ASK.S..S.S.RR...S.S.F..S.MEED..............
A0A2K6EK02_PROCO/327-479             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpgeegpgetl..............................mlgaevpdpeplP--.--.---.---..........................-ALPPQ...APL....................GP...................................................PAQppSP..FH..........HLDFSHSLSF...........AGGDDEGP..pGY.P.E..AL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5EA08_AOTNA/196-315             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QTS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLHD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A3B4F555_9CICH/243-369             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3B3R457_9TELE/272-386             ..................................................................................................IQARAHGLP...NM...AP..P..VL..GQ.VE..L.S..S.PLQSQP.....................................................-AL.PM.HQE.GSS..........................-GEYAQ...ST-....................--...................................................---..VS..AA..........AAAFSDPLTH...........--FTDF--...-F.G.A..TL.K....EE......QRLEHI......................LMDG...............PLSPFG..ADPLLSS.TS..PA..ASK.G..S.S.RR...S.S.F..S.TDEG..............
A0A093FWR9_DRYPU/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A1A6GK01_NEOLE/319-471             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpgedgpgeal..............................mlgpevsdpepmPAL.PP.QAP.LP-..........................PAAQPQ...SPF....................--...................................................---..--..-H..........HLDFSHSLSF...........GGGGDEGP..tGY.H.N..PL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLXST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q3N7Y4_9TELE/360-483             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CT.AE..L.G..T.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPQ...HQH....................-H...................................................PAC..TP..EP..........PGSLELNEVH...........SNFQEG--...HY.S.T..HN.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
Q9IAU0_CHICK/256-381                 ..................................................................................................MQARAHGLS...LV...PS..T..GI..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2K6U7Z4_SAIBB/332-484             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1U7TH36_TARSY/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGSEASQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2K6GN74_PROCO/397-522             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nslGPGTEGSQ...VY.G.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A452F9Y3_CAPHI/158-277             ..................................................................................................IQARAHGLP...TL...AS..L..--..VT.VD..L.G..A.HITKQQ.....................................................THL.EQ.NSG.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDNM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SEDG..............
A0A3Q0QQ07_AMPCI/356-479             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..I.G..A.RTIKQE.....................................................PAL.DD.CHQ.DLY..........................-TLHPH..hQHH....................PA...................................................CTP..ET..PS..........NLELNEGHSN...........--FSE--A...HY.G.V..HS.K....SG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A151MKB9_ALLMI/390-499             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..-.V..N.RVIKQE.....................................................SVI.DN.CNP.DIV..........................QHRTDL...---....................--...................................................---..SC..TT..........TLDLTDGTITfs......dnlGNVTDSSS...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPD-..-------.--..--..---.-..-.-.--...-.-.-..-.----evvtskpdlskpgv
A0A2K5RBQ3_CEBCA/390-515             ..................................................................................................MQARAHGLS...LI...PT..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
G3UUK0_MELGA/256-381                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2I3GG15_NOMLE/331-483             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q2IHR8_HORSE/326-483             .............................................................dyirrmqkdlqksrelenhsrrlemtnkqlwlriqel---------...--...--..-..--..--.--..-.-..-.-----Emqalllga.....................................evpdpeplPAL.PP.QAP.LPP..........................PAQPPQ...P--....................--...................................................--P..SS..FH..........HLDFSHSLSF...........GDGGDEGP..pGY.P.E..PL.G....PEh....gSLFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I2YDB9_GORGO/323-475             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
I3KT52_ORENI/330-513                 ..................................................................................................MQARLHGLP...SN...SP..S..GL..NT.GD..I.M..G.SYIKQEtsleenhshpqaqahhqpqhlphnq..ahpqaqqhqflshthfhpqgqgqpepRQL.PP.LPQ.---..........................-HLQPQ...PPI....................QY...................................................PAV..GS..SQ..........HFDFAQSLDL...........---CD-GI..sGF.S.D..GM.-....--......SGLGDLggldvqa.......rrgdlgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A401RTS5_CHIPU/131-260             ..................................................................................................MQAQAHGLS...TA...SP..S..GL..NT.SE..L.T..GcSSIKPE.....................................................QNV.MD.MFQ.HQQ.........................hQHLQPP...Q--....................--...................................................SQV..DF..PQ..........ALDFCDSSLGft......dpmNQFTDL--...SF.S.I..PT.K....KE......YQLDEM.....................lMMDD...............AVSPLG..RDPLLSS.GS..PE..ASK.A..S.S.RR...S.S.I..S.IDD-a.............
A0A2I0LMJ9_COLLI/157-294             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEasgd............................................egtlePLL.PP.PDP.ESQl........................vVPPPPQ...S--....................--...................................................---..-P..YH..........QLDFTHSLSF...........---DDGSR...GF.P.D..SL.E....PGh....sASFPALskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
H3AEP1_LATCH/381-501                 ..................................................................................................MQARQHGLP...VA...SP..S..GL..NM.SK..L.A..V.EIIKQE.....................................................SDL.KQ.GAI.---..........................GFLEPL...APL....................--...................................................--G..LA..ST..........TLDLN-TFNF...........SDLDNPVM...TF.G.L..GL.D....PD......PSIEDI......................LMED...............TLSPIS.aSDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.F..S.MEEE..............
TFE3_MOUSE/431-571                   ..................................................................................................LQAQIHGLP...VP...PN..P..GLlsLT.TS..S.V..S.DSLKPE.....................................................---.--.-QL.DIEeegrps.............ttfhvsgGPAQNA...PPQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegmvg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A452GK04_9SAUR/318-440             ..................................................................................................MQAQLHGLP...LT...SS..A..GL..LP.LG..C.S..G.EGAKPE.....................................................---.GP.GPP.PFR..........................----GG...PSC....................-A...................................................PAP..TS..SA..........ACLLDLAFPS...........EELGEAGL...GF.P.L..GL.G....VD......GGLEDI......................LMEDg.............gPLSPLG.aSDPLLSS.LS..PG..ASK.G..S.S.RR...S.S.F..S.MEED..............
