GenomeNet

Database: Pfam
Entry: DUF3580
LinkDB: DUF3580
Original site: DUF3580 
#=GF ID   DUF3580
#=GF AC   PF12117.9
#=GF DE   Protein of unknown function (DUF3580)
#=GF PI   DUF_B2046;
#=GF AU   Assefa S;0000-0003-2178-533X
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   PFAM-B_2046 (release 23.0)
#=GF GA   25.00 25.00;
#=GF TC   47.40 272.10;
#=GF NC   24.00 20.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 47079205 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR021972;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This domain is found in viruses, and is about 120 amino acids in
#=GF CC   length. It is found in association with Pfam:PF01057.
#=GF SQ   2
#=GS Q84365_MUMIP/601-721  AC Q84365.1
#=GS NS1_MUMIP/552-672     AC P03134.1
Q84365_MUMIP/601-721             AKWGKVPDWSENWAEPKVPTPINLLGSARSPFTTPKSTPLSQNYALTPLASDLEDLALEPWSTPNTPVAGTAETQNTGEAGSKACQDGQLSPTWSEIEEDLRACFGAEPLKKDFSEPLNLD
NS1_MUMIP/552-672                AKWGKVPDWSENWAEPKVPTPINLLGSARSPFTTPKSTPLSQNYALTPLASDLEDLALEPWSTPNTPVAGTAETQNTGEAGSKACQDGQLSPTWSEIEEDLRACFGAEPLKKDFSEPLNLD
#=GC seq_cons                    AKWGKVPDWSENWAEPKVPTPINLLGSARSPFTTPKSTPLSQNYALTPLASDLEDLALEPWSTPNTPVAGTAETQNTGEAGSKACQDGQLSPTWSEIEEDLRACFGAEPLKKDFSEPLNLD
//
DBGET integrated database retrieval system