H0Y0F7_OTOGA/432-574                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.DEE.G-Rpgtta................fhvvgGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q3FKH9_KRYMA/387-509             ..................................................................................................MQARAHGLS...IS...SS..A..-L..CS.AE..L.E..A.RTIKQE.....................................................PAL.ED.CHR.DLY..........................-TLHPH...HHH....................HH...................................................HLH..QH..QH..........HAGCAPEQAG...........AQPELGEG...HY.S.A..Q-.-....--......SKAGDV......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A2U3XCB5_LEPWE/196-315             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..V.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2Y9JDZ6_ENHLU/319-474             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................lleaevpdpeplPVL.PP.QAP.LPL..........................PAQPPQ...PP-....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5SBU2_CEBCA/332-484             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S2ZW41_ERIEU/158-277             ..................................................................................................IQARAHGLP...IL...AS..F..--..GT.VD..L.G..A.PVNKQQ.....................................................TQL.EQ.NSV.DFC..........................QQLTPS...QG-....................--...................................................---..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDGI......................LLDD...............AISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDD-a.............
G7P2I1_MACFA/225-344                 ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3B5R4G6_XIPMA/289-437             ..................................................................................................IQARAHGLP...NM...AA..T..-L..GT.VE..L.S..S.HLLKQQ.....................................................Q--.QQ.SPP.QVQ..........................-QQQPQ..qPPI....................YQedpnsdylqr..............................iamvtgvssiaTAS..GP..QD..........HIQGADACTTfs......dplSHFTDF--...-F.T.A..TL.K....EE......NQLEEI......................LMDD...............PLSPFG..ADPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-a.............
A0A3Q2DE40_CYPVA/276-400             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DIY..........................QHNCTP...---....................--...................................................-EM..SP..PT..........TLDLNNGTIT..........fDHIPADAG..dSY.G.-..-N.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSH.N.vS.S.RH...SsS.S..S.MDE-k.............
A0A1D5R887_MACMU/339-464             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A087RBZ2_APTFO/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A1U8C1U8_MESAU/228-353             ..................................................................................................MQARAHGLS...LI...PS..S..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.ELV..........................QHQTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITft......nnlGTMPESNP...AY.S.I..PR.K....MG......SNLEDI......................LMDD...............ALSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.AEE-t.............
A0A384B688_BALAS/158-277             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P8YER7_ESOLU/251-397             ..................................................................................................IQALAHGLP...NM...AT..S..-L..GT.VE..L.S..S.HLLKQQ.....................................................-QQ.QH.QPQ.ASQp.......................eeTQKGPQ...PPM....................YQeevngeyl..................................qrtsmpamaPGA..TE..QG..........PGAVDGSTTFsd.......plSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMED...............PLSPFA..TDPLLSA.GS..PA..TSK.D..S.S.QR...S.S.F..S.SDDE..............
A0A091WBC3_OPIHO/339-464             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................PHHRD-...---....................--...................................................--L..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2K6T408_SAIBB/381-506             ..................................................................................................MQARAHGLS...LI...PT..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGAEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1U7QQD1_MESAU/378-528             ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsedgp.......................................gealmlgP--.--.EVP.DPEq........................mPTLPPQ...APP....................PP...................................................AAQ..SP..FH..........HLDFSHSLSF...........GGGGDEGP..tGY.H.D..PL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2I3TFC5_PANTR/395-547             ..................................................................................................MQARVHGLP...TA...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5RBQ6_CEBCA/397-522             ..................................................................................................MQARAHGLS...LI...PT..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A498N1Q2_LABRO/373-524             ..................................................................................................IQARAHGLP...SM...AA..S..-M..GA.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.HQP.VTPapl....................stqA-----...-PL....................QPgqpplypqedmsn.........................peytqrtplpaamIAG..NA..GE..........QTDGSNTFSDp.........lSHFTDF--...-F.C.S..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PA..ASK.G..S.S.RR...S.S.F..S.SEE-a.............
B5X456_SALSA/345-480                 ..................................................................................................MQACLHGLS...TP...AS..S..S-..-Q.GS..S.S..-.SHLSLS.....................................................QSL.DP.STG.DALsk.....................tllS-----...--Lrg...............dlgLQ...................................................ATS..PS..ASp.......vgLMNMASPLSF...........SELDDPSA..aAF.H.S..SL.L....PD......MGLGDI......................LMDHg............giGMSPVW.aREPLLSS.FS..PG..PSK.T..S.S.RR...S.S.F..S.MEK-d.............
A0A1S3GGI4_DIPOR/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL..--.LS..L.A..T.TSTSDS.....................................................--L.KP.EQL.DIEeegrssa............atfhvggGPAQSA...VHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsgvALSPLRatSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3Q7X328_URSAR/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CGQ.DLL..........................QHHADL...---....................--...................................................---..PC..TT..........TLDLTDGTITfn......nnlGAGTESNQ...AY.S.I..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-a.............
A0A3Q7XGM5_URSAR/262-381             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q2LBG1_HORSE/269-388             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.QVTKQQ.....................................................THL.EQ.NSV.DYC..........................QQLT--...--I....................--...................................................SQG..TS..PE..........LSDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3P8QTW4_ASTCA/271-397             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3B4CTH8_PYGNA/241-388             ..................................................................................................IQARAHGLP...ST...--..-..-L..GA.VE..L.S..S.HLLKQQ.....................................................QHQ.AP.QPV.QGP..........................QAPQAS...QPA....................LYpqeelngpeylq..........................rtslpsivpagggGGG..GV..SE..........QADVSTTFSDp.........lSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDE...............ALSPFG..ADPLLSA.TS..PA..ASK.G..S.S.RR...S.S.F..S.TDDG..............
R0LNY2_ANAPL/364-489                 ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PAL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNMTEPTG...TY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2U4AI59_TURTR/196-315             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3M0JCX1_HIRRU/353-478             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CTQ.DMM..........................----PH...---....................-H...................................................ADL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPAG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2I3GHW4_NOMLE/233-385             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3Q1GKA7_9TELE/365-488             ..................................................................................................MQARAHGLA...TA...SS..A..-L..CS.GE..L.G..P.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TS..EPp........gTLELSEGHSN...........----YPEG...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A1U7SWQ4_TARSY/284-409             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CNQ.DLL..........................QHHTDL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGSEASQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A1S3MYP2_SALSA/328-472             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A3B5BK81_9TELE/244-370             ..................................................................................................IQARAHGLT...VM...SS..S..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QQS--S...---....................-A...................................................PDM..SP..PT..........TLDLNNGTITfd......qipADTGDP-G...PY.G.N..S-.-....QP......CKMKEL......................VRNN...............SLGPIS.pSDPLLSK.MS..PCisNSV.G..S.H.HS...S.S.S..S.MEEK..............
A0A2K5X911_MACFA/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A401NR04_SCYTO/348-464             ..................................................................................................MQARVHGLP...TM...SS..A..-P..SP.TE..L.V..T.HLVKHE.....................................................SYQ.GD.NCP.DYL.........................qQQSLPQ...-ML....................NE...................................................LNE..GS..CG..........---------Fld.......plSHFTDL--...SF.S.A..AL.K....QE......NRLDNI......................LIDN...............TIS---..-DPLLSAaTS..PD..ASK.G..S.S.RR...S.S.F..S.TDEE..............
A0A3B4B6P2_9GOBI/328-483             ..................................................................................................MQARLHGLP...SS...SP..S..GL..NP.AD..L.M..A.SFIKQEtspdetlshp................................qvqghhphlphN--.--.-QQ.QQQqq......................qpLHQQQP...PPI....................QY...................................................PAV..GS..SQ..........-YDYTSTLDF...........---VDGMV...GF.S.D..GM.-....--......GGLGDMtgvdaqg.......rrsdlsflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A384AYI9_BALAS/391-516             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-t.............
A0A2U9C2R2_SCOMX/455-580             ..................................................................................................MQARAHGLS...IA...SS..L..--..CS.AD..L.G..P.RSIKQE.....................................................PAL.DD.CHQ.DLYt.......................fhP----H...HQH....................HH...................................................PAC..TP..EPp.......pgALELGEGHVA...........----DYPD..gLY.G.V..HG.K....PS......SKLDDI......................LMED...............ELSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.L..S.MDEN..............
F6TIG8_ORNAN/319-469                 ..................................................................................................MQARLHGLP...TA...SP..S..GV..NV.AE..L.A..Q.QLVKQElqlp............................................gdegvG--.--.---.--Epprpsgl............adqelprPLLPPP...SPFh..................qAL...................................................YKL..EX..FH..........QTEFSPSVNFgdgp..pgildPTGPDPGS...SF.P.A..L-.-....SK......RELDLM......................LLDE...............SVLPLA..PDPLFPA.MS..PE..ASK.A..S.S.RR...S.S.F..S.VEEG..............
H2ME80_ORYLA/367-490                 ..................................................................................................MQARAHGLP...IT...SS..A..-L..CS.VE..L.G..V.RAIKQE.....................................................PAL.ED.CHQ.DMY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EQp........gTLELNDGHSN...........--FPE--G...HY.N.V..HS.K....AG......SKLNDI......................LMED...............TLAPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3Q3NDX1_9TELE/302-449             ..................................................................................................MQARLHGLA...TSnnlSS..G..LS..SD.PS..L.-..-.--LQQQqllqg...........................................sqglpP--.--.TV-.--Ggaptq...............nplsmgAIGQPL...PASflsp............pssdST...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDSSA...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cTLSPER.vAEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A2K6R668_RHIRO/335-487             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3P8TMY9_AMPPE/349-472             ..................................................................................................MQARAHGLA...IA...SS..A..-L..CS.AE..L.G..P.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TP..EPp........gTLELSEGHSN...........----YPEG...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A1L8GYW0_XENLA/255-366             ..................................................................................................IQARAHGLP...MP...--..-..TL..CT.VE..I.A..S.QVIKQQ.....................................................TYR.ED.MAQ.---..........................------...DYA....................SQ...................................................LPV..SI..GQ..........TTDLCDVSTSfs......dplSHFTDL--...SF.T.-..--.-....--......AALKEQ......................ML-E...............EMSPYG..ADPFLSA.TS..PD..LSK.G..S.S.RR...S.S.F..S.TDDG..............
A0A3B4X206_SERLL/248-374             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......qipEDAGDV-G...PY.G.-..-N.S....RT......CKMKEL......................VRDN...............TLSSIS.pTDPLLSS.MS..PD..VSN.N.vS.S.HH...S.S.T.sS.MEE-k.............
A0A3B4XW15_SERLL/319-453             ..................................................................................................MQARIHGLS...NSn.sIS..S..GL.gSD.PS..L.L..Q.HAGGAPsqnl.............................................lslgAIG.QP.LPA.---..........................SFLSPP...SSD....................SP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDTSA...--.-.S..AL.Y....PD......VGLGDI......................LMDDg.............cTLSPER.vGDPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
I3LY70_ICTTR/196-315                 ..................................................................................................IQARAHGLP...TV...TS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-TH.PE.QNS.---..........................-VDYSQ...QLT....................-L...................................................SQG..PS..PE..........LCDQALAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDI......................LLDN...............TISPFG..TDPLLSA.AS..PA..VSK.A..S.S.RR...S.S.F..S.SEDG..............
G3R351_GORGO/225-344                 ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKRQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAVAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A402EJR4_9SAUR/335-477             ..................................................................................................MQARVHGLP...AS...SP..S..GM..NV.AE..L.A..H.QVVKQEasgee..........................................gttteiQQQ.PP.LHP.DQE..........................TRH---...QPT....................YV...................................................PPQ..SP..YH..........QLDFTHNLSF...........---DENSR...GF.H.D..VL.D....PSq....nVSFPSLskke..............ldlmLMED...............TMLPVA..SDPLFSA.VS..PE..ASK.T..S.S.RR...S.S.F..S.MED-t.............
F6W7D6_MOUSE/179-331                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpsedgpgeal..............................mlgpevpepeqmPAL.PP.QAP.LP-..........................SAAQPQ...SPF....................--...................................................---..--..-H..........HLDFSHGLSF...........GGGGDEGP..tGY.P.D..TL.G....TEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K5WM80_MACFA/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A452G230_CAPHI/430-572             ..................................................................................................LQAQIHGLP...VP...PT..P..GL..--.LS..L.A..A.TSASDS.....................................................--L.KP.EQL.DVE..........................EEGRPG...TAIfhaag..........glaqsAP...................................................HQQ..PP..PP..........PSDALLDLHFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
H2PJ06_PONAB/426-578                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2U3WIF6_ODORO/225-344             ..................................................................................................IQARAHGLP...AL...AS..L..--..GT.VD..L.G..V.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLNDM......................LLDD...............TVSPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
B0QYS6_HUMAN/335-487                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B4T9H3_SERDU/329-510             ..................................................................................................MQAHLHGLP...SN...SP..S..GL..NP.TD..L.M..A.PYIKQEtspeeklshpqiqahhqpqhlpqn....qaqphqhhflpqnhlqpqgqaqpqpR--.--.---.--Qlp.....................plpQHLQPQ...PPI....................QF...................................................PAV..GS..SQ..........PFDYAQSLDL...........----CDGI..pGF.S.D..SM.-....--......SGLADLggldvhg.......rrgelgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3Q0RTE4_AMPCI/237-384             ..................................................................................................MQARLHGLS...SS...--..S..GI..SA.LT..S.D..P.SLLQQQ.....................................................STV.PQ.SSQ.SLPpnaggas...........tqsllgpaAIGQPL...PASflsp............pssdSP...................................................AGL..TI..SS..........PLDLG-SLSF...........AELDDAPA...--.-.S..AL.Y....SD......VGLGDI......................LMDDg.............cALSPER.mGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A0Q3WUL3_AMAAE/315-454             ..................................................................................................MQARVHGLP...TS...SP..S..GV..NV.AE..L.A..Q.QVVKQEas................................................gdeGTL.EP.LLP.ALD..........................PESQPQ...PAL....................PP...................................................PPP..SP..YH..........QLDFTHSLSF...........---DDGSR...GF.P.D..SL.E....PGh....sASFPSLskke..............ldlmLMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A384B619_BALAS/196-315             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A226NL66_CALSU/280-405             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DLM..........................----PH...---....................-H...................................................TDL..SC..TT..........TLDLTDGTITfs......dnlGSVTEPAG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A3Q2DKX1_CYPVA/300-447             ..................................................................................................MQARLHGIQ...ASnniSS..G..LT..SD.VS..L.Q..H.QPE--Aph.................................................sgQSL.PT.NTA.VASslnl..................sglgGAAQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLSF...........AELDDPTA...--.-.S..AL.Y....PD......VGLGDI......................LMDDg.............cTLSPDR.mGGPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
G1TA90_RABIT/432-575                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.SRPgtat.................fhvagGPAQSA...PHQ....................QP...................................................PAP..PS..DA..........LLDLQ----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VSlsPRpaA--.-..-.-.--...-.-.-..-.----aaaasawrrspd..
A0A2I3SN03_PANTR/366-491             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHAEL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4WVH0_SERLL/329-510             ..................................................................................................MQAHMHGLP...SN...SP..S..GL..NP.TD..L.M..A.PYIKQEtspeeklshpqiqahhqpqhlpqn....qaqphqhhflpqnhlqpqgqaqpqpR--.--.---.--Qlp.....................plpQHLQPQ...PPI....................QF...................................................PAV..GS..SQ..........PFDYAQSLDL...........----CDGI..pGF.S.D..SM.-....--......SGLADLggldvhg.......rrgelgflMMDE...............PLSPMG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A093IYB9_DRYPU/249-414             .............svdyikrmqkdlqrsrdlenhsrrlemtnkqlllriqvsfpllfppsaplrphgqlspaqakgwarallplralkspganpsdkp---------...--...--..-..--..--.--..-.-..-.------.....................................................---.--.---.---..........................------...---....................--...................................................---..AP..PP..........QLNFSHSLSFddgs..rgsldSLEPSHSA...SF.P.S..L-.-....SK......KELDLM......................LMQD...............TMLPLA..SDPLFSA.MS..PE..ASK.A..S.S.RR...S.S.F..S.MED-a.............
A0A3B3R4C2_9TELE/238-352             ..................................................................................................IQARAHGLP...NM...AP..P..VL..GQ.VE..L.S..S.PLQSQP.....................................................-AL.PM.HQE.GSS..........................-GEYAQ...ST-....................--...................................................---..VS..AA..........AAAFSDPLTH...........--FTDF--...-F.G.A..TL.K....EE......QRLEHI......................LMDG...............PLSPFG..ADPLLSS.TS..PA..ASK.G..S.S.RR...S.S.F..S.TDEG..............
I3M6U9_ICTTR/354-478                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHQAEL...---....................--...................................................-AC..TS..LD..........LTDGTLAFSSs.........lGPTAEGAQ...AY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPAG.vTDPLLSS.VS..PG..ASK.A..S.S.RR...S.S.M..S.MEE-a.............
A0A2I2Y530_GORGO/196-315             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKRQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAVAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A287B431_PIG/391-516               ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGSEGNP...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2U4AI38_TURTR/225-344             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1S3MG30_SALSA/352-484             ..................................................................................................MQARAHGLT...TD...TS..A..-L..CS.TE..L.S..A.RGIKQE.....................................................PAL.GD.CHQ.DLYh........................vH-SQHQ..hHPA....................CT...................................................PDQ..VQ..YT..........TLELNDGASPyt......kghGGVSGDQR...PY.G.G..HL.-....-K......GALMDI......................LMDD...............TLSPVR.gGDPLLSS.VS..PG..ASK.D..S.S.CS...G.S.K..S.MEEN..............
A0A2Y9MKB2_DELLE/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQST...PHQ....................QP...................................................PAP..PS..DA..........LLDLHFPS--...........DHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2I4D0A8_9TELE/382-490             ..................................................................................................LQARHHGLS...SS...SS..P..HT..SS.PS..-.-..P.SLSVDP.....................................................HIL.-L.SPP.---..........................---LPH...PCL....................--...................................................---..-S..LM..........ELDEPQVVST...........VFSQDL--...-M.S.D..MV.L....PE.....lDSLGGL......................LIEE...............EGGEGV.lSDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
W5LNJ1_ASTMX/366-500                 ..................................................................................................MQARLHGLS...SN..lSS..S..GV..GA.D-..-.-..A.QFLQQQ.....................................................-QQ.QQ.RPQ.-ASggeplthlg........ldggvgpasSFLSPP...-PS....................AS...................................................PGL..GL..AA..........PLDLG-SLSF...........SELDDPA-...--.G.S..GL.Y....PD......VSLGDM......................LMEE..............cALSP--..-EHLLSS.NS..PG..ASK.S..S.S.RR...S.S.L..D.MDED..............
A0A3Q2X1U7_HAPBU/369-498             ..................................................................................................LQARVHGLS...SS...SS..N..SP..PP.KS..S.S..S.SLDPQTll.................................................spPLL.HP.FSS.---..........................---SSS...PPS....................SS...................................................SLV..TP..SL..........GLDALTFTDL...........DEPQGAAT...VF.S.P..DL.M....SD......MGLTDLngl................gglLMED..............gSGAGVM..SDPLLSC.G-..--..ASK.T..S.S.RR...S.S.F..S.MDED..............
A0A2R8Z8K1_PANPA/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A2R8Z8J6_PANPA/315-434             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...QLT....................-V...................................................SQG..PS..PE..........LCDQAIAFSDp.........lSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q4G502_NEOBR/250-409             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQhqqq..................qsspQAQQPQ...QPT....................LYqedinndylqr.............................iaaasgvpstaTVS..GP..QD..........HISGTDACTTfs......dplSHFTDF--...-F.T.T..TL.K....EE......HQLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A452QSM2_URSAM/158-277             ..................................................................................................LQARAHGLP...AL...AS..L..--..GT.VD..L.S..A.HVTKQQ.....................................................THL.EQ.NSV.DYC..........................-----Q...QLT....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..SL.K....EE......QRLNDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q4I4B7_NEOBR/271-397             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3B4GLB5_9CICH/330-406             ..................................................................................................MQACLHGLP...SN...SP..S..GL..NT.GD..I.M..G.SYIKQE.....................................................TSL.EE.NHS.HPQa........................qAHHQPQ...HLP....................HN...................................................QAH..PQ..AQ..........QHQFLSHTHF...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----hpqgqaq.......
A0A3B3QUD7_9TELE/363-491             ..................................................................................................MQARAHGLA...VV...AP..T..AL..CS.PE..L.A..N.RAIKQE.....................................................AVR.GD.CSQ.DLY..........................-HQQRH...AAS....................KP...................................................PGP..T-..--..........TLDLSDGTISf........snGPPTQGEP..sVY.S.I..AT.K....GS......SKLDSM......................LMDE...............AVSPAG.vEDPLLCC.VS..PG..VSK.D..N.S.RE...N.S.M..S.MEEN..............
G1TNA4_RABIT/328-480                 ..................................................................................................MQARVHGLP...TT...SP..S..GV..NM.AE..L.A..Q.QVVKQElpseegpgetl..............................mlgaevpdpetlPAL.PP.QAP.LP-..........................PPAQPQ...SPF....................--...................................................---..--..-H..........QLDFSHGLSF...........GGGGDEGP..pGY.P.E..PL.G....PEh....gSPFPSLskkd..............ldfmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A384AYL3_BALAS/381-506             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..S.RIIKQE.....................................................PAL.EN.CSQ.DLL..........................Q---Q-...---....................-H...................................................ADL..TC..TT..........TLDLTDGTITfn......nnfGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.iTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MEE-t.............
A0A2K5MGY3_CERAT/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-VDYCQ...---....................-Q...................................................LTV..SQ..GP..........TPELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGI......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
F6UXQ5_MACMU/390-515                 ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A2D0RW61_ICTPU/280-409             ..................................................................................................MQARAHGLA...VG...GS..S..AL..CS.TE..L.V..A.CAIKEE.....................................................PISyTS.CSS.---..........................-DLYTR...SHL....................SS...................................................PDH..SR..PT..........TLDLNNGTISy........sdSTTEEAET..eLY.A.S..HK.E....SS......TKLDDM......................FLEN...............TLSPVG.tSNLLLSS.GS..PT..HSN.D..S.S.RR...S.S.T..S.TEEQ..............
A0A3B3CJ40_ORYME/325-508             ..................................................................................................MQARLHGLP...NA...SP..S..GL..SL.PD..M.M..P.PYIKQEtspeenlphshpqvhhqphhlhhnh..aqpqpqqhhympqphlhpqdhmqpqtRQL.PP.LPP.---..........................-HLQPQ...QPI....................QY...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..pGF.S.D..GM.-....--......AGLGDLsgldvqm.......rrgdmgllMMDE...............PLSPMV..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A060Y6H8_ONCMY/304-447             ..................................................................................................MQAQLHGLS...SP...MS..H..GL.sSD.PS..L.L..Q.QQHLQQg...................................................dHKL.GP.SAG.EACsqtfl................slgaaAMAQPV...--Ltssp............pssdSP...................................................VVV..TI..SS..........PLDLG-SVSF...........TELDDP--...-S.N.A..GL.Y....LD......VGLGDI......................IMDEg.............yTLSPER..VDPLF-F.VS..PG..ASK.T..S.S.RG...S.S.F..S.MEED..............
A0A3Q7QVJ8_VULVU/429-570             ..................................................................................................LQAQIHGLP...VP...PT..P..GL..L-.-S..L.A..T.TSASD-.....................................................-SL.KP.EQL.DIE..........................EESRPG...TATfha..............aggS-...................................................---..--..AQsaphqhppvpPSDALLDLHFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgTLSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A2K5Q0R2_CEBCA/225-344             ..................................................................................................IQARTHGLP...TL...AS..L..--..GT.VD..L.G..A.HVTKQQ.....................................................-SH.PE.QNS.---..........................-V----...DYC....................QQ...................................................LTV..SQ..GR..........SLELCDQAIAfs......dplSYFTDL--...SF.S.A..AL.K....EE......QRLDGM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.L..S.SDDG..............
A0A2Y9T6Y9_PHYMC/196-315             ..................................................................................................IQARAHGLP...TL...AS..L..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDM......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A1S3MYX4_SALSA/279-423             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................KQQ.QQ.EPL.APQ..........................SQQGLQ...PPLyqeel..........ngeylQRtsm............................................pamvTGL..TD..QGq........gVVDGST---Tfs......dplSHFTDF--...-F.S.S..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
G1KB16_ANOCA/316-471                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQEtsgdegtpe...................................iqqqkqqqqQSL.PP.QPP.---..........................------...--Pqlhpele......aqqqhshFA...................................................PPQ..SP..YD..........QLDFTHSLSF...........---DDNSR...GF.H.D..SL.D....PSq....sVSFPSLskke..............ldlmLMED...............TMLPVA..SDPLFSA.VS..PE..ASK.A..S.S.RR...S.S.F..S.MED-t.............
F6Y0V4_CANLF/429-570                 ..................................................................................................LQAQIHGLP...VP...PT..P..GL..LS.--..L.A..T.TSASD-.....................................................-SL.KP.EQL.DIE..........................EESRPG...TATfhaag..........gsaqsAP...................................................HQH..PP..AP..........PSDALLDLHFp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv.....gglsgALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3P8QVG5_ASTCA/320-446             ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGEP-G...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............TLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A2I2ZPE6_GORGO/390-515             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PVL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEANQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3Q0S0J6_AMPCI/307-454             ..................................................................................................MQARLHGLS...SS...--..S..GI..SA.LT..S.D..P.SLLQQQ.....................................................STV.PQ.SSQ.SLPpnaggas...........tqsllgpaAIGQPL...PASflsp............pssdSP...................................................AGL..TI..SS..........PLDLG-SLSF...........AELDDAPA...--.-.S..AL.Y....SD......VGLGDI......................LMDDg.............cALSPER.mGEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
F7FDI1_MONDO/270-389                 ..................................................................................................IQARAHGLP...VL...SS..H..--..SA.ID..L.A..A.HTTNHQ.....................................................TYV.ED.NSV.DYS..........................-----Q...---....................-E...................................................LTL..AP..RS..........RIDLCDGSTAfs......yplSHFTDL--...SF.S.A..AL.K....EE......QRLDDI......................LLDD...............SISPFG..TDPLLSA.TS..PT..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A498N5F5_LABRO/346-471             ..................................................................................................IQARAHGLA...VA...SS..T..-L..CS.SE..L.A..P.RPIKQE.....................................................PVL.GD.CTQ.DMY..........................----PH...AHL....................SC...................................................PDI..GC..SS..........TLDLNDGTITfn.......dsST----ST..dAY.G.L..VT.K....AH.....gAKLDDI......................LMDD...............TLSSVA.tNDPLLTS.VS..SG..ASN.D..S.S.CK...D.S.V..S.MEEN..............
A0A3B5Q6U7_XIPMA/244-372             ..................................................................................................IQARAHGLT...VV...SS..P..SL..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSCTP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hmpADAGDS-A...HY.G.-..-N.S....RT......CKMKEL......................VRDN...............GLGPVS.pSDPLLSS.MS..PE..VSHpA..S.S.RH...S.S.S..S.S---ssmeek........
A0A093JJ64_STRCA/321-446             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................QHHADL...---....................--...................................................---..SC..TT..........TLDLTDGTITfs......dnlGNMTEPTG...TY.S.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A1V4K929_PATFA/390-515             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.EN.CNP.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPTG...TY.S.V..PP.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
G3N598_GASAC/315-386                 ..................................................................................................MQARIHGLP...SP...SP..S..AL..NP.PD..P.M..G.SYIKQE.....................................................TSP.EE.NLS.H-Sm.......................aqAHHHPQ...HLP....................QN...................................................LAH..PQ..VQ..........QHHFLQQSQL...........--------...--.-.-..--.-....--......------......................----...............------..-------.--..--..---.-..-.-.--...-.-.-..-.----hh............
I3LH97_PIG/279-437                   ............................................................vdyirrmqkdlqksrelenhsrrlemtnkqlwlriqel---------...--...--..-..--..--.--..-.-..-.-----Emqalllga.....................................evpdpeplPAL.PP.QAQ.LPP..........................PAQPPQ...---....................--...................................................-PP..SP..FH..........HLDFSHGLSF...........GGGGTEGP..pGY.P.E..PL.G....PEh....gSPFPNLskkd..............ldlmLLDD...............SLLPLA..SDPLFST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1S3SG08_SALSA/252-397             ..................................................................................................IQARAHGLP...SM...AT..A..-L..GT.VE..L.S..S.HLLKQQ.....................................................QQQ.PL.APQ.S--..........................-QQGPQ...PPL....................YQeelngeylqr..............................tsmpamttggvT--..--..-G..........VTDQGQGVVDcstt..fsdplSHFTDF--...-F.S.A..TL.K....EE......QRLDEI......................LMDN...............PLSPFG..TDPLLSA.GS..PD..ASK.D..S.S.HR...S.S.F..S.SDDG..............
A0A493SXR2_ANAPP/337-462             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PAL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNMTEPTG...TY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A1U8CN32_MESAU/326-467             ..................................................................................................LQAQIHGLP...VP...PT..P..GLlsLA.TS..S.G..S.DSLKPE.....................................................-QL.DI.EEE.GRPntas.................fhvsgGPVQNT...PQQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEegvmg.....glsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A1S3P4H3_SALSA/317-489             ..................................................................................................MQARLHGLP...SS...SP..S..GM..GS.GE..L.M..G.SYVKQEtspeeklqqqqqaqhqahaq.............gqqhlhhpqshhiqpqqgqpRQL.PP.LPP.---..........................-HLQPQ...LPL....................QY...................................................PAV..GS..SQ..........PFDFAQSLNL...........---CDG-V..pGY.P.E..GL.-....--......SGLGELgllgtqg.......rrgdlgflMMDE...............PLSPLG..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IED-t.............
A0A340X334_LIPVE/225-344             ..................................................................................................IQARAHGLP...TL...AS..R..--..GT.VD..L.G..A.HITKQQ.....................................................AHL.EQ.NSV.DYC..........................-----Q...QLV....................-L...................................................SQG..TS..PE..........LCDQAMAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLDDV......................LLDD...............TISPFG..TDPLLSA.TS..PA..VSK.E..S.S.RR...S.S.F..S.SDDG..............
A0A3Q2DE18_CYPVA/235-359             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PIL.GD.CPS.DIY..........................QHNCTP...---....................--...................................................-EM..SP..PT..........TLDLNNGTIT..........fDHIPADAG..dSY.G.-..-N.S....RT......CKMKEL......................VRDN...............SLGPVS.pSDPLLSS.MS..PD..VSH.N.vS.S.RH...SsS.S..S.MDE-k.............
A0A096LQ59_POEFO/325-506             ..................................................................................................MQAQLHGLP...SN...SP..S..AL..NP.SE..M.M..P.PYIKQEtspeqnfshaqaqalhqsqhi...........phnqaqpqqhhflpqahlhpqSQL.QP.QAR.QLPp.......................lpQHLPPQ...QPI....................QF...................................................PAV..GS..SQ..........PFDFVQSLDL...........----CDGI..hGF.S.D..GM.-....--......SGLGDLggldvqg.......rrgelgflMMDE...............PLSPMA..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3Q1F6I2_9TELE/352-475             ..................................................................................................MQARAHGLA...TA...SS..A..-L..CS.GE..L.G..P.RTIKQE.....................................................PAL.ED.CHQ.DLY..........................-TLHPH...HQH....................-H...................................................PAC..TS..EPp........gTLELSEGHSN...........----YPEG...HY.S.V..HS.K....PG......SKLNDI......................LMED...............TLSPVR.gGDPLLSS.VS..PD..ASK.D..S.S.RK...S.S.V..S.MDEN..............
A0A3P8XF41_ESOLU/300-411             ..................................................................................................MQARFHGLS...SS...MS..S..GL..CSdPS..L.Q..Q.HVHQGG.....................................................PTL.GP.SAE.D--..........................---QNL...---....................--...................................................---..-L..SL..........TLDLG-SLSF...........AELDETS-...--.N.A..GL.Y....TE......VGLGDI......................LMDEs.............cTLSPER..VGPLFS-.MS..PG..ASK.N..S.S.CR...S.S.F..S.MEED..............
A0A3B4XDL4_SERLL/251-418             ..................................................................................................IQARAHGLP...NM...AT..A..-L..GT.VE..L.S..T.HLLKQQ.....................................................QQQ.QQ.QQQ.QQQqqqqqq.............qqqqsspQ-----...---....................-Ahqaqqpqqpplyqedps.................sdylqrlavvagvpsipTAS..GP..QD..........HITGTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDEI......................LMDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.S---agg...........
A0A3B5PNX6_XIPMA/387-511             ..................................................................................................MQARAHGLA...IT...SS..A..-L..CS.AE..V.G..V.RPIKQE.....................................................PAL.ED.CQQ.DLY..........................-TLHPH...HQH....................-H...................................................PACtpEQ..PS..........TLELTEGHSN...........--FPDG--...HYgS.V..HG.K....AG......SKLNDI......................LMED...............NLSPVR.gGDPLLSS.VS..PD..TSK.D..S.S.RK...S.S.V..S.MDEN..............
A0A0R4IU64_DANRE/158-291             ..................................................................................................MQARLHGLS...SS...Q-..-..-L..SD.SL..T.Q..T.QTLTLEhnpn.............................................tdlsKTL.LS.ITQ.TTP.........................sSFLSPP...SST....................SS...................................................VGG..TV..TS..........PLELG-TLSF...........GELDDHTA..sVF.S.P..AL.M....AD......MGLGDI......................LMDDt.............gALSPVG.gADPLLSA.VS..PG..ASK.T..S.S.RR...S.S.F..S.M---..............
A0A383ZZ28_BALAS/432-574             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AK..TxA..S.DSLKPE.....................................................-QL.DV.EEE.GRPgtat.................fhaagGPAQST...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3B3ILR6_ORYLA/338-449             .................................................................................................q-QARQHGLL...SS...SS..V..--..--.-D..P.-..-.----QT.....................................................FLL.SP.FPP.PIS.........................sSFSLTS...LSL....................GE...................................................DAL..SF..VE..........QDDTLEACNVf.........sPDLM----...-C.D.L..GL.T....EM......HGLQGL......................LMED...............IQGGVA..SDPLVVC.G-..--..ASK.T..T.S.RS...S.S.F..S.MDED..............
I3KWP4_ORENI/348-474                 ..................................................................................................IQARAHGLT...VV...SS..P..TV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.ELY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......hipADAGDPG-...PY.G.S..SS.-....-A......CKMKEL......................VRDN...............SLGPIS.pSDPLLSS.MS..PDisSNI.D..S.H.HT...S.S.S..S.LEEK..............
A0A3B4A4G0_9GOBI/252-397             ..................................................................................................IQARAHGLP...NM...AA..P..-M..GS.VE..L.S..S.HLLKQQ.....................................................QQQ.QL.SPQ.---..........................AQAPPQ...PPL....................YQedpnvdylq................................riavvptlpnTGA..PQ..EH..........SMTTTDGCTTfs......dplSHFTDF--...-F.S.A..TL.K....EE......HRLDDI......................LIDD...............PLSPFG..TDPLLSA.GS..PG.aASK.D..S.S.RR...S.S.F..S.SAE-g.............
A0A2K6CP35_MACNE/321-473             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A3B5B6E5_9TELE/305-452             ..................................................................................................MQARLHGLS...TP...TSmsS..GL.sSD.PS..L.L.qQ.QAVPQS....................................................gQPL.PP.NAG.GASshnl..................lslgAIGQPL...PASflsp............pssdSP...................................................AGV..TI..SS..........PLDLG-SLTF...........AELDDTSA...--.-.S..AL.Y....PD......VGLGDI......................LMDEg.............cALSPER.vAEPLFSP.LS..PG..ASK.T..S.S.RR...S.S.L..E.MDED..............
A0A1U7RIP0_ALLSI/302-427             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RAIKQE.....................................................SVI.DN.CNP.DIV..........................QRRT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTDSSN...AY.N.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MED-t.............
A0A2K5JG89_COLAP/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DSLKPE.....................................................-QL.DI.EEE.GRPgaat.................fhvggGPAQNA...PHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A0Q3URF6_AMAAE/488-613             ..................................................................................................MQARAHGLS...LV...PS..T..GL..CS.PD..M.V..N.RVIKQE.....................................................PVL.DN.CNQ.DIM..........................PHHT--...---....................--...................................................-DL..SC..TT..........TLDLTDGTITfs......dnlGNVTEPAG...TY.G.V..PA.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.V..S.MED-t.............
A0A2K6U7Y4_SAIBB/333-485             ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPGLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K6P6V8_RHIRO/290-415             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PIL.EN.CSQ.DLL..........................QHHADL...---....................--...................................................---..TC..TT..........TLDLTDGTITfn......nnlGTGTEASQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
A0A3B4UE90_SERDU/248-374             ..................................................................................................IQARAHGLT...VV...SS..P..SV..CT.SE..L.M..A.RAIKQE.....................................................PVL.GD.CPS.DLY..........................QHSSAP...---....................--...................................................-DM..SP..PT..........TLDLNNGTITfd......qipEDAGDV-G...PY.G.-..-N.S....RT......CKMKEL......................VRDN...............TLSSIS.pTDPLLSS.MS..PD..VSN.N.vS.S.HH...S.S.T.sS.MEE-k.............
A0A2I3S1P9_PANTR/334-486             ..................................................................................................MQARVHGLP...TA...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PGh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A2K6V509_SAIBB/397-539             ..................................................................................................LQAQIHGLP...VP...PT..P..GL.lSL.AT..TsA..S.DS----.....................................................--L.KP.EQL.DIEeegrpga............atfhvagGPAQNA...SHQ....................QP...................................................PAP..PS..DA..........LLDLH----Fp.........sDHLGDLGD...PF.H.-..--.-....--......LGLEDI......................LMEEeegvv....gglsggALSPLRaaSDPLLSS.VS..PA..VSK.A..S.S.RR...S.S.F..S.MEEE..............
A0A3B3SLL4_9TELE/301-443             ..................................................................................................MQARLHGLP...NPm.gAP..L..AM..EQ.VA..L.Q..Q.QVGPAPppsllll.......................................dgtggetKSL.AQ.AAA.PP-..........................AFLSPP...SPN....................LG...................................................VGV..TV..GS..........PLDLG-TLSF...........AELDEPQA...--.N.T..GL.Y....TG......VGLEDI......................LMDEg.............cVLSPPG.aADPLFAA.VS..PG..PSK.T..N.S.RR...S.S.I..D.MEED..............
G1QYE3_NOMLE/332-484                 ..................................................................................................MQARVHGLP...TT...SP..S..GM..NM.AE..L.A..Q.QVVKQElpseegpgeal..............................mlgaevpdpeplPAL.PP.QAP.LPL..........................-PTQPP...---....................--...................................................---..SP..FH..........HLDFSHSLSF...........GGREDEGP..pGY.P.E..PL.A....PEh....gSPFPSLskkd..............ldlmLLDD...............SLLPLA..SDPLLST.MS..PE..ASK.A..S.S.RR...S.S.F..S.MEEG..............
A0A1L8EZJ2_XENLA/395-512             ..................................................................................................MQAQLHGMN...GN...PP..A..C-..NP.MD..-.-..-.-TLKSE.....................................................PTA.MA.MPT.FQ-..........................-SASPQ...PP-....................--...................................................---..-N..PS..........ALDLG-TLHFtd.......plSDLVDQDL...SF.H.L..SL.T....GD......SAIADI......................LMDD...............ALSPLG.gADPLLSS.VF..PQ..ASK.T..S.S.RH...S.S.F..S.MEDD..............
A0A493TU12_ANAPP/305-424             ..................................................................................................IQARAHGLP...VI...SS..L..--..SA.VD..L.A..A.QVIKQQ.....................................................-SY.PE.ENS.VDY..........................SQQMPL...---....................--...................................................---..AH..GQ..........NSDVCDGSTAfs......dplSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TVSPFG..ADPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A1U8D2E2_ALLSI/262-381             ..................................................................................................IQARAHGLP...VM...SS..L..--..AA.VD..L.A..A.QVIKQQ.....................................................-TY.PE.ENV.---..........................-IDYSQ...QMA....................-L...................................................THG..PS..SD..........ICDGSIAFSDp.........lSHFTDL--...SF.S.A..AL.K....EE......QRLEEI......................LLDD...............TISPFG..TDPLLSS.TS..PA..ASK.E..S.S.RR...S.S.F..S.TDDG..............
A0A3Q3RWW1_9TELE/396-522             ..................................................................................qaqqhhflpqnhlhpq---------...--...--..-..--..--.--..-.-..G.QAQPQP.....................................................RQL.PS.LP-.---..........................QHLQPQ...PPI....................QY...................................................PAV..GS..SQ..........SFDFAHSLDL...........----CDGI..pSF.S.D..GM.-....--......SGLGDLsgldtqg.......rrgemgflMMDE...............PLSPMV..GDPLLSA.MS..PE..ASV.D..S.S.RR...S.S.F..S.IEDG..............
A0A3Q7R5Q7_VULVU/375-500             ..................................................................................................MQARAHGLS...LI...PS..T..GL..CS.PD..L.V..N.RIIKQE.....................................................PTL.EN.CNQ.DLL..........................QHHADL...P--....................--...................................................---..-C..TT..........TLDLTDGSITfn......nnlGAGTESSQ...AY.S.V..PT.K....MG......SKLEDI......................LMDD...............TLSPVG.vTDPLLSS.VS..PG..ASK.T..S.S.RR...S.S.M..S.MEE-t.............
#=GC SS_cons                         ..................................................................................................HHHHH-XXX...XX...XX..X..XX..XX.XX..X.X..X.XXXXXX.....................................................XXX.XX.XXX.XXX..........................XXXXXX...---....................--...................................................---..XX..XX..........XXXXXXXXXXXX......XXXXXXXXXXX...XX.X.X..XX.X....XX......XXXXXX......................XXXX...............XXXXXX.XXXXXXXX.XX..XX..XXX.X..X.X.XX...X.X.X..X.XXX-X.............
#=GC seq_cons                        ..................................................................................................hQARsHGLs...sh...so..s..sl..ss.s-..L.s..s.cllKQE.....................................................stL.ts.psp.t..............................tts.....................................................................................ss..ss..........sLDhspuh.t...........uths-.s....sa.u.s..sh.p.....t......spLc-l......................LMDD...............oLSPlu..oDPLLSo.sS..Ps..ASK.s..S.S.RR...S.S.h..S.MEEt..............
//
DBGET integrated database retrieval